Diablo (diablo, IAP-binding mitochondrial protein)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Diablo (diablo, IAP-binding mitochondrial protein) Rattus norvegicus

Analyze

Symbol:

Diablo

Name:

diablo, IAP-binding mitochondrial protein

RGD ID:

1310885

Description:

Predicted to be involved in several processes, including activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c; intrinsic apoptotic signaling pathway in response to oxidative stress; and neuron apoptotic process. Predicted to act upstream of or within activation of cysteine-type endopeptidase activity involved in apoptotic process. Located in cytosol and mitochondrion. Human ortholog(s) of this gene implicated in autosomal dominant nonsyndromic deafness 64. Orthologous to human DIABLO (diablo IAP-binding mitochondrial protein); INTERACTS WITH (-)-epigallocatechin 3-gallate; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

diablo homolog (Drosophila); diablo homolog, mitochondrial; LOC288753; MGC105680; Smac

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	12	33,055,784 - 33,070,400 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	33,055,263 - 33,070,387 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	34,234,556 - 34,249,178 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	12	34,845,907 - 34,860,529 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	146,213,188 - 146,214,531 (+)	NCBI	Rnor_WKY
Rnor_6.0	12	38,490,230 - 38,503,344 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	38,490,230 - 38,503,330 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	40,372,113 - 40,385,227 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	34,196,347 - 34,209,633 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	34,059,734 - 34,073,021 (+)	NCBI
Celera	12	34,742,122 - 34,755,405 (+)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal dominant nonsyndromic deafness (ISO)

autosomal dominant nonsyndromic deafness 64 (ISO)

brain ischemia (ISO)

genetic disease (ISO)

Hearing Loss (ISO)

Huntington's disease (ISO)

lung non-small cell carcinoma (ISO)

Myocardial Reperfusion Injury (ISO)

Osteoarthritis, Hip (ISO)

Prostatic Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (EXP,ISO)

(R,R,R)-alpha-tocopherol (ISO)

1,2-dimethylhydrazine (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,4-dinitrotoluene (EXP)

2,6-di-tert-butyl-4-methylphenol (EXP)

2,6-dinitrotoluene (EXP)

2-methylcholine (ISO)

3-phenylprop-2-enal (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

4-nitrophenol (ISO)

5-fluorouracil (ISO)

6-bromoindirubin-3'-oxime (ISO)

acetylsalicylic acid (ISO)

adenosine (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

alvocidib (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

aspartame (ISO)

bisphenol A (EXP,ISO)

Bisphenol A diglycidyl ether (ISO)

Bisphenol B (ISO)

bisphenol F (EXP)

bortezomib (ISO)

Butylparaben (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

cannabidiol (ISO)

cerivastatin (ISO)

chromium(6+) (ISO)

chrysazin (ISO)

cinchocaine (EXP)

cisplatin (ISO)

cladribine (ISO)

clobetasol (ISO)

clofibric acid (EXP)

corosolic acid (ISO)

curcumin (ISO)

cyclosporin A (EXP)

cylindrospermopsin (ISO)

cyproconazole (EXP)

D-glucose (ISO)

desferrioxamine B (ISO)

dexamethasone (ISO)

diallyl disulfide (ISO)

Diallyl sulfide (ISO)

diarsenic trioxide (ISO)

diazinon (EXP)

dibenziodolium (EXP)

dieldrin (EXP)

diepoxybutane (ISO)

dioscin (ISO)

dioxygen (ISO)

dipyridamole (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

Echinocystic acid (ISO)

entinostat (ISO)

epichlorohydrin (ISO)

epoxiconazole (EXP)

fenthion (ISO)

flutamide (EXP,ISO)

folic acid (ISO)

fomepizole (ISO)

fumonisin B1 (ISO)

glucose (ISO)

hydrogen peroxide (EXP,ISO)

indole-3-methanol (EXP)

ivermectin (ISO)

kainic acid (EXP)

lamivudine (ISO)

LGK974 (ISO)

melatonin (ISO)

metformin (ISO)

minocycline (EXP,ISO)

mono(2-ethylhexyl) phthalate (ISO)

monosodium L-glutamate (ISO)

morin (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

nitric oxide (ISO)

ochratoxin A (ISO)

p-menthan-3-ol (ISO)

paclitaxel (ISO)

paracetamol (EXP,ISO)

paraquat (EXP,ISO)

perfluorooctanoic acid (EXP,ISO)

phenethyl isothiocyanate (ISO)

phenobarbital (EXP)

propylparaben (ISO)

pterostilbene (ISO)

pyrroloquinoline quinone (ISO)

quercetin (ISO)

resveratrol (ISO)

rotenone (ISO)

SB 431542 (ISO)

simvastatin (ISO)

sirolimus (ISO)

sodium dichromate (ISO)

sorafenib (ISO)

spermine (ISO)

streptozocin (ISO)

T-2 toxin (ISO)

thapsigargin (ISO)

thioacetamide (EXP)

trichostatin A (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vincristine (ISO)

vitamin E (ISO)

vorinostat (ISO)

zidovudine (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

activation of cysteine-type endopeptidase activity involved in apoptotic process (ISO)

activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c (IBA,ISO)

intrinsic apoptotic signaling pathway in response to oxidative stress (IBA,ISO)

neuron apoptotic process (IBA,ISO)

positive regulation of apoptotic process (ISO)

Cellular Component

CD40 receptor complex (ISO)

cytoplasm (IDA)

cytoplasm (ISO)

cytoplasmic side of plasma membrane (ISO)

cytosol (IDA)

cytosol (ISO)

mitochondrion (IBA)

mitochondrion (IDA)

mitochondrion (ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Dynamic changes of the anti- and pro-apoptotic proteins Bcl-w, Bcl-2, and Bax with Smac/Diablo mitochondrial release after photothrombotic ring stroke in rats.	Hu XL, etal., Eur J Neurosci. 2004 Sep;20(5):1177-88.
3.	Expression of apoptosome pathway-related transcripts in non-small cell lung cancer.	Krepela E, etal., J Cancer Res Clin Oncol. 2006 Jan;132(1):57-68. Epub 2005 Oct 18.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Nuclear translocation of X-linked inhibitor of apoptosis (XIAP) determines cell fate after hypoxia ischemia in neonatal brain.	Russell JC, etal., J Neurochem. 2008 Aug;106(3):1357-70. Epub 2008 May 13.

Additional References at PubMed

PMID:11604410	PMID:12011074	PMID:12477932	PMID:12967350	PMID:14623868	PMID:14651853	PMID:15567514	PMID:15689551	PMID:15814844	PMID:15882989	PMID:16085184	PMID:18338251
PMID:18614015	PMID:19107361	PMID:20552279	PMID:20614026	PMID:21155217	PMID:22535253	PMID:24305822	PMID:33310074

Genomics

Comparative Map Data

Diablo
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	12	33,055,784 - 33,070,400 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	33,055,263 - 33,070,387 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	34,234,556 - 34,249,178 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	12	34,845,907 - 34,860,529 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	146,213,188 - 146,214,531 (+)	NCBI	Rnor_WKY
Rnor_6.0	12	38,490,230 - 38,503,344 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	38,490,230 - 38,503,330 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	40,372,113 - 40,385,227 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	34,196,347 - 34,209,633 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	34,059,734 - 34,073,021 (+)	NCBI
Celera	12	34,742,122 - 34,755,405 (+)	NCBI		Celera
Cytogenetic Map	12	q16	NCBI

DIABLO
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	122,207,662 - 122,227,456 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	12	122,207,663 - 122,227,456 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	122,692,209 - 122,712,003 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	121,258,162 - 121,276,552 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	12	122,281,555 - 122,301,434 (-)	NCBI		Celera
Cytogenetic Map	12	q24.31	NCBI
HuRef	12	119,653,145 - 119,672,846 (-)	NCBI		HuRef
CHM1_1	12	122,660,505 - 122,680,373 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	122,203,450 - 122,223,242 (-)	NCBI		T2T-CHM13v2.0

Diablo
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	123,649,393 - 123,664,825 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	123,647,828 - 123,662,239 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	123,511,330 - 123,524,164 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	123,509,765 - 123,524,176 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	123,961,339 - 123,974,173 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	123,771,948 - 123,784,782 (-)	NCBI		MGSCv36	mm8
Celera	5	120,598,178 - 120,610,967 (-)	NCBI		Celera
Cytogenetic Map	5	F	NCBI

Diablo
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955482	6,354,146 - 6,365,344 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955482	6,354,502 - 6,364,424 (+)	NCBI	ChiLan1.0	ChiLan1.0

DIABLO
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	12	123,176,411 - 123,196,359 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	123,176,405 - 123,196,359 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	12	119,808,718 - 119,829,378 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

DIABLO
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	7,125,320 - 7,144,884 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	7,125,405 - 7,144,308 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	7,285,592 - 7,304,497 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	7,376,808 - 7,396,382 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	7,375,359 - 7,396,458 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	7,309,065 - 7,327,956 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	7,400,008 - 7,418,867 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	7,355,700 - 7,374,608 (+)	NCBI		UU_Cfam_GSD_1.0

Diablo
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	157,210,485 - 157,217,683 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936558	2,260,359 - 2,268,941 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936558	2,260,459 - 2,268,941 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DIABLO
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	30,498,900 - 30,520,070 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	30,498,885 - 30,519,846 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	32,338,122 - 32,359,079 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DIABLO
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	117,555,328 - 117,580,419 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	117,552,145 - 117,579,553 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	127,751,294 - 127,771,548 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Diablo
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	22,441,541 - 22,457,075 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624747	22,441,533 - 22,457,056 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Diablo
50 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	92
Count of miRNA genes:	76
Interacting mature miRNAs:	89
Transcripts:	ENSRNOT00000047861
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	19835789	38193007	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	24139202	36638073	Rat
1556747	Calcic1	Intracellular calcium level QTL 1		3.6	platelet calcium amount (VT:0010500)	platelet intracellular calcium level (CMO:0000922)	12	28064433	40130419	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	28064433	45899022	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	28064433	46669029	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	28064557	40218380	Rat
631829	Alc6	Alcohol consumption QTL 6	4.7		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	28607526	37691617	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	32103174	45899022	Rat

Markers in Region

BF397544

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	33,065,764 - 33,065,968 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	38,498,714 - 38,498,917	NCBI	Rnor6.0
Rnor_5.0	12	40,380,597 - 40,380,800	UniSTS	Rnor5.0
RGSC_v3.4	12	34,205,002 - 34,205,205	UniSTS	RGSC3.4
Celera	12	34,750,775 - 34,750,978	UniSTS
RH 3.4 Map	12	580.8	UniSTS
Cytogenetic Map	12	q16	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	35	41	28	14	28		3	66	32	41	11
Low		8	16	13	5	13	8	8	8	3			8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001008292	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089284	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC086366	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219826	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000228	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000047861 ⟹ ENSRNOP00000046476

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	33,055,263 - 33,070,387 (+)	Ensembl
Rnor_6.0 Ensembl	12	38,490,230 - 38,503,330 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000102277 ⟹ ENSRNOP00000079537

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	33,057,084 - 33,065,673 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000115798 ⟹ ENSRNOP00000089260

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	33,057,084 - 33,063,895 (+)	Ensembl

RefSeq Acc Id:

NM_001008292 ⟹ NP_001008293

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	12	33,057,111 - 33,070,395 (+)	NCBI
Rnor_6.0	12	38,490,230 - 38,503,344 (+)	NCBI
Rnor_5.0	12	40,372,113 - 40,385,227 (+)	NCBI
RGSC_v3.4	12	34,196,347 - 34,209,633 (+)	RGD
Celera	12	34,742,122 - 34,755,405 (+)	RGD

Sequence:

show sequence

CCGGCGTCCGTCCGCCGCGGGATGGCGGCTCTGAGGAGTTGGATGACTCGGAGCGTAACCTTTC
TGTTCAGGTACGGACAGCGTTTTCCTGTCTCTGCTAACTCTAAGAAACGCTGTTTCTCAGAATT
GATAAGACCATGGCACAAAACTATGTTGACTGGATTCGGTGTGACACTGTGCGCCGTTCCTATT
GCTCAGAAATCAGAGCCTCAGTCTCTCAGCAACGAAGCACTGATGAGGAGGGCTGTGTCTTTGG
TAACGGACAGCACCTCTACCTTTCTGTCTCAAACCACGTACGCACTGATCGAAGCCATCACCGA
GTATACTAAGGCTGTCTACACGTTAGTGTCTCTGTACCGACAGTATACAAGCTTGCTGGGGAAG
ATGAATTCCCAGGAGGAGGATGAGGTGTGGCAGGTGATCATAGGAGCCAGAGTTGAGATGACTT
CAAAGCAGCAGGAGTACTTGAAGCTGGAGACCACGTGGATGACAGCAGTCAGCCTTTCAGAGAT
GGCTGCGGAGGCTGCCTATCAGACTGGAGCAGATCAGGCCTCTATAACCGCCAGGAATCACATC
CAGTTGGTGAAGTCGCAGGTGCAGGAGGTGCGCCAGCTCTCCCAGAAGGCGGAAACCAAGCTGG
CAGAAGTGCAGACACAAGAGCTGCGCCAGAAAACACAGGAAGCGAGCGATGAGGCAGCGGACCA
GGAAGAGGAGGCCTACCTACGAGAAGATTGAGGGCTCGAGCCCAGTGCCCTGTCCATCCACTCT
GTGGGGAAAGCAGGTGCATGACATCCACCCAGTGACGTCCCAACTGCAGAAGCTGACCGGTTCT
GCCATTGACAGTCAGACCAGAGCCTTTGCGAGCTGCGCCTGGCCCCTTCTCTCTGCTCGCAGCC
TCTCTGGGCCTGGCTCTGCACTGTCCCTCACACAGCTTCTCTCTTGATCTTTTACCTCACTCCC
AAAGCACTTCACCAACCGGGGCCAATGGAGGAGGGGCCTTTTCTGCCACACCCTTAAGTTCAAT
AGCTGTTTAACTCCAGTTTTTACTGTTACTCAGATGTTCAAGTATGAATTACTGCTTGCTCCTC
CACAGGGAAGCTTGTCTGGTTTGTAACATTTCTTTGTGTTTATAATGTCCTTTCTCCCTGTGAG
CACAGCTCAGCTAAGGCGTTACTCAGTGTGAACAGTTCCCCTGGTGCTCCCCACAGCACCTTCT
CCAACACGTGCTTCTTGTTCGTTCCTTTTTTGAATTTCTCTGCTGTATCCAAAGGAAGAGAAGT
TTGGTGTTTGCATTAAAAAAAAAAAAAAAGTCAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039089284 ⟹ XP_038945212

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	12	33,055,784 - 33,070,400 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001008293	(Get FASTA)	NCBI Sequence Viewer
	XP_038945212	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH86366	(Get FASTA)	NCBI Sequence Viewer
	EDM13632	(Get FASTA)	NCBI Sequence Viewer
	EDM13633	(Get FASTA)	NCBI Sequence Viewer
	EDM13634	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_001008293 ⟸ NM_001008292

- UniProtKB:

Q5RK17 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAALRSWMTRSVTFLFRYGQRFPVSANSKKRCFSELIRPWHKTMLTGFGVTLCAVPIAQKSEPQ
SLSNEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLVSLYRQYTSLLGKMNSQEED
EVWQVIIGARVEMTSKQQEYLKLETTWMTAVSLSEMAAEAAYQTGADQASITARNHIQLVKSQV
QEVRQLSQKAETKLAEVQTQELRQKTQEASDEAADQEEEAYLRED

hide sequence

RefSeq Acc Id:

ENSRNOP00000046476 ⟸ ENSRNOT00000047861

RefSeq Acc Id:	XP_038945212 ⟸ XM_039089284
- Peptide Label:	isoform X1

RefSeq Acc Id:

ENSRNOP00000089260 ⟸ ENSRNOT00000115798

RefSeq Acc Id:

ENSRNOP00000079537 ⟸ ENSRNOT00000102277

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5RK17-F1-model_v2	AlphaFold	Q5RK17	1-237	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698631

Promoter ID:

EPDNEW_R9155

Type:

multiple initiation site

Name:

Diablo_1

Description:

diablo, IAP-binding mitochondrial protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	38,490,224 - 38,490,284	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310885	AgrOrtholog
BioCyc Gene	G2FUF-19315	BioCyc
Ensembl Genes	ENSRNOG00000029197	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000046476	ENTREZGENE
	ENSRNOP00000046476.3	UniProtKB/TrEMBL
	ENSRNOP00000079537.1	UniProtKB/TrEMBL
	ENSRNOP00000089260.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000047861	ENTREZGENE
	ENSRNOT00000047861.5	UniProtKB/TrEMBL
	ENSRNOT00000102277.1	UniProtKB/TrEMBL
	ENSRNOT00000115798.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.58.70	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7305418	IMAGE-MGC_LOAD
InterPro	Smac_DIABLO	UniProtKB/TrEMBL
	Smac_DIABLO-like	UniProtKB/TrEMBL
KEGG Report	rno:288753	UniProtKB/TrEMBL
MGC_CLONE	MGC:105680	IMAGE-MGC_LOAD
NCBI Gene	288753	ENTREZGENE
PANTHER	DIABLO HOMOLOG, MITOCHONDRIAL	UniProtKB/TrEMBL
	PTHR32247	UniProtKB/TrEMBL
Pfam	Smac_DIABLO	UniProtKB/TrEMBL
PhenoGen	Diablo	PhenoGen
Superfamily-SCOP	Smac_Diablo	UniProtKB/TrEMBL
UniProt	A0A8I5ZR69_RAT	UniProtKB/TrEMBL
	A0A8I6A7T3_RAT	UniProtKB/TrEMBL
	F7F5S4_RAT	UniProtKB/TrEMBL
	Q5RK17	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-02	Diablo	diablo, IAP-binding mitochondrial protein	Diablo	diablo homolog (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Diablo	diablo homolog (Drosophila)	Diablo_predicted	diablo homolog (Drosophila) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Diablo_predicted	diablo homolog (Drosophila) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM