Symbol:
Polr2j
Name:
RNA polymerase II subunit J
RGD ID:
1310198
Description:
Predicted to enable LRR domain binding activity. Predicted to contribute to DNA-directed RNA polymerase activity. Predicted to be involved in transcription by RNA polymerase II. Predicted to be located in nucleus. Predicted to be part of RNA polymerase II, core complex. Orthologous to several human genes including POLR2J (RNA polymerase II subunit J); PARTICIPATES IN RNA polymerase II transcription pathway; Huntington's disease pathway; purine metabolic pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; cadmium dichloride.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
DNA-directed RNA polymerase II subunit RPB11-a; LOC288588; polymerase (RNA) II (DNA directed) polypeptide J; polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa; polymerase (RNA) II subunit J
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
POLR2J (RNA polymerase II subunit J) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Polr2j (polymerase (RNA) II (DNA directed) polypeptide J) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Polr2j (RNA polymerase II subunit J) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
POLR2J (RNA polymerase II subunit J) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Polr2j (RNA polymerase II subunit J) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
POLR2J (RNA polymerase II subunit J) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
POLR2J (RNA polymerase II subunit J) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Polr2j (RNA polymerase II subunit J) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
POLR2J2 (RNA polymerase II subunit J2) HGNC
EggNOG, Ensembl, OrthoDB, Panther
Homo sapiens (human):
POLR2J3 (RNA polymerase II subunit J3) HGNC
Ensembl, Panther
Homo sapiens (human):
POLR2J3-UPK3BL2 (POLR2J3-UPK3BL2 readthrough) HGNC
OrthoDB
Homo sapiens (human):
CALN1 (calneuron 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
POLR2J (RNA polymerase II subunit J)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Polr2j (polymerase (RNA) II (DNA directed) polypeptide J)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
POLR2J2 (RNA polymerase II subunit J2)
Alliance
DIOPT (Hieranoid|OMA|PANTHER)
Homo sapiens (human):
POLR2J3 (RNA polymerase II subunit J3)
Alliance
DIOPT (Hieranoid|OMA|PANTHER)
Danio rerio (zebrafish):
polr2j (polymerase (RNA) II (DNA directed) polypeptide J)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
rpb-11
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RPB11
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Rpb11
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
polr2j
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 26,179,649 - 26,185,201 (-) NCBI GRCr8 mRatBN7.2 12 20,543,038 - 20,548,590 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 20,543,038 - 20,548,594 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 21,683,016 - 21,688,571 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 22,295,721 - 22,301,276 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 21,361,193 - 21,366,748 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 23,587,222 - 23,592,774 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 23,587,222 - 23,592,774 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 25,587,572 - 25,593,124 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 21,658,406 - 21,663,958 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 21,649,381 - 21,654,560 (-) NCBI Celera 12 22,311,433 - 22,316,972 (-) NCBI Celera Cytogenetic Map 12 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Polr2j Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:1320958 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of POLR2J mRNA CTD PMID:17942748 Polr2j Rat 17beta-estradiol multiple interactions ISO RGD:1320957 6480464 [Progesterone co-treated with Estradiol] results in decreased expression of POLR2J mRNA CTD PMID:17404688 Polr2j Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO RGD:1320958 6480464 2,2',4,4'-tetrabromodiphenyl ether affects the expression of POLR2J mRNA CTD PMID:30294300 Polr2j Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1320958 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of POLR2J mRNA CTD PMID:17942748 Polr2j Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of POLR2J mRNA CTD PMID:33387578 Polr2j Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1320958 6480464 Tetrachlorodibenzodioxin affects the expression of POLR2J mRNA CTD PMID:21570461 Polr2j Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of POLR2J mRNA CTD PMID:21215274|PMID:34747641 Polr2j Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1320958 6480464 Tetrachlorodibenzodioxin results in increased expression of POLR2J mRNA CTD PMID:18796159 Polr2j Rat 2-hydroxypropanoic acid decreases expression ISO RGD:1320957 6480464 Lactic Acid results in decreased expression of POLR2J mRNA CTD PMID:30851411 Polr2j Rat atrazine decreases expression ISO RGD:1320957 6480464 Atrazine results in decreased expression of POLR2J mRNA CTD PMID:22378314 Polr2j Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1320958 6480464 Diethylhexyl Phthalate results in increased expression of POLR2J mRNA CTD PMID:33754040 Polr2j Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of POLR2J mRNA CTD PMID:25181051 Polr2j Rat bisphenol A decreases expression ISO RGD:1320958 6480464 bisphenol A results in decreased expression of POLR2J mRNA CTD PMID:33221593 Polr2j Rat bisphenol A decreases expression ISO RGD:1320957 6480464 bisphenol A results in decreased expression of POLR2J mRNA CTD PMID:29275510 Polr2j Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of POLR2J gene CTD PMID:28505145 Polr2j Rat bisphenol F decreases expression ISO RGD:1320958 6480464 bisphenol F results in decreased expression of POLR2J mRNA CTD PMID:38685157 Polr2j Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of POLR2J mRNA CTD PMID:33453195 Polr2j Rat cobalt dichloride decreases expression ISO RGD:1320957 6480464 cobaltous chloride results in decreased expression of POLR2J mRNA CTD PMID:19376846 Polr2j Rat copper(II) sulfate decreases expression ISO RGD:1320957 6480464 Copper Sulfate results in decreased expression of POLR2J mRNA CTD PMID:19549813 Polr2j Rat dibutyl phthalate decreases expression ISO RGD:1320958 6480464 Dibutyl Phthalate results in decreased expression of POLR2J mRNA CTD PMID:17361019 Polr2j Rat doxorubicin increases expression ISO RGD:1320957 6480464 Doxorubicin results in increased expression of POLR2J mRNA CTD PMID:29803840 Polr2j Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of POLR2J mRNA CTD PMID:24136188 Polr2j Rat mechlorethamine decreases expression ISO RGD:1320958 6480464 Mechlorethamine results in decreased expression of POLR2J mRNA CTD PMID:17107856 Polr2j Rat methidathion increases expression ISO RGD:1320958 6480464 methidathion results in increased expression of POLR2J mRNA CTD PMID:34813904 Polr2j Rat pinosylvin increases expression ISO RGD:1320957 6480464 pinosylvin results in increased expression of POLR2J mRNA CTD PMID:23333577 Polr2j Rat potassium dichromate decreases expression ISO RGD:1320957 6480464 Potassium Dichromate results in decreased expression of POLR2J protein CTD PMID:23718831 Polr2j Rat progesterone multiple interactions ISO RGD:1320957 6480464 [Progesterone co-treated with Estradiol] results in decreased expression of POLR2J mRNA CTD PMID:17404688 Polr2j Rat rac-lactic acid decreases expression ISO RGD:1320957 6480464 Lactic Acid results in decreased expression of POLR2J mRNA CTD PMID:30851411 Polr2j Rat resveratrol increases expression ISO RGD:1320958 6480464 resveratrol results in increased expression of POLR2J mRNA CTD PMID:22610192 Polr2j Rat rimonabant multiple interactions ISO RGD:1320958 6480464 Rimonabant inhibits the reaction [Dietary Fats results in decreased expression of POLR2J mRNA] CTD PMID:19030233 Polr2j Rat tamoxifen increases expression ISO RGD:1320957 6480464 Tamoxifen results in increased expression of POLR2J mRNA CTD PMID:15849065 Polr2j Rat tert-butyl hydroperoxide decreases expression ISO RGD:1320957 6480464 tert-Butylhydroperoxide results in decreased expression of POLR2J mRNA CTD PMID:15336504 Polr2j Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of POLR2J mRNA CTD PMID:34492290 Polr2j Rat titanium dioxide decreases methylation ISO RGD:1320958 6480464 titanium dioxide results in decreased methylation of POLR2J promoter CTD PMID:35295148 Polr2j Rat trans-pinosylvin increases expression ISO RGD:1320957 6480464 pinosylvin results in increased expression of POLR2J mRNA CTD PMID:23333577 Polr2j Rat triphenyl phosphate affects expression ISO RGD:1320957 6480464 triphenyl phosphate affects the expression of POLR2J mRNA CTD PMID:37042841 Polr2j Rat triptonide increases expression ISO RGD:1320958 6480464 triptonide results in increased expression of POLR2J mRNA CTD PMID:33045310 Polr2j Rat tungsten increases expression ISO RGD:1320958 6480464 Tungsten results in increased expression of POLR2J mRNA CTD PMID:30912803 Polr2j Rat valproic acid increases expression ISO RGD:1320957 6480464 Valproic Acid results in increased expression of POLR2J mRNA CTD PMID:23179753 Polr2j Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of POLR2J mRNA CTD PMID:23034163
Imported Annotations - KEGG (archival)
Polr2j Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 26,179,649 - 26,185,201 (-) NCBI GRCr8 mRatBN7.2 12 20,543,038 - 20,548,590 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 20,543,038 - 20,548,594 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 21,683,016 - 21,688,571 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 22,295,721 - 22,301,276 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 21,361,193 - 21,366,748 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 23,587,222 - 23,592,774 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 23,587,222 - 23,592,774 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 25,587,572 - 25,593,124 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 21,658,406 - 21,663,958 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 21,649,381 - 21,654,560 (-) NCBI Celera 12 22,311,433 - 22,316,972 (-) NCBI Celera Cytogenetic Map 12 q12 NCBI
POLR2J Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 102,473,128 - 102,478,922 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 102,473,128 - 102,478,922 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 102,113,575 - 102,119,369 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 101,900,552 - 101,906,386 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 101,707,623 - 101,713,077 NCBI Celera 7 97,125,817 - 97,127,251 (-) NCBI Celera Cytogenetic Map 7 q22.1 NCBI HuRef 7 96,703,776 - 96,705,210 (-) NCBI HuRef CHM1_1 7 102,043,567 - 102,049,407 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 103,790,727 - 103,796,555 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 101,473,848 - 101,479,682 (-) NCBI
Polr2j Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 136,145,545 - 136,151,801 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 136,145,485 - 136,151,801 (+) Ensembl GRCm39 Ensembl GRCm38 5 136,116,691 - 136,122,947 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 136,116,631 - 136,122,947 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 136,592,561 - 136,598,817 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 136,401,364 - 136,407,566 (+) NCBI MGSCv36 mm8 Celera 5 133,137,045 - 133,143,301 (+) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 75.8 NCBI
Polr2j Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955456 15,146,713 - 15,151,311 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955456 15,146,713 - 15,151,320 (+) NCBI ChiLan1.0 ChiLan1.0
POLR2J Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 7,707,426 - 7,710,882 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 9,402,443 - 9,405,898 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 7,527,599 - 7,531,054 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 7,527,645 - 7,531,266 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 7,496,109 - 7,499,564 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 7,459,175 - 7,462,631 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 7,622,887 - 7,626,343 (+) NCBI UU_Cfam_GSD_1.0
Polr2j Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 132,136,578 - 132,140,703 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936543 1,895,828 - 1,899,904 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936543 1,895,827 - 1,899,918 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
POLR2J Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 9,812,441 - 9,816,656 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 9,812,746 - 9,816,657 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 9,695,498 - 9,699,407 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
POLR2J Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 28 10,742,636 - 10,748,084 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 28 10,742,570 - 10,749,382 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666070 5,660,475 - 5,666,066 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Polr2j
.
Predicted Target Of
Count of predictions: 150 Count of miRNA genes: 113 Interacting mature miRNAs: 122 Transcripts: ENSRNOT00000001941 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631560 Apr1 Acute phase response QTL 1 6.1 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 19144362 46669029 Rat 61443 Btemp2 Thermal response to stress QTL 2 3.3 0.000094 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 12 15025183 20794014 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 61324 Eae5 Experimental allergic encephalomyelitis QTL 5 14 nervous system integrity trait (VT:0010566) percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402) 12 19610870 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 61331 Eau2 Experimental allergic uveoretinitis QTL 2 0.0005 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 12 8525423 28064601 Rat 737822 Alc10 Alcohol consumption QTL 10 2.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 12 19610870 40218516 Rat 2293684 Bmd26 Bone mineral density QTL 26 4.4 0.0002 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 12 15872653 32974238 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 1300157 Rf21 Renal function QTL 21 4.4 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 12 9318216 32103380 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 1298081 Cia25 Collagen induced arthritis QTL 25 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610889 35682913 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1331755 Bp219 Blood pressure QTL 219 3.041 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 28064557 Rat 70213 Niddm27 Non-insulin dependent diabetes mellitus QTL 27 3.72 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 19835789 38193007 Rat 2306789 Ean6 Experimental allergic neuritis QTL 6 4.9 nervous system integrity trait (VT:0010566) experimental autoimmune neuritis severity score (CMO:0001528) 12 19610870 24139202 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 7411643 Foco20 Food consumption QTL 20 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 20328819 46669029 Rat 5684888 Pia42 Pristane induced arthritis QTL 42 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610870 42828880 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 1331786 Kidm11 Kidney mass QTL 11 3.571 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 12 11073825 24234895 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 61416 Pia4 Pristane induced arthritis QTL 4 8.4 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 12 13635523 30827399 Rat 631521 Pia12 Pristane induced arthritis QTL 12 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 20259417 23672083 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 61421 Cia12 Collagen induced arthritis QTL 12 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 13635523 35682913 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2293086 Iddm30 Insulin dependent diabetes mellitus QTL 30 3.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 8449490 28302290 Rat 631543 Bp83 Blood pressure QTL 83 5.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 15550826 38478808 Rat
RH132174
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 12 26,179,313 - 26,179,627 (+) Marker Load Pipeline mRatBN7.2 12 20,542,702 - 20,543,016 (+) MAPPER mRatBN7.2 Rnor_6.0 12 23,586,887 - 23,587,200 NCBI Rnor6.0 Rnor_5.0 12 25,587,237 - 25,587,550 UniSTS Rnor5.0 RGSC_v3.4 12 21,658,071 - 21,658,384 UniSTS RGSC3.4 Celera 12 22,311,098 - 22,311,411 UniSTS RH 3.4 Map 12 298.11 UniSTS Cytogenetic Map 12 q12 UniSTS
RH134388
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 12 26,179,925 - 26,180,670 (+) Marker Load Pipeline mRatBN7.2 12 20,543,314 - 20,544,059 (+) MAPPER mRatBN7.2 Rnor_6.0 12 23,587,499 - 23,588,243 NCBI Rnor6.0 Rnor_5.0 12 25,587,849 - 25,588,593 UniSTS Rnor5.0 RGSC_v3.4 12 21,658,683 - 21,659,427 UniSTS RGSC3.4 Celera 12 22,311,710 - 22,312,454 UniSTS RH 3.4 Map 12 300.5 UniSTS Cytogenetic Map 12 q12 UniSTS
GDB:4585697
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 20,545,862 - 20,545,946 (+) MAPPER mRatBN7.2 Rnor_6.0 12 23,590,047 - 23,590,130 NCBI Rnor6.0 Rnor_5.0 12 25,590,397 - 25,590,480 UniSTS Rnor5.0 RGSC_v3.4 12 21,661,231 - 21,661,314 UniSTS RGSC3.4 Celera 12 22,314,258 - 22,314,341 UniSTS Cytogenetic Map 12 q12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001941 ⟹ ENSRNOP00000001941
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 20,543,038 - 20,548,590 (-) Ensembl Rnor_6.0 Ensembl 12 23,587,222 - 23,592,774 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000098210 ⟹ ENSRNOP00000097097
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 20,543,198 - 20,548,594 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000116070 ⟹ ENSRNOP00000096502
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 20,543,038 - 20,548,538 (-) Ensembl
RefSeq Acc Id:
NM_001105921 ⟹ NP_001099391
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 26,179,649 - 26,185,201 (-) NCBI mRatBN7.2 12 20,543,038 - 20,548,590 (-) NCBI Rnor_6.0 12 23,587,222 - 23,592,774 (-) NCBI Rnor_5.0 12 25,587,572 - 25,593,124 (-) NCBI RGSC_v3.4 12 21,658,406 - 21,663,958 (-) RGD Celera 12 22,311,433 - 22,316,972 (-) RGD
Sequence:
GGGCGGAAGGCGGCTGCGGGTTGGTGTCTGGGAGTGAGAGCGCCTTGCTAGGATGAACGCCCCTCCGGCCTTCGAGTCGTTCTTGCTCTTCGAGGGCGAGAAGAAAATCACCATTAACAAGGACACCA
hide sequence
RefSeq Acc Id:
NP_001099391 ⟸ NM_001105921
- UniProtKB:
D3ZQI0 (UniProtKB/TrEMBL), A6J085 (UniProtKB/TrEMBL), A0A8I6GMD7 (UniProtKB/TrEMBL)
- Sequence:
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
hide sequence
Ensembl Acc Id:
ENSRNOP00000001941 ⟸ ENSRNOT00000001941
Ensembl Acc Id:
ENSRNOP00000097097 ⟸ ENSRNOT00000098210
Ensembl Acc Id:
ENSRNOP00000096502 ⟸ ENSRNOT00000116070
RGD ID: 13698541 Promoter ID: EPDNEW_R9064 Type: initiation region Name: Polr2j_1 Description: RNA polymerase II subunit J SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 23,592,749 - 23,592,809 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-07-21
Polr2j
RNA polymerase II subunit J
Polr2j
polymerase (RNA) II subunit J
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-03-16
Polr2j
polymerase (RNA) II subunit J
Polr2j
polymerase (RNA) II (DNA directed) polypeptide J
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2009-10-22
Polr2j
polymerase (RNA) II (DNA directed) polypeptide J
Polr2j
polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-24
Polr2j
polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa
Polr2j
polymerase (RNA) II (DNA directed) polypeptide J
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Polr2j
polymerase (RNA) II (DNA directed) polypeptide J
Polr2j_predicted
polymerase (RNA) II (DNA directed) polypeptide J (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Polr2j_predicted
polymerase (RNA) II (DNA directed) polypeptide J (predicted)
Symbol and Name status set to approved
70820 APPROVED
