Symbol:
Itgb2
Name:
integrin subunit beta 2
RGD ID:
1305581
Description:
Contributes to cell adhesion molecule binding activity. Involved in several processes, including leukocyte migration involved in inflammatory response; positive regulation of NF-kappaB transcription factor activity; and positive regulation of nitric oxide biosynthetic process. Located in cell surface. Used to study nephritis and pneumonia. Biomarker of allergic rhinitis. Human ortholog(s) of this gene implicated in coronary restenosis; leukocyte adhesion deficiency; and leukocyte adhesion deficiency 1. Orthologous to human ITGB2 (integrin subunit beta 2); PARTICIPATES IN hypoxia inducible factor pathway; integrin mediated signaling pathway; Entamoebiasis pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 17beta-estradiol 3-benzoate.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Cd18; CD18 leukocyte adhesion molecule; integrin beta 2; integrin beta-2; integrin, beta 2; integrin, beta 2 (antigen CD18 (p95), lymphocyte function-associated antigen 1; integrin, beta 2 (antigen CD18 (p95), lymphocyte function-associated antigen 1); integrin, beta 2 (antigen CD18 (p95), lymphocyte function-associated antigen 1, macrophage antigen 1 (mac-1) beta subunit); macrophage antigen 1 (mac-1) beta subunit; macrophage antigen 1 (mac-1) beta subunit); MGC116306
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ITGB2 (integrin subunit beta 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Itgb2 (integrin beta 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Itgb2 (integrin subunit beta 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ITGB2 (integrin subunit beta 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ITGB2 (integrin subunit beta 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Itgb2 (integrin subunit beta 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ITGB2 (integrin subunit beta 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ITGB2 (integrin subunit beta 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Itgb2 (integrin subunit beta 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
IDI2 (isopentenyl-diphosphate delta isomerase 2) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
ITGB2 (integrin subunit beta 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Itgb2 (integrin beta 2)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Itgb2l (integrin beta 2-like)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Danio rerio (zebrafish):
itgb2 (integrin, beta 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pat-3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
mys
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
itgb2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 11,061,009 - 11,097,242 (-) NCBI GRCr8 mRatBN7.2 20 11,061,394 - 11,097,656 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 11,061,430 - 11,097,600 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 11,760,914 - 11,797,085 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 11,121,883 - 11,158,052 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 11,593,622 - 11,629,796 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 11,777,773 - 11,815,647 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 11,777,783 - 11,815,647 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 13,944,190 - 13,981,048 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 11,446,521 - 11,485,009 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 11,446,936 - 11,485,236 (-) NCBI Celera 20 12,564,941 - 12,601,097 (-) NCBI Celera Cytogenetic Map 20 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Itgb2 Rat autistic disorder ISO RGD:1313694 8554872 ClinVar Annotator: match by term: Autism ClinVar PMID:21681106|PMID:30208311 Itgb2 Rat autoimmune polyendocrine syndrome type 1 ISO RGD:1313694 8554872 ClinVar Annotator: match by term: Polyglandular autoimmune syndrome, type 1 ClinVar PMID:28492532 Itgb2 Rat cataract 9 multiple types ISO RGD:1313694 8554872 ClinVar Annotator: match by term: Cataract 9 multiple types ClinVar PMID:28492532 Itgb2 Rat developmental and epileptic encephalopathy 30 ISO RGD:1313694 8554872 ClinVar Annotator: match by term: Developmental and epileptic encephalopathy, 30 ClinVar PMID:28492532|PMID:8596935 Itgb2 Rat genetic disease ISO RGD:1313694 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:10886250|PMID:11703376|PMID:12488604|PMID:1346132|PMID:17875809|PMID:22134107|PMID:25514840|PMID:25703682|PMID:25741868|PMID:28492532|PMID:30412664|PMID:7143170|PMID:7686755|PMID:7705401 Itgb2 Rat homocystinuria ISO RGD:1313694 8554872 ClinVar Annotator: match by term: HYPERHOMOCYSTEINEMIA, THROMBOTIC, CBS-RELATED ClinVar PMID:10338090|PMID:12124992|PMID:28492532 Itgb2 Rat leukocyte adhesion deficiency ISO RGD:1313694 8554872 ClinVar Annotator: match by term: Leukocyte adhesion deficiency ClinVar Itgb2 Rat leukocyte adhesion deficiency 1 ISO RGD:1313694 8554872 ClinVar Annotator: match by term: Leukocyte adhesion deficiency 1 ClinVar PMID:10712675|PMID:10886250|PMID:11703376|PMID:11882363|PMID:12377933|PMID:12488604|PMID:1346132|PMID:1346613|PMID:1347532|PMID:14512306|PMID:1590804|PMID:16199547|PMID:16595236|PMID:1694220|PMID:17576681|PMID:17875809|PMID:18675632|PMID:19171538|PMID:1968911|PMID:20549317|PMID:20807363|PMID:21103413|PMID:21195692|PMID:22134107|PMID:24033266|PMID:24338230|PMID:24753537|PMID:25135596|PMID:25514840|PMID:25703682|PMID:25741868|PMID:25858935|PMID:26497373|PMID:26639818|PMID:27492259|PMID:28445705|PMID:28492532|PMID:29548898|PMID:30041527|PMID:30412664|PMID:30919141|PMID:32279896|PMID:33391282|PMID:36353617|PMID:6142255|PMID:7143170|PMID:7686755|PMID:7705401|PMID:7901025|PMID:9536098|PMID:9884339 Itgb2 Rat leukocyte adhesion deficiency 3 ISO RGD:1313694 8554872 ClinVar Annotator: match by term: Leukocyte adhesion deficiency 3 ClinVar PMID:25741868 Itgb2 Rat Neurodevelopmental Disorders ISO RGD:1313694 8554872 ClinVar Annotator: match by term: Neurodevelopmental disorder ClinVar PMID:25741868 Itgb2 Rat primary ciliary dyskinesia ISO RGD:1313694 8554872 ClinVar Annotator: match by term: Primary ciliary dyskinesia ClinVar PMID:28492532 Itgb2 Rat progressive myoclonus epilepsy ISO RGD:1313694 8554872 ClinVar Annotator: match by term: Progressive myoclonic epilepsy ClinVar PMID:28492532|PMID:8596935
Only show annotations with direct experimental evidence (0 objects hidden)
Itgb2 Rat (+)-catechin multiple interactions ISO RGD:1313694 6480464 Catechin inhibits the reaction [S100B protein results in increased expression of ITGB2 mRNA] CTD PMID:17103373 Itgb2 Rat (-)-Arctigenin decreases secretion ISO RGD:1313694 6480464 arctigenin results in decreased secretion of ITGB2 protein CTD PMID:29740324 Itgb2 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1313695 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ITGB2 mRNA CTD PMID:36331819 Itgb2 Rat (20S)-ginsenoside Rh1 multiple interactions ISO RGD:1313694 6480464 ginsenoside Rh1 inhibits the reaction [TNF protein results in increased expression of [ITGAL protein binds more ... CTD PMID:21875580 Itgb2 Rat (S)-ropivacaine multiple interactions ISO RGD:1313694 6480464 Ropivacaine inhibits the reaction [TNF protein results in increased expression of [ITGAM protein binds to more ... CTD PMID:9336308 Itgb2 Rat 1,1-dichloroethene increases expression ISO RGD:1313695 6480464 vinylidene chloride results in increased expression of ITGB2 mRNA CTD PMID:26682919 Itgb2 Rat 1,2-dimethylhydrazine increases expression ISO RGD:1313695 6480464 1,2-Dimethylhydrazine results in increased expression of ITGB2 mRNA CTD PMID:22206623 Itgb2 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of ITGB2 mRNA CTD PMID:25380136 Itgb2 Rat 1-naphthyl isothiocyanate multiple interactions ISO RGD:1313694 6480464 [1-Naphthylisothiocyanate co-treated with Cholic Acids] affects the expression of ITGB2 mRNA CTD PMID:27344345 Itgb2 Rat 1-naphthyl isothiocyanate increases response to substance ISO RGD:1313695 6480464 ITGB2 protein results in increased susceptibility to 1-Naphthylisothiocyanate CTD PMID:16614373|PMID:21070799 Itgb2 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:1313694 6480464 [Ethinyl Estradiol co-treated with Cholic Acids] affects the expression of ITGB2 mRNA CTD PMID:27344345 Itgb2 Rat 17beta-estradiol multiple interactions ISO RGD:1313694 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of ITGB2 mRNA; [Progesterone co-treated with more ... CTD PMID:20226447|PMID:30165855 Itgb2 Rat 17beta-estradiol decreases expression ISO RGD:1313695 6480464 Estradiol results in decreased expression of ITGB2 mRNA CTD PMID:39298647 Itgb2 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of ITGB2 mRNA CTD PMID:32741896 Itgb2 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of ITGB2 mRNA CTD PMID:32741896 Itgb2 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2,2',4,4'-tetrabromodiphenyl ether results in increased expression of ITGB2 mRNA CTD PMID:27291303 Itgb2 Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO RGD:1313695 6480464 [Flame Retardants results in increased abundance of 2,2',4,4'-tetrabromodiphenyl ether] which results in increased expression of more ... CTD PMID:38995820 Itgb2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1313695 6480464 Tetrachlorodibenzodioxin affects the expression of ITGB2 mRNA CTD PMID:16962184 Itgb2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ITGB2 mRNA CTD PMID:34747641 Itgb2 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:1313695 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of ITGB2 mRNA CTD PMID:38648751 Itgb2 Rat 2-nitrotoluene increases expression EXP 6480464 2-nitrotoluene results in increased expression of ITGB2 mRNA CTD PMID:16460773 Itgb2 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:1313694 6480464 tetrabromobisphenol A results in decreased expression of ITGB2 protein CTD PMID:21623697 Itgb2 Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO RGD:1313694 6480464 bisindolylmaleimide I inhibits the reaction [ITGB2 protein results in increased activity of RAP1A protein] CTD PMID:16963453 Itgb2 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of ITGB2 mRNA CTD PMID:28522335 Itgb2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1313694 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Itgb2 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4,4'-diaminodiphenylmethane results in increased expression of ITGB2 mRNA CTD PMID:25380136 Itgb2 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1313695 6480464 bisphenol S results in increased expression of ITGB2 mRNA CTD PMID:30951980 Itgb2 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1313695 6480464 bisphenol S results in decreased expression of ITGB2 mRNA CTD PMID:39298647 Itgb2 Rat 5-azacytidine decreases expression ISO RGD:1313694 6480464 Azacitidine results in decreased expression of ITGB2 mRNA CTD PMID:19194470 Itgb2 Rat 5-fluorouracil decreases expression ISO RGD:1313694 6480464 Fluorouracil results in decreased expression of ITGB2 CTD PMID:15485462 Itgb2 Rat 9-cis-retinoic acid multiple interactions ISO RGD:1313694 6480464 Dimethyl Sulfoxide promotes the reaction [Alitretinoin results in increased expression of ITGB2 protein] CTD PMID:15964820 Itgb2 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of ITGB2 mRNA CTD PMID:31881176 Itgb2 Rat acetylsalicylic acid multiple interactions ISO RGD:1313694 6480464 Aspirin results in decreased expression of [ITGA2B protein binds to ITGB2 protein] CTD PMID:15140583 Itgb2 Rat acrolein increases expression ISO RGD:1313695 6480464 Acrolein results in increased expression of ITGB2 mRNA CTD PMID:18515264 Itgb2 Rat acrolein multiple interactions ISO RGD:1313694 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Itgb2 Rat acteoside multiple interactions ISO RGD:1313694 6480464 acteoside inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine results in increased expression of ITGB2 protein]; acteoside inhibits more ... CTD PMID:16393473 Itgb2 Rat aflatoxin B1 decreases expression ISO RGD:1313694 6480464 Aflatoxin B1 results in decreased expression of ITGB2 mRNA CTD PMID:22100608 Itgb2 Rat all-trans-retinoic acid increases expression ISO RGD:1313694 6480464 Tretinoin results in increased expression of ITGB2 mRNA; Tretinoin results in increased expression of ITGB2 more ... CTD PMID:15498508|PMID:16322068|PMID:16581781|PMID:18055984|PMID:33167477 Itgb2 Rat all-trans-retinoic acid multiple interactions ISO RGD:1313694 6480464 [GABPA protein binds to EP300 protein] promotes the reaction [Tretinoin results in increased expression of more ... CTD PMID:16581781|PMID:18055984 Itgb2 Rat alpha-pinene multiple interactions ISO RGD:1313694 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Itgb2 Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of ITGB2 mRNA CTD PMID:35163327 Itgb2 Rat antirheumatic drug decreases expression ISO RGD:1313694 6480464 Antirheumatic Agents results in decreased expression of ITGB2 mRNA CTD PMID:24449571 Itgb2 Rat aristolochic acid A increases expression ISO RGD:1313694 6480464 aristolochic acid I results in increased expression of ITGB2 mRNA; aristolochic acid I results in more ... CTD PMID:33212167 Itgb2 Rat arsenous acid increases expression ISO RGD:1313694 6480464 Arsenic Trioxide results in increased expression of ITGB2 mRNA CTD PMID:20458559 Itgb2 Rat asbestos decreases expression ISO RGD:1313694 6480464 Asbestos results in decreased expression of ITGB2 mRNA CTD PMID:22398240 Itgb2 Rat atorvastatin calcium multiple interactions ISO RGD:1313694 6480464 Atorvastatin inhibits the reaction [TNF results in increased expression of ITGB2] CTD PMID:12615677 Itgb2 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of ITGB2 gene CTD PMID:35440735 Itgb2 Rat Azoxymethane multiple interactions ISO RGD:1313695 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of ITGB2 more ... CTD PMID:29950665 Itgb2 Rat benzene decreases expression ISO RGD:1313694 6480464 Benzene results in decreased expression of ITGB2 mRNA CTD PMID:16188091|PMID:20036648 Itgb2 Rat benzo[a]pyrene increases expression ISO RGD:1313695 6480464 Benzo(a)pyrene results in increased expression of ITGB2 mRNA CTD PMID:22228805 Itgb2 Rat benzo[a]pyrene affects methylation ISO RGD:1313694 6480464 Benzo(a)pyrene affects the methylation of ITGB2 5' UTR; Benzo(a)pyrene affects the methylation of ITGB2 intron CTD PMID:27901495|PMID:30157460 Itgb2 Rat benzo[a]pyrene decreases methylation ISO RGD:1313694 6480464 Benzo(a)pyrene results in decreased methylation of ITGB2 promoter CTD PMID:27901495 Itgb2 Rat benzo[a]pyrene increases expression ISO RGD:1313694 6480464 Benzo(a)pyrene metabolite results in increased expression of ITGB2 mRNA; Benzo(a)pyrene results in increased expression of more ... CTD PMID:22316170|PMID:26314263 Itgb2 Rat bis(2-chloroethyl) sulfide increases expression ISO RGD:1313695 6480464 Mustard Gas results in increased expression of ITGB2 mRNA CTD PMID:18955075 Itgb2 Rat bisphenol A increases expression ISO RGD:1313694 6480464 bisphenol A results in increased expression of ITGB2 mRNA; bisphenol A results in increased expression more ... CTD PMID:14555285 Itgb2 Rat bisphenol A increases expression ISO RGD:1313695 6480464 bisphenol A results in increased expression of ITGB2 mRNA CTD PMID:32156529|PMID:38701888 Itgb2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ITGB2 mRNA CTD PMID:34973380 Itgb2 Rat bisphenol A multiple interactions ISO RGD:1313694 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ITGB2 gene; [INS protein co-treated more ... CTD PMID:28628672|PMID:31601247 Itgb2 Rat bisphenol A decreases expression ISO RGD:1313695 6480464 bisphenol A results in decreased expression of ITGB2 mRNA CTD PMID:25594700 Itgb2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ITGB2 mRNA CTD PMID:25181051 Itgb2 Rat bisphenol F decreases expression ISO RGD:1313695 6480464 bisphenol F results in decreased expression of ITGB2 mRNA CTD PMID:30951980|PMID:38685157 Itgb2 Rat bleomycin A2 increases expression ISO RGD:1313695 6480464 Bleomycin results in increased expression of ITGB2 mRNA CTD PMID:30825431 Itgb2 Rat bleomycin A2 multiple interactions ISO RGD:1313695 6480464 Cannabidiol analog inhibits the reaction [Bleomycin results in increased expression of ITGB2 mRNA]; lenabasum inhibits more ... CTD PMID:30825431 Itgb2 Rat bromochloroacetic acid increases expression EXP 6480464 bromochloroacetic acid results in increased expression of ITGB2 mRNA CTD PMID:16460773 Itgb2 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of ITGB2 mRNA CTD PMID:24136188 Itgb2 Rat butanal decreases expression ISO RGD:1313694 6480464 butyraldehyde results in decreased expression of ITGB2 mRNA CTD PMID:26079696 Itgb2 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of ITGB2 promoter CTD PMID:22457795 Itgb2 Rat cadmium dichloride increases expression ISO RGD:1313694 6480464 Cadmium Chloride results in increased expression of ITGB2 mRNA CTD PMID:38568856 Itgb2 Rat Calcimycin increases expression ISO RGD:1313694 6480464 Calcimycin results in increased expression of ITGB2 protein CTD PMID:8094364 Itgb2 Rat cannabidiol multiple interactions ISO RGD:1313695 6480464 Cannabidiol analog inhibits the reaction [Bleomycin results in increased expression of ITGB2 mRNA] CTD PMID:30825431 Itgb2 Rat carbon nanotube affects expression ISO RGD:1313695 6480464 Nanotubes, Carbon affects the expression of ITGB2 mRNA CTD PMID:23845593 Itgb2 Rat carbon nanotube increases expression ISO RGD:1313695 6480464 Nanotubes, Carbon analog results in increased expression of ITGB2 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Itgb2 Rat carnosic acid decreases expression ISO RGD:1313695 6480464 salvin results in decreased expression of ITGB2 protein CTD PMID:35926579 Itgb2 Rat cerivastatin multiple interactions ISO RGD:1313694 6480464 cerivastatin inhibits the reaction [TNF results in increased expression of ITGB2] CTD PMID:12615677 Itgb2 Rat chlorogenic acid decreases expression EXP 6480464 Chlorogenic Acid results in decreased expression of ITGB2 protein CTD PMID:21414398 Itgb2 Rat chlorogenic acid multiple interactions EXP 6480464 Chlorogenic Acid inhibits the reaction [lipopolysaccharide, E. coli O26-B6 results in increased expression of ITGB2 more ... CTD PMID:21414398 Itgb2 Rat chlorpyrifos increases expression ISO RGD:1313695 6480464 Chlorpyrifos results in increased expression of ITGB2 mRNA CTD PMID:32715474 Itgb2 Rat choline multiple interactions ISO RGD:1313695 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Itgb2 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of ITGB2 mRNA CTD PMID:22023808 Itgb2 Rat cobalt dichloride increases expression ISO RGD:1313694 6480464 cobaltous chloride results in increased expression of ITGB2 mRNA CTD PMID:26314263 Itgb2 Rat crocidolite asbestos increases expression ISO RGD:1313694 6480464 Asbestos, Crocidolite results in increased expression of ITGB2 mRNA CTD PMID:23634900 Itgb2 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of ITGB2 mRNA CTD PMID:27523638 Itgb2 Rat cyclosporin A decreases expression ISO RGD:1313694 6480464 Cyclosporine results in decreased expression of ITGB2 mRNA CTD PMID:25562108 Itgb2 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of ITGB2 mRNA CTD PMID:23640034 Itgb2 Rat deoxynivalenol increases expression ISO RGD:1313695 6480464 deoxynivalenol results in increased expression of ITGB2 mRNA CTD PMID:22968694 Itgb2 Rat dexamethasone multiple interactions ISO RGD:1313694 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Itgb2 Rat dextran sulfate increases expression ISO RGD:1313695 6480464 Dextran Sulfate results in increased expression of ITGB2 protein CTD PMID:32272095 Itgb2 Rat dextran sulfate multiple interactions ISO RGD:1313695 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of ITGB2 more ... CTD PMID:29950665|PMID:32272095 Itgb2 Rat diarsenic trioxide increases expression ISO RGD:1313694 6480464 Arsenic Trioxide results in increased expression of ITGB2 mRNA CTD PMID:20458559 Itgb2 Rat diazinon increases methylation ISO RGD:1313694 6480464 Diazinon results in increased methylation of ITGB2 gene CTD PMID:22964155 Itgb2 Rat diclofenac increases expression ISO RGD:1313695 6480464 Diclofenac results in increased expression of ITGB2 mRNA CTD PMID:26934552 Itgb2 Rat dimethyl sulfoxide multiple interactions ISO RGD:1313694 6480464 Dimethyl Sulfoxide promotes the reaction [alitretinoin results in increased expression of ITGB2 protein] CTD PMID:15964820 Itgb2 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression more ... CTD PMID:33729688 Itgb2 Rat diuron decreases expression ISO RGD:1313694 6480464 Diuron results in decreased expression of ITGB2 mRNA CTD PMID:35967413 Itgb2 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of ITGB2 mRNA CTD PMID:31464424 Itgb2 Rat Enterolactone decreases secretion ISO RGD:1313694 6480464 2,3-bis(3'-hydroxybenzyl)butyrolactone results in decreased secretion of ITGB2 protein CTD PMID:29740324 Itgb2 Rat epoxiconazole decreases expression ISO RGD:1313695 6480464 epoxiconazole results in decreased expression of ITGB2 mRNA CTD PMID:35436446 Itgb2 Rat erianin multiple interactions ISO RGD:1313695 6480464 Erianin inhibits the reaction [Dextran Sulfate results in increased expression of ITGB2 protein] CTD PMID:32272095 Itgb2 Rat ethanol multiple interactions ISO RGD:1313695 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of ITGB2 mRNA CTD PMID:30517762 Itgb2 Rat ethanol increases expression ISO RGD:1313695 6480464 Ethanol results in increased expression of ITGB2 mRNA CTD PMID:30319688 Itgb2 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of ITGB2 mRNA CTD PMID:24136188 Itgb2 Rat folic acid multiple interactions ISO RGD:1313695 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Itgb2 Rat formaldehyde decreases expression ISO RGD:1313694 6480464 Formaldehyde results in decreased expression of ITGB2 mRNA CTD PMID:23649840 Itgb2 Rat Formylmethionyl-leucyl-phenylalanine methyl ester multiple interactions ISO RGD:1313694 6480464 resveratrol analog inhibits the reaction [formylmethionyl-leucyl-phenylalanine methyl ester results in increased expression of ITGB2 protein] CTD PMID:9605577 Itgb2 Rat Formylmethionyl-leucyl-phenylalanine methyl ester increases expression ISO RGD:1313694 6480464 formylmethionyl-leucyl-phenylalanine methyl ester results in increased expression of ITGB2 protein CTD PMID:9605577 Itgb2 Rat fulvestrant multiple interactions ISO RGD:1313694 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ITGB2 gene CTD PMID:31601247 Itgb2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ITGB2 mRNA CTD PMID:22061828 Itgb2 Rat ginsenoside C-K multiple interactions ISO RGD:1313694 6480464 ginsenoside compound K inhibits the reaction [TNF protein results in increased expression of [ITGAL protein more ... CTD PMID:21875580 Itgb2 Rat ginsenoside Rb1 multiple interactions EXP 6480464 ginsenoside Rb1 inhibits the reaction [Lipopolysaccharides results in increased expression of ITGB2 protein] CTD PMID:17655881 Itgb2 Rat graphene oxide increases expression ISO RGD:1313695 6480464 graphene oxide analog results in increased expression of ITGB2 mRNA; graphene oxide results in increased more ... CTD PMID:33227293 Itgb2 Rat griseofulvin affects expression ISO RGD:1313695 6480464 Griseofulvin affects the expression of ITGB2 mRNA CTD PMID:12735108 Itgb2 Rat GSK-J4 decreases expression ISO RGD:1313694 6480464 GSK-J4 results in decreased expression of ITGB2 mRNA CTD PMID:29301935 Itgb2 Rat Heliotrine increases expression EXP 6480464 heliotrine results in increased expression of ITGB2 mRNA CTD PMID:34185104 Itgb2 Rat hydroquinone decreases expression ISO RGD:1313695 6480464 hydroquinone results in decreased expression of ITGB2 protein CTD PMID:17464197 Itgb2 Rat hydroquinone decreases expression ISO RGD:1313694 6480464 hydroquinone results in decreased expression of ITGB2 mRNA CTD PMID:19148301 Itgb2 Rat hydroquinone increases expression ISO RGD:1313695 6480464 hydroquinone results in increased expression of ITGB2 protein CTD PMID:21664406 Itgb2 Rat indirubin increases expression ISO RGD:1313694 6480464 indirubin results in increased expression of ITGB2 protein CTD PMID:16115123 Itgb2 Rat indometacin multiple interactions ISO RGD:1313695 6480464 Indomethacin results in increased expression of [ITGAM protein binds to ITGB2 protein] CTD PMID:10761979 Itgb2 Rat indometacin increases expression EXP 6480464 Indomethacin results in increased expression of ITGB2 mRNA CTD PMID:36868495 Itgb2 Rat indometacin multiple interactions ISO RGD:1313694 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Itgb2 Rat indometacin affects response to substance ISO RGD:1313695 6480464 ITGB2 protein affects the susceptibility to Indomethacin CTD PMID:10486359 Itgb2 Rat iron atom increases expression ISO RGD:1313694 6480464 Iron deficiency results in increased expression of ITGB2 mRNA CTD PMID:20368581 Itgb2 Rat iron(0) increases expression ISO RGD:1313694 6480464 Iron deficiency results in increased expression of ITGB2 mRNA CTD PMID:20368581 Itgb2 Rat isoflavones affects expression ISO RGD:1313694 6480464 Isoflavones affects the expression of ITGB2 mRNA CTD PMID:16365062 Itgb2 Rat isotretinoin increases expression ISO RGD:1313694 6480464 Isotretinoin results in increased expression of ITGB2 mRNA CTD PMID:20436886 Itgb2 Rat josamycin decreases expression ISO RGD:1313694 6480464 Josamycin results in decreased expression of ITGB2 protein CTD PMID:8096833 Itgb2 Rat josamycin multiple interactions ISO RGD:1313694 6480464 Ribomunyl inhibits the reaction [Josamycin results in decreased expression of ITGB2 protein] CTD PMID:8096833 Itgb2 Rat L-methionine multiple interactions ISO RGD:1313695 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Itgb2 Rat leukotriene B4 increases expression EXP 6480464 Leukotriene B4 results in increased expression of ITGB2 protein CTD PMID:14716214 Itgb2 Rat leukotriene B4 multiple interactions ISO RGD:1313694 6480464 Leukotriene B4 results in increased expression of [ITGAM protein binds to ITGB2 protein]; LY 255283 more ... CTD PMID:7473568 Itgb2 Rat lidocaine multiple interactions ISO RGD:1313694 6480464 Lidocaine inhibits the reaction [TNF protein results in increased expression of [ITGAM protein binds to more ... CTD PMID:9336308 Itgb2 Rat lipopolysaccharide multiple interactions ISO RGD:1313694 6480464 ITGB2 protein affects the reaction [Lipopolysaccharides results in increased expression of TNF protein] CTD PMID:12538815 Itgb2 Rat lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of ITGB2 protein CTD PMID:17655881 Itgb2 Rat lipopolysaccharide multiple interactions EXP 6480464 ginsenoside Rb1 inhibits the reaction [Lipopolysaccharides results in increased expression of ITGB2 protein]; notoginsenoside R1 more ... CTD PMID:17655881 Itgb2 Rat lipopolysaccharide increases expression ISO RGD:1313695 6480464 Lipopolysaccharides results in increased expression of ITGB2 mRNA CTD PMID:10975854|PMID:27339419 Itgb2 Rat LY294002 multiple interactions ISO RGD:1313694 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [ITGB2 protein results in increased activity of RAP1A protein] CTD PMID:16963453 Itgb2 Rat methotrexate increases expression ISO RGD:1313694 6480464 Methotrexate results in increased expression of ITGB2 mRNA CTD PMID:21678067 Itgb2 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of ITGB2 gene CTD PMID:35440735 Itgb2 Rat methyl methanesulfonate decreases expression ISO RGD:1313694 6480464 Methyl Methanesulfonate results in decreased expression of ITGB2 mRNA CTD PMID:23649840 Itgb2 Rat methylmercury(1+) increases expression ISO RGD:1313694 6480464 methylmercury II results in increased expression of ITGB2 mRNA CTD PMID:26314263 Itgb2 Rat microcystin-LR increases expression EXP 6480464 cyanoginosin LR results in increased expression of ITGB2 mRNA; cyanoginosin LR results in increased expression more ... CTD PMID:19360947 Itgb2 Rat mycotoxin increases expression ISO RGD:1313695 6480464 Mycotoxins results in increased expression of ITGB2 mRNA CTD PMID:19818335 Itgb2 Rat N-[3-(aminomethyl)benzyl]acetamidine multiple interactions ISO RGD:1313694 6480464 N-(3-(aminomethyl)benzyl)acetamidine inhibits the reaction [ITGB2 protein results in increased activity of RAP1A protein]; N-(3-(aminomethyl)benzyl)acetamidine inhibits more ... CTD PMID:16963453 Itgb2 Rat N-formyl-L-methionyl-L-leucyl-L-phenylalanine increases expression ISO RGD:1313694 6480464 N-Formylmethionine Leucyl-Phenylalanine results in increased expression of ITGB2 protein CTD PMID:10215738|PMID:16393473 Itgb2 Rat N-formyl-L-methionyl-L-leucyl-L-phenylalanine increases expression ISO RGD:1313695 6480464 N-Formylmethionine Leucyl-Phenylalanine results in increased expression of ITGB2 protein CTD PMID:21664406 Itgb2 Rat N-formyl-L-methionyl-L-leucyl-L-phenylalanine multiple interactions ISO RGD:1313694 6480464 1,2-bis(2-aminophenoxy)ethane N,N,N',N'-tetraacetic acid acetoxymethyl ester inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine results in increased expression of more ... CTD PMID:10215738|PMID:16393473 Itgb2 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of ITGB2 mRNA CTD PMID:25380136 Itgb2 Rat neoechinulin A increases expression ISO RGD:1313695 6480464 neoechinulin A results in increased expression of ITGB2 mRNA CTD PMID:19818335 Itgb2 Rat nickel atom increases expression ISO RGD:1313694 6480464 Nickel results in increased expression of ITGB2 mRNA CTD PMID:25583101 Itgb2 Rat nitric oxide multiple interactions ISO RGD:1313694 6480464 Nitric Oxide promotes the reaction [ITGB2 protein results in increased activity of RAP1A protein]; Nitric more ... CTD PMID:16963453 Itgb2 Rat nitric oxide increases abundance EXP 6480464 ITGB2 protein results in increased abundance of Nitric Oxide CTD PMID:8600936 Itgb2 Rat nitric oxide multiple interactions EXP 6480464 [CSF2 protein results in increased expression of ITGB2 protein] which results in increased abundance of more ... CTD PMID:8600936 Itgb2 Rat notoginsenoside R1 decreases expression ISO RGD:1313695 6480464 notoginsenoside R1 results in decreased expression of ITGB2 protein CTD PMID:18176958 Itgb2 Rat notoginsenoside R1 multiple interactions EXP 6480464 notoginsenoside R1 inhibits the reaction [Lipopolysaccharides results in increased expression of ITGB2 protein] CTD PMID:17655881 Itgb2 Rat ochratoxin A increases expression ISO RGD:1313694 6480464 ochratoxin A metabolite results in increased expression of ITGB2 mRNA; ochratoxin A results in increased more ... CTD PMID:26314263 Itgb2 Rat okadaic acid decreases expression ISO RGD:1313694 6480464 Okadaic Acid results in decreased expression of ITGB2 mRNA CTD PMID:38832940 Itgb2 Rat oxycodone decreases expression EXP 6480464 Oxycodone results in decreased expression of ITGB2 mRNA CTD PMID:23439660 Itgb2 Rat ozone increases response to substance EXP 6480464 ITGB2 protein results in increased susceptibility to Ozone CTD PMID:8600936 Itgb2 Rat ozone multiple interactions ISO RGD:1313695 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 Itgb2 Rat ozone multiple interactions ISO RGD:1313694 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Itgb2 Rat ozone multiple interactions EXP 6480464 [ITGB2 protein results in increased susceptibility to Ozone] which results in increased abundance of Nitric more ... CTD PMID:8600936 Itgb2 Rat paracetamol affects expression ISO RGD:1313695 6480464 Acetaminophen affects the expression of ITGB2 mRNA CTD PMID:17562736 Itgb2 Rat pentanal decreases expression ISO RGD:1313694 6480464 pentanal results in decreased expression of ITGB2 mRNA CTD PMID:26079696 Itgb2 Rat Pentoxifylline affects expression ISO RGD:1313694 6480464 Pentoxifylline affects the expression of ITGB2 CTD PMID:1976392 Itgb2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1313695 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ITGB2 mRNA CTD PMID:36331819 Itgb2 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of ITGB2 mRNA CTD PMID:35163327 Itgb2 Rat perfluorooctanoic acid decreases expression ISO RGD:1313694 6480464 perfluorooctanoic acid results in decreased expression of ITGB2 protein CTD PMID:38758093 Itgb2 Rat phorbol 13-acetate 12-myristate increases expression ISO RGD:1313694 6480464 Tetradecanoylphorbol Acetate results in increased expression of ITGB2 protein CTD PMID:16393473 Itgb2 Rat phorbol 13-acetate 12-myristate affects localization ISO RGD:1313694 6480464 Tetradecanoylphorbol Acetate affects the localization of ITGB2 protein CTD PMID:20883105 Itgb2 Rat phorbol 13-acetate 12-myristate multiple interactions ISO RGD:1313694 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Tetradecanoylphorbol Acetate affects the localization of ITGB2 protein]; acteoside inhibits the more ... CTD PMID:16393473|PMID:20883105 Itgb2 Rat pirinixic acid multiple interactions ISO RGD:1313694 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Itgb2 Rat pirinixic acid decreases expression ISO RGD:1313695 6480464 pirinixic acid results in decreased expression of ITGB2 mRNA CTD PMID:17426115 Itgb2 Rat plaunotol multiple interactions ISO RGD:1313694 6480464 plaunotol inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine results in increased expression of ITGB2 protein] CTD PMID:10215738 Itgb2 Rat probucol multiple interactions ISO RGD:1313695 6480464 Probucol promotes the reaction [APOE gene mutant form results in increased expression of ITGB2 mRNA] CTD PMID:19394937 Itgb2 Rat progesterone affects expression ISO RGD:1313695 6480464 Progesterone affects the expression of ITGB2 mRNA CTD PMID:17251523 Itgb2 Rat progesterone increases expression ISO RGD:1313694 6480464 Progesterone results in increased expression of ITGB2 mRNA CTD PMID:21540246 Itgb2 Rat progesterone multiple interactions ISO RGD:1313694 6480464 [Progesterone co-treated with Estradiol] results in increased expression of ITGB2 mRNA CTD PMID:20226447 Itgb2 Rat quercetin multiple interactions ISO RGD:1313694 6480464 Quercetin inhibits the reaction [S100B protein results in increased expression of ITGB2 mRNA] CTD PMID:17103373 Itgb2 Rat resveratrol multiple interactions ISO RGD:1313694 6480464 resveratrol analog inhibits the reaction [formylmethionyl-leucyl-phenylalanine methyl ester results in increased expression of ITGB2 protein] CTD PMID:9605577 Itgb2 Rat resveratrol increases expression ISO RGD:1313694 6480464 resveratrol results in increased expression of ITGB2 mRNA CTD PMID:25888808 Itgb2 Rat resveratrol multiple interactions EXP 6480464 [resveratrol co-treated with Streptozocin] results in increased expression of ITGB2 mRNA CTD PMID:25905778 Itgb2 Rat Senkirkine increases expression EXP 6480464 senkirkine results in increased expression of ITGB2 mRNA CTD PMID:34185104 Itgb2 Rat silicon dioxide decreases expression ISO RGD:1313694 6480464 Silicon Dioxide analog results in decreased expression of ITGB2 mRNA CTD PMID:25895662 Itgb2 Rat silicon dioxide increases expression ISO RGD:1313695 6480464 Silicon Dioxide results in increased expression of ITGB2 mRNA CTD PMID:29341224 Itgb2 Rat simvastatin affects binding ISO RGD:1313694 6480464 Simvastatin binds to [ITGAL protein binds to ITGB2 protein] CTD PMID:15041742 Itgb2 Rat simvastatin decreases expression ISO RGD:1313694 6480464 Simvastatin results in decreased expression of ITGB2 mRNA CTD PMID:12615677 Itgb2 Rat simvastatin multiple interactions ISO RGD:1313694 6480464 Simvastatin inhibits the reaction [TNF results in increased expression of ITGB2] CTD PMID:12615677 Itgb2 Rat simvastatin multiple interactions ISO RGD:1313695 6480464 Simvastatin results in decreased expression of [ITGAM protein binds to ITGB2 protein] CTD PMID:21330348 Itgb2 Rat sodium arsenite decreases expression ISO RGD:1313695 6480464 sodium arsenite results in decreased expression of ITGB2 mRNA CTD PMID:14691202|PMID:37682722 Itgb2 Rat sodium arsenite increases expression ISO RGD:1313694 6480464 sodium arsenite results in increased expression of ITGB2 mRNA CTD PMID:29301061|PMID:34032870|PMID:38568856 Itgb2 Rat Soman increases expression EXP 6480464 Soman results in increased expression of ITGB2 mRNA CTD PMID:19281266 Itgb2 Rat staurosporine multiple interactions ISO RGD:1313694 6480464 Staurosporine inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of ITGB2 protein] CTD PMID:16393473 Itgb2 Rat streptozocin multiple interactions EXP 6480464 [resveratrol co-treated with Streptozocin] results in increased expression of ITGB2 mRNA; KLK1 protein inhibits the more ... CTD PMID:16129698|PMID:25905778 Itgb2 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of ITGB2 protein CTD PMID:16129698 Itgb2 Rat SU6656 multiple interactions ISO RGD:1313694 6480464 SU 6656 inhibits the reaction [ITGB2 protein results in increased activity of RAP1A protein] CTD PMID:16963453 Itgb2 Rat sulfasalazine multiple interactions ISO RGD:1313694 6480464 Sulfasalazine inhibits the reaction [TNF protein results in increased expression of ITGB2 protein] CTD PMID:8094364 Itgb2 Rat sulforaphane increases expression ISO RGD:1313694 6480464 sulforaphane results in increased expression of ITGB2 mRNA CTD PMID:26833863 Itgb2 Rat tamibarotene increases expression ISO RGD:1313694 6480464 tamibarotene results in increased expression of ITGB2 mRNA CTD PMID:15498508 Itgb2 Rat tamibarotene multiple interactions ISO RGD:1313694 6480464 CSF3 protein inhibits the reaction [tamibarotene results in decreased expression of ITGB2 mRNA]; tamibarotene inhibits more ... CTD PMID:27737899 Itgb2 Rat tamibarotene decreases expression ISO RGD:1313694 6480464 tamibarotene results in decreased expression of ITGB2 mRNA CTD PMID:27737899 Itgb2 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of ITGB2 mRNA CTD PMID:32741896 Itgb2 Rat tetrachloromethane increases expression ISO RGD:1313695 6480464 Carbon Tetrachloride results in increased expression of ITGB2 mRNA CTD PMID:15056808|PMID:27339419|PMID:31919559 Itgb2 Rat tetrachloromethane multiple interactions ISO RGD:1313695 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of ITGB2 mRNA CTD PMID:30517762 Itgb2 Rat theophylline increases expression ISO RGD:1313694 6480464 Theophylline results in increased expression of ITGB2 mRNA CTD PMID:16083514 Itgb2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ITGB2 mRNA CTD PMID:34492290 Itgb2 Rat titanium dioxide multiple interactions ISO RGD:1313695 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of ITGB2 more ... CTD PMID:29950665 Itgb2 Rat TMC-120A increases expression ISO RGD:1313695 6480464 TMC 120A results in increased expression of ITGB2 mRNA CTD PMID:19818335 Itgb2 Rat tributylstannane increases expression ISO RGD:1313694 6480464 tributyltin results in increased expression of ITGB2 mRNA CTD PMID:26314263 Itgb2 Rat tributylstannane multiple interactions ISO RGD:1313694 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [tributyltin affects the localization of ITGB2 protein] CTD PMID:20883105 Itgb2 Rat tributylstannane affects localization ISO RGD:1313694 6480464 tributyltin affects the localization of ITGB2 protein CTD PMID:20883105 Itgb2 Rat Tributyltin oxide increases expression ISO RGD:1313694 6480464 bis(tri-n-butyltin)oxide results in increased expression of ITGB2 mRNA CTD PMID:26314263 Itgb2 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of ITGB2 gene CTD PMID:27618143 Itgb2 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of ITGB2 mRNA CTD PMID:33387578 Itgb2 Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of ITGB2 mRNA CTD PMID:30589522 Itgb2 Rat triphenyl phosphate affects expression ISO RGD:1313694 6480464 triphenyl phosphate affects the expression of ITGB2 mRNA CTD PMID:37042841 Itgb2 Rat triphenylstannane increases expression ISO RGD:1313694 6480464 triphenyltin results in increased expression of ITGB2 mRNA; triphenyltin results in increased expression of ITGB2 more ... CTD PMID:12788061 Itgb2 Rat triptonide decreases expression ISO RGD:1313695 6480464 triptonide results in decreased expression of ITGB2 mRNA CTD PMID:33045310 Itgb2 Rat valproic acid increases expression ISO RGD:1313694 6480464 Valproic Acid results in increased expression of ITGB2 mRNA CTD PMID:23527032 Itgb2 Rat valproic acid increases methylation ISO RGD:1313694 6480464 Valproic Acid results in increased methylation of ITGB2 gene CTD PMID:29154799 Itgb2 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of ITGB2 mRNA CTD PMID:19015723 Itgb2 Rat vitamin D increases expression ISO RGD:1313694 6480464 Vitamin D results in increased expression of ITGB2 mRNA CTD PMID:20368581 Itgb2 Rat wortmannin multiple interactions ISO RGD:1313694 6480464 wortmannin inhibits the reaction [ITGB2 protein results in increased activity of RAP1A protein] CTD PMID:16963453 Itgb2 Rat zinc atom decreases expression ISO RGD:1313694 6480464 Zinc results in decreased expression of ITGB2 mRNA CTD PMID:19071009 Itgb2 Rat zinc(0) decreases expression ISO RGD:1313694 6480464 Zinc results in decreased expression of ITGB2 mRNA CTD PMID:19071009 Itgb2 Rat zoledronic acid increases expression ISO RGD:1313694 6480464 zoledronic acid results in increased expression of ITGB2 mRNA CTD PMID:24714768
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Itgb2 Rat amyloid-beta binding enables ISO RGD:1313695 1624291 PMID:18981818 RGD PMID:18981818 Itgb2 Rat amyloid-beta binding enables IBA MGI:96611|PANTHER:PTN002560716 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Itgb2 Rat cargo receptor activity contributes_to ISO RGD:1313695 1624291 PMID:20199584 RGD PMID:20199584 Itgb2 Rat cell adhesion molecule binding contributes_to IMP 1582375 Icam1 binding RGD Itgb2 Rat cell adhesion molecule binding enables IEA UniProtKB:P05107|ensembl:ENSP00000498780 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Itgb2 Rat cell adhesion molecule binding enables ISO RGD:1313694 1624291 PMID:19029120 RGD PMID:19029120 Itgb2 Rat complement component C3b binding enables ISO RGD:1313695 1624291 UniProtKB:P01027 PMID:20199584 RGD PMID:20199584 Itgb2 Rat heat shock protein binding enables ISO RGD:1313694 1624291 UniProtKB:P50142 PMID:12496435 RGD PMID:12496435 Itgb2 Rat heat shock protein binding enables IEA UniProtKB:P05107|ensembl:ENSP00000498780 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Itgb2 Rat ICAM-3 receptor activity enables ISO RGD:1313694 1624291 PMID:19029120 RGD PMID:19029120 Itgb2 Rat ICAM-3 receptor activity enables IEA UniProtKB:P05107|ensembl:ENSP00000498780 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Itgb2 Rat integrin binding enables IBA MGI:96610|MGI:96612|MGI:96614|MGI:96615|PANTHER:PTN000801545|RGD:2927|UniProtKB:P05106 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Itgb2 Rat protein binding enables ISO RGD:1313694 1624291 UniProtKB:A8MQ03|UniProtKB:O75841|UniProtKB:P00519|UniProtKB:P0DPK4|UniProtKB:P11215|UniProtKB:P13796|UniProtKB:P20702|UniProtKB:P21333|UniProtKB:P35241|UniProtKB:P60033|UniProtKB:P60410|UniProtKB:Q14145|UniProtKB:Q15323|UniProtKB:Q15582|UniProtKB:Q15762|UniProtKB:Q3SYB3|UniProtKB:Q6UY14-3|UniProtKB:Q7Z3S9|UniProtKB:Q8N6Q3|UniProtKB:Q8TAF8|UniProtKB:Q96CE8|UniProtKB:Q9BQE5|UniProtKB:Q9BX67|UniProtKB:Q9GZW8|UniProtKB:Q9H2K0|UniProtKB:Q9UN30-2|UniProtKB:Q9Y4G6 PMID:12208882, PMID:12796480, PMID:16831868, PMID:17321526, PMID:18083624, PMID:19234221, PMID:19828450, PMID:20033057, PMID:20183869, PMID:20679211, PMID:21193407, PMID:25416956, PMID:25910212, more ... RGD PMID:12208882|PMID:12796480|PMID:16831868|PMID:17321526|PMID:18083624|PMID:19234221|PMID:19828450|PMID:20033057|PMID:20183869|PMID:20679211|PMID:21193407|PMID:25416956|PMID:25910212|PMID:28807980|PMID:31515488|PMID:32296183|PMID:32814053 Itgb2 Rat protein binding enables ISO RGD:1313695 1624291 UniProtKB:P09055|UniProtKB:P20491|UniProtKB:P35762|UniProtKB:P40240|UniProtKB:Q08857|UniProtKB:Q8K1B8 PMID:19234461, PMID:23395392 RGD PMID:19234461|PMID:23395392 Itgb2 Rat protein kinase binding enables ISO RGD:1313694 1624291 UniProtKB:P43405 PMID:12885943 RGD PMID:12885943 Itgb2 Rat protein kinase binding enables IEA UniProtKB:P05107|ensembl:ENSP00000498780 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Itgb2 Rat protein kinase binding enables IBA PANTHER:PTN002560716|UniProtKB:P05107 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Itgb2 Rat protein-containing complex binding IPI RGD:631424 1600245 heterodimerization RGD Itgb2 Rat protein-containing complex binding IPI RGD:2926 1600245 heterodimerization RGD Itgb2 Rat protein-containing complex binding IPI RGD:71075 1600245 heterodimerization RGD Itgb2 Rat protein-containing complex binding IPI RGD:631424|RGD:2857 4145434 RGD
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-catechin (ISO) (-)-Arctigenin (ISO) (1->4)-beta-D-glucan (ISO) (20S)-ginsenoside Rh1 (ISO) (S)-ropivacaine (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP,ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-nitrotoluene (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 5-azacytidine (ISO) 5-fluorouracil (ISO) 9-cis-retinoic acid (ISO) acetamide (EXP) acetylsalicylic acid (ISO) acrolein (ISO) acteoside (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) alpha-Zearalanol (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenous acid (ISO) asbestos (ISO) atorvastatin calcium (ISO) atrazine (EXP) Azoxymethane (ISO) benzene (ISO) benzo[a]pyrene (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bleomycin A2 (ISO) bromochloroacetic acid (EXP) buspirone (EXP) butanal (ISO) cadmium dichloride (EXP,ISO) Calcimycin (ISO) cannabidiol (ISO) carbon nanotube (ISO) carnosic acid (ISO) cerivastatin (ISO) chlorogenic acid (EXP) chlorpyrifos (ISO) choline (ISO) cisplatin (EXP) cobalt dichloride (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) cyclosporin A (ISO) decabromodiphenyl ether (EXP) deoxynivalenol (ISO) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) diazinon (ISO) diclofenac (ISO) dimethyl sulfoxide (ISO) dioxygen (EXP) diuron (ISO) endosulfan (EXP) Enterolactone (ISO) epoxiconazole (ISO) erianin (ISO) ethanol (ISO) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) Formylmethionyl-leucyl-phenylalanine methyl ester (ISO) fulvestrant (ISO) gentamycin (EXP) ginsenoside C-K (ISO) ginsenoside Rb1 (EXP) graphene oxide (ISO) griseofulvin (ISO) GSK-J4 (ISO) Heliotrine (EXP) hydroquinone (ISO) indirubin (ISO) indometacin (EXP,ISO) iron atom (ISO) iron(0) (ISO) isoflavones (ISO) isotretinoin (ISO) josamycin (ISO) L-methionine (ISO) leukotriene B4 (EXP,ISO) lidocaine (ISO) lipopolysaccharide (EXP,ISO) LY294002 (ISO) methotrexate (ISO) methoxychlor (EXP) methyl methanesulfonate (ISO) methylmercury(1+) (ISO) microcystin-LR (EXP) mycotoxin (ISO) N-[3-(aminomethyl)benzyl]acetamidine (ISO) N-formyl-L-methionyl-L-leucyl-L-phenylalanine (ISO) N-nitrosodimethylamine (EXP) neoechinulin A (ISO) nickel atom (ISO) nitric oxide (EXP,ISO) notoginsenoside R1 (EXP,ISO) ochratoxin A (ISO) okadaic acid (ISO) oxycodone (EXP) ozone (EXP,ISO) paracetamol (ISO) pentanal (ISO) Pentoxifylline (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP,ISO) phorbol 13-acetate 12-myristate (ISO) pirinixic acid (ISO) plaunotol (ISO) probucol (ISO) progesterone (ISO) quercetin (ISO) resveratrol (EXP,ISO) Senkirkine (EXP) silicon dioxide (ISO) simvastatin (ISO) sodium arsenite (ISO) Soman (EXP) staurosporine (ISO) streptozocin (EXP) SU6656 (ISO) sulfasalazine (ISO) sulforaphane (ISO) tamibarotene (ISO) testosterone (EXP) tetrachloromethane (ISO) theophylline (ISO) thioacetamide (EXP) titanium dioxide (ISO) TMC-120A (ISO) tributylstannane (ISO) Tributyltin oxide (ISO) trichloroethene (EXP) triphenyl phosphate (EXP,ISO) triphenylstannane (ISO) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP) vitamin D (ISO) wortmannin (ISO) zinc atom (ISO) zinc(0) (ISO) zoledronic acid (ISO)
Biological Process
activated T cell proliferation (ISO) amyloid-beta clearance (ISO) cell adhesion (IEA,ISO) cell adhesion mediated by integrin (IBA) cell-cell adhesion (IMP,ISO) cell-matrix adhesion (IBA,IEA,ISO) cellular extravasation (IMP,ISO) cellular response to low-density lipoprotein particle stimulus (ISO) endodermal cell differentiation (IEA,ISO) endothelial cell migration (IMP) heterotypic cell-cell adhesion (IEA,ISO) integrin-mediated signaling pathway (IBA,IEA,ISO) leukocyte cell-cell adhesion (IBA,IEA,IMP,ISO) leukocyte migration involved in inflammatory response (IMP) neutrophil chemotaxis (IBA,IEA,ISO) neutrophil migration (IEA,ISO) phagocytosis (IEA) phagocytosis, engulfment (ISO) positive regulation of angiogenesis (IMP) positive regulation of leukocyte adhesion to vascular endothelial cell (ISO) positive regulation of neutrophil degranulation (IEA,ISO) positive regulation of NF-kappaB transcription factor activity (IMP) positive regulation of nitric oxide biosynthetic process (IMP) positive regulation of phagocytosis (ISO) positive regulation of superoxide anion generation (IEA,ISO) receptor clustering (IEA,ISO) receptor internalization (ISO) receptor-mediated endocytosis (ISO) regulation of peptidyl-tyrosine phosphorylation (ISO)
Cellular Component
cell surface (IBA,IDA,IEA,ISO) external side of plasma membrane (ISO) focal adhesion (IBA) integrin alphaL-beta2 complex (IEA,ISO) integrin alphaM-beta2 complex (IEA,ISO) integrin alphaX-beta2 complex (IEA,ISO) integrin complex (IBA) membrane (IEA,ISO) membrane raft (IEA,ISO) plasma membrane (IEA,ISO) plasma membrane raft (IEA,ISO) receptor complex (IEA,ISO)
1.
Altered gene expression in leukocyte transendothelial migration and cell communication pathways in periodontitis-affected gingival tissues.
Abe D, etal., J Periodontal Res. 2011 Jun;46(3):345-53. doi: 10.1111/j.1600-0765.2011.01349.x. Epub 2011 Mar 7.
2.
Point mutations impairing cell surface expression of the common beta subunit (CD18) in a patient with leukocyte adhesion molecule (Leu-CAM) deficiency.
Arnaout MA, etal., J Clin Invest. 1990 Mar;85(3):977-81.
3.
Soluble Jagged-1 inhibits neointima formation by attenuating Notch-Herp2 signaling.
Caolo V, etal., Arterioscler Thromb Vasc Biol. 2011 May;31(5):1059-65. Epub 2011 Feb 17.
4.
Regulation of LFA-1-dependent inflammatory cell recruitment by Cbl-b and 14-3-3 proteins.
Choi EY, etal., Blood. 2008 Apr 1;111(7):3607-14. doi: 10.1182/blood-2007-07-103077. Epub 2008 Jan 31.
5.
Increased expression of intercellular adhesion molecule-1 (ICAM-1) in a murine model of pulmonary eosinophilia and high IgE level.
Chu HW, etal., Clin Exp Immunol. 1995 May;100(2):319-24.
6.
Low-density array PCR analysis of reperfusion biopsies: an adjunct to histological analysis.
Cravedi P, etal., Nephrol Dial Transplant. 2010 Dec;25(12):4077-86. Epub 2010 May 26.
7.
Regulation of CD18 expression on neutrophils in response to fluid shear stress.
Fukuda S and Schmid-Schonbein GW, Proc Natl Acad Sci U S A. 2003 Nov 11;100(23):13152-7. Epub 2003 Oct 31.
8.
Inhibitory effect of olopatadine on antigen-induced eosinophil infiltration and the LFA-1 and Mac-1 expression in eosinophils.
Fukuishi N, etal., Jpn J Pharmacol. 2002 Apr;88(4):463-6.
9.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
10.
Characterization of three new membrane structures on rat NK cells which are involved in activation of the lytic machinery.
Giezeman-Smits KM, etal., Immunobiology. 1997 Nov;197(5):429-43.
11.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
12.
Mac-1 (CD11b/CD18) links inflammation and thrombosis after glomerular injury.
Hirahashi J, etal., Circulation. 2009 Sep 29;120(13):1255-65. Epub 2009 Sep 14.
13.
Unique CD18 mutations involving a deletion in the extracellular stalk region and a major truncation of the cytoplasmic domain in a patient with leukocyte adhesion deficiency type 1.
Hixson P, etal., Blood. 2004 Feb 1;103(3):1105-13. Epub 2003 Sep 25.
14.
Effects of monoclonal antibodies to adhesion molecules on eosinophilic myocarditis in Toxocara canis-infected CBA/J mice.
Hokibara S, etal., Clin Exp Immunol. 1998 Nov;114(2):236-44.
15.
Integrins: bidirectional, allosteric signaling machines.
Hynes RO Cell 2002 Sep 20;110(6):673-87.
16.
Treatment of established adjuvant arthritis in rats with monoclonal antibody to CD18 and very late activation antigen-4 integrins suppresses neutrophil and T-lymphocyte migration to the joints and improves clinical disease.
Issekutz AC, etal., Immunology. 1996 Aug;88(4):569-76.
17.
Loss of LFA-1, but not Mac-1, protects MRL/MpJ-Fas(lpr) mice from autoimmune disease.
Kevil CG, etal., Am J Pathol. 2004 Aug;165(2):609-16.
18.
[Circulating adhesion molecules (cICAM-1, lcVCAM-1) in patients with suspected inflammatory heart muscle disease].
Klein RM, etal., Z Kardiol. 1998 Feb;87(2):84-93.
19.
Leukocyte recruitment in hepatic injury: selectin-mediated leukocyte rolling is a prerequisite for CD18-dependent firm adhesion.
Klintman D, etal., J Hepatol. 2002 Jan;36(1):53-9.
20.
Association of a CD18 gene polymorphism with a reduced risk of restenosis after coronary stenting.
Koch W, etal., Am J Cardiol. 2001 Nov 15;88(10):1120-4.
21.
CD18/ICAM-1-dependent oxidative NF-kappaB activation leading to nitric oxide production in rat Kupffer cells cocultured with syngeneic hepatoma cells.
Kurose I, etal., J Clin Invest. 1997 Mar 1;99(5):867-78.
22.
Differential requirement for CD18 in T-helper effector homing.
Lee SH, etal., Nat Med. 2003 Oct;9(10):1281-6. doi: 10.1038/nm932. Epub 2003 Sep 14.
23.
The role of adhesion molecules in the recruitment of hepatic natural killer cells (pit cells) in rat liver.
Luo D, etal., Hepatology. 1996 Dec;24(6):1475-80.
24.
Label-free proteomics reveals decreased expression of CD18 and AKNA in peripheral CD4+ T cells from patients with Vogt-Koyanagi-Harada syndrome.
Mao L, etal., PLoS One. 2011 Jan 28;6(1):e14616.
25.
A novel point mutation in CD18 causing the expression of dysfunctional CD11/CD18 leucocyte integrins in a patient with leucocyte adhesion deficiency (LAD).
Mathew EC, etal., Clin Exp Immunol. 2000 Jul;121(1):133-8.
26.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
27.
The ITGB2 immunomodulatory gene (CD18), enterocolitis, and Hirschsprung's disease.
Moore SW, etal., J Pediatr Surg. 2008 Aug;43(8):1439-44.
28.
Epstein-Barr virus infection induces an increase of T regulatory type 1 cells in Hodgkin lymphoma patients.
Morales O, etal., Br J Haematol. 2014 Sep;166(6):875-90. doi: 10.1111/bjh.12980. Epub 2014 Jul 9.
29.
Development of a cell-free binding assay for rat ICAM-1/LFA-1 interactions using a novel anti-rat LFA-1 monoclonal antibody and comparison with a cell-based assay.
Mukasa R, etal., J Immunol Methods. 1999 Aug 31;228(1-2):69-79.
30.
In vivo migration of lymphocytes in chronically rejecting rat kidney allografts.
Muller V, etal., Transpl Int. 1999;12(2):145-51.
31.
Lung injury after deposition of IgA immune complexes. Requirements for CD18 and L-arginine.
Mulligan MS, etal., J Immunol. 1992 May 15;148(10):3086-92.
32.
Kindlin 3 (FERMT3) is associated with unstable atherosclerotic plaques, anti-inflammatory type II macrophages and upregulation of beta-2 integrins in all major arterial beds.
Oksala N, etal., Atherosclerosis. 2015 Sep;242(1):145-54. doi: 10.1016/j.atherosclerosis.2015.06.058. Epub 2015 Jul 13.
33.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
34.
Characterization of 11 new cases of leukocyte adhesion deficiency type 1 with seven novel mutations in the ITGB2 gene.
Parvaneh N, etal., J Clin Immunol. 2010 Sep;30(5):756-60. Epub 2010 Jun 12.
35.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
36.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
37.
The differential roles of LFA-1 and Mac-1 in host defense against systemic infection with Streptococcus pneumoniae.
Prince JE, etal., J Immunol. 2001 Jun 15;166(12):7362-9. doi: 10.4049/jimmunol.166.12.7362.
38.
GOA pipeline
RGD automated data pipeline
39.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
40.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
41.
Reduction in inflammation following blockade of CD18 or CD29 adhesive pathways during the acute phase of a spirochetal-induced colitis in mice.
Sacco RE, etal., Microb Pathog. 2000 Nov;29(5):289-99.
42.
The role of alpha4 (CD49d) and beta2 (CD18) integrins in eosinophil and neutrophil migration to allergic lung inflammation in the Brown Norway rat.
Schneider T, etal., Am J Respir Cell Mol Biol. 1999 Mar;20(3):448-57.
43.
Tumor-specific CTL kill murine renal cancer cells using both perforin and Fas ligand-mediated lysis in vitro, but cause tumor regression in vivo in the absence of perforin.
Seki N, etal., J Immunol. 2002 Apr 1;168(7):3484-92.
44.
Tumour necrosis factor alpha secretion induces protease activation and acinar cell necrosis in acute experimental pancreatitis in mice.
Sendler M, etal., Gut. 2012 Apr 5.
45.
The effect of gentamicin-induced readthrough on a novel premature termination codon of CD18 leukocyte adhesion deficiency patients.
Simon AJ, etal., PLoS One. 2010 Nov 16;5(11):e13659.
46.
Antibody-induced modulation of the leukocyte CD11b integrin prevents mild but not major renal ischaemic injury.
Tajra LC, etal., Nephrol Dial Transplant. 2000 Oct;15(10):1556-61.
47.
The integrins.
Takada Y, etal., Genome Biol. 2007;8(5):215.
48.
Characterization of the rat leukocyte integrin, CD11/CD18, by the use of LFA-1 subunit-specific monoclonal antibodies.
Tamatani T, etal., Eur J Immunol. 1991 Mar;21(3):627-33.
49.
Reduced brain injury in CD18-deficient mice after experimental intracerebral hemorrhage.
Titova E, etal., J Neurosci Res. 2008 Nov 1;86(14):3240-5.
50.
Gene expression in macrophage-rich inflammatory cell infiltrates in human atherosclerotic lesions as studied by laser microdissection and DNA array: overexpression of HMG-CoA reductase, colony stimulating factor receptors, CD11A/CD18 integrins, and interleukin receptors.
Tuomisto TT, etal., Arterioscler Thromb Vasc Biol. 2003 Dec;23(12):2235-40. Epub 2003 Oct 23.
51.
Ageing prolongs inflammatory marker expression in regenerating rat skeletal muscles after injury.
van der Poel C, etal., J Inflamm (Lond). 2011 Dec 29;8(1):41.
52.
The critical role of intercellular adhesion molecule-1 in Masugi nephritis in rats.
Wada J, etal., Nephron. 1996;73(2):264-72.
53.
Extracellular adherence protein of Staphylococcus aureus suppresses disease by inhibiting T-cell recruitment in a mouse model of psoriasis.
Wang H, etal., J Invest Dermatol. 2010 Mar;130(3):743-54. Epub 2009 Oct 8.
54.
Essential role of ICAM-1/CD18 in mediating EPC recruitment, angiogenesis, and repair to the infarcted myocardium.
Wu Y, etal., Circ Res. 2006 Aug 4;99(3):315-22. Epub 2006 Jul 6.
55.
A prospective evaluation of the CD14 and CD18 gene polymorphisms and risk of stroke.
Zee RY, etal., Stroke. 2002 Apr;33(4):892-5.
56.
Integrated Analysis of Multiple Microarray Studies to Identify Core Gene-Expression Signatures Involved in Tubulointerstitial Injury in Diabetic Nephropathy.
Zhou H, etal., Biomed Res Int. 2022 May 10;2022:9554658. doi: 10.1155/2022/9554658. eCollection 2022.
Itgb2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 11,061,009 - 11,097,242 (-) NCBI GRCr8 mRatBN7.2 20 11,061,394 - 11,097,656 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 11,061,430 - 11,097,600 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 11,760,914 - 11,797,085 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 11,121,883 - 11,158,052 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 11,593,622 - 11,629,796 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 11,777,773 - 11,815,647 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 11,777,783 - 11,815,647 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 13,944,190 - 13,981,048 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 11,446,521 - 11,485,009 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 11,446,936 - 11,485,236 (-) NCBI Celera 20 12,564,941 - 12,601,097 (-) NCBI Celera Cytogenetic Map 20 p12 NCBI
ITGB2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 21 44,885,953 - 44,928,815 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 21 44,885,953 - 44,931,989 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 21 46,305,868 - 46,348,730 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 21 45,130,296 - 45,165,303 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 21 45,130,313 - 45,165,232 NCBI Celera 21 31,412,498 - 31,455,256 (-) NCBI Celera Cytogenetic Map 21 q22.3 NCBI HuRef 21 31,679,225 - 31,721,357 (-) NCBI HuRef CHM1_1 21 45,866,651 - 45,909,349 (-) NCBI CHM1_1 T2T-CHM13v2.0 21 43,246,634 - 43,289,593 (-) NCBI T2T-CHM13v2.0
Itgb2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 77,366,164 - 77,401,542 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 77,366,086 - 77,401,542 (+) Ensembl GRCm39 Ensembl GRCm38 10 77,530,329 - 77,565,708 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 77,530,252 - 77,565,708 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 76,993,093 - 77,028,419 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 76,985,685 - 77,009,099 (+) NCBI MGSCv36 mm8 Celera 10 78,572,639 - 78,608,564 (+) NCBI Celera Cytogenetic Map 10 C1 NCBI cM Map 10 39.72 NCBI
Itgb2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955407 41,777,777 - 41,800,201 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955407 41,779,849 - 41,805,637 (-) NCBI ChiLan1.0 ChiLan1.0
ITGB2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 22 40,933,241 - 40,976,107 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 21 35,804,383 - 35,839,245 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 21 31,181,228 - 31,216,033 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 21 44,470,999 - 44,505,963 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 21 44,470,999 - 44,505,963 (-) Ensembl panpan1.1 panPan2
ITGB2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 31 38,520,733 - 38,547,003 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 31 38,521,103 - 38,547,018 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 31 37,718,851 - 37,741,911 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 31 38,125,566 - 38,152,274 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 31 38,125,550 - 38,148,633 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 31 37,988,075 - 38,014,617 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 31 37,949,217 - 37,972,818 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 31 38,463,168 - 38,490,402 (-) NCBI UU_Cfam_GSD_1.0
Itgb2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404971 37,819,024 - 37,843,866 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936778 1,286,341 - 1,311,194 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936778 1,286,475 - 1,311,184 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ITGB2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 207,512,950 - 207,544,107 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 207,514,281 - 207,544,108 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 217,446,055 - 217,475,887 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ITGB2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 88,597,554 - 88,644,890 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 88,597,556 - 88,624,025 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 16,774,420 - 16,821,705 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Itgb2
.
Predicted Target Of
Count of predictions: 97 Count of miRNA genes: 71 Interacting mature miRNAs: 88 Transcripts: ENSRNOT00000001639 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 2317057 Aia27 Adjuvant induced arthritis QTL 27 2.83 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 20 2892597 26381954 Rat 7387283 Uae44 Urinary albumin excretion QTL 44 0.1712 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 20 1 26123605 Rat 4889870 Pur30 Proteinuria QTL 30 19 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 20 8042410 29322208 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 1354642 Despr15 Despair related QTL 15 0.0027 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 20 1 24159021 Rat 1600382 Edcs3 Endometrial carcinoma susceptibility QTL3 3.5 0.003 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 20 1 25159026 Rat 1558640 Prcs2 Prostate cancer susceptibility QTL 2 3.3 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 20 4606607 17617956 Rat 631265 Iresp1 Immunoglobin response QTL1 8.3 blood anti-double stranded DNA antibody amount (VT:0004762) serum anti-DNA antibody level (CMO:0001533) 20 9039719 13461775 Rat 8694189 Bw153 Body weight QTL 153 3.13 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 20 1 29191651 Rat 4889857 Pur27 Proteinuria QTL 27 12.2 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 20 4606607 17617956 Rat 70154 Insul2 Insulin level QTL 2 3.75 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 6691706 17489458 Rat 9590109 Sffal8 Serum free fatty acids level QTL 8 5.32 0.01 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 20 1 29191651 Rat 9590275 Scort15 Serum corticosterone level QTL 15 3.48 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 29191651 Rat 9589155 Insul32 Insulin level QTL 32 6.38 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 1 29191651 Rat 1581577 Pur15 Proteinuria QTL 15 4.38 0.0002 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 20 8042410 17617956 Rat 7411650 Foco23 Food consumption QTL 23 20.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 29191651 Rat 2317851 Alcrsp22 Alcohol response QTL 22 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 61432 Cia1 Collagen induced arthritis QTL 1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 3621656 14101050 Rat 1641893 Alcrsp7 Alcohol response QTL 7 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 6893685 Bw111 Body weight QTL 111 2.7 0.004 body mass (VT:0001259) body weight (CMO:0000012) 20 1 32578807 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat
Itgb2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 11,061,745 - 11,061,853 (+) MAPPER mRatBN7.2 Rnor_6.0 20 11,778,099 - 11,778,206 NCBI Rnor6.0 Rnor_5.0 20 13,944,516 - 13,944,623 UniSTS Rnor5.0 RGSC_v3.4 20 11,446,847 - 11,446,954 UniSTS RGSC3.4 Celera 20 12,565,267 - 12,565,374 UniSTS Cytogenetic Map 20 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
47
113
91
90
59
25
59
6
216
95
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001639 ⟹ ENSRNOP00000001639
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 11,061,430 - 11,097,600 (-) Ensembl Rnor_6.0 Ensembl 20 11,777,783 - 11,815,647 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000101048 ⟹ ENSRNOP00000081713
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 11,061,430 - 11,067,731 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119404 ⟹ ENSRNOP00000082439
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 11,061,430 - 11,080,548 (-) Ensembl
RefSeq Acc Id:
NM_001037780 ⟹ NP_001032869
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 11,061,009 - 11,097,182 (-) NCBI mRatBN7.2 20 11,061,420 - 11,097,600 (-) NCBI Rnor_6.0 20 11,777,773 - 11,815,647 (-) NCBI Rnor_5.0 20 13,944,190 - 13,981,048 (-) NCBI RGSC_v3.4 20 11,446,521 - 11,485,009 (-) RGD Celera 20 12,564,941 - 12,601,097 (-) RGD
Sequence:
CACCACCACAGAGCCAGCTGGTGAGAAGCAGGCAGAGACATCTCCAGTCAGTCAGATTCACGGATTGGAGGCTTCCTGGGACCAAGAGGGGTACTTGACCACCTGAGCCAGCCCCCCCACATCCCTCC
hide sequence
RefSeq Acc Id:
XM_039098729 ⟹ XP_038954657
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 11,061,009 - 11,097,242 (-) NCBI mRatBN7.2 20 11,061,394 - 11,097,656 (-) NCBI
RefSeq Acc Id:
XM_039098730 ⟹ XP_038954658
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 11,061,009 - 11,097,205 (-) NCBI mRatBN7.2 20 11,061,394 - 11,097,608 (-) NCBI
RefSeq Acc Id:
XM_063279156 ⟹ XP_063135226
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 11,061,009 - 11,096,160 (-) NCBI
RefSeq Acc Id:
NP_001032869 ⟸ NM_001037780
- Peptide Label:
precursor
- UniProtKB:
B2RYB8 (UniProtKB/TrEMBL), F7F4S8 (UniProtKB/TrEMBL), A0A9K3Y824 (UniProtKB/TrEMBL), A6JK86 (UniProtKB/TrEMBL)
- Sequence:
MLGPHTLLLILAGLLFLGSALSEECTKYKVSNCRDCIQSGPGCSWCQKLNFTGPGEPDSLRCDTRAQLLLKGCPADDIMDPKSFADLHPQYQVQRSQLSPQKVTLNLRPGQAAAFNVTFRRAKGYPID
hide sequence
Ensembl Acc Id:
ENSRNOP00000001639 ⟸ ENSRNOT00000001639
RefSeq Acc Id:
XP_038954657 ⟸ XM_039098729
- Peptide Label:
isoform X1
- UniProtKB:
F7F4S8 (UniProtKB/TrEMBL), B2RYB8 (UniProtKB/TrEMBL), A0A9K3Y824 (UniProtKB/TrEMBL), A6JK86 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038954658 ⟸ XM_039098730
- Peptide Label:
isoform X1
- UniProtKB:
F7F4S8 (UniProtKB/TrEMBL), B2RYB8 (UniProtKB/TrEMBL), A0A9K3Y824 (UniProtKB/TrEMBL), A6JK86 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000081713 ⟸ ENSRNOT00000101048
Ensembl Acc Id:
ENSRNOP00000082439 ⟸ ENSRNOT00000119404
RefSeq Acc Id:
XP_063135226 ⟸ XM_063279156
- Peptide Label:
isoform X1
- UniProtKB:
A6JK86 (UniProtKB/TrEMBL), A0A9K3Y824 (UniProtKB/TrEMBL), B2RYB8 (UniProtKB/TrEMBL), F7F4S8 (UniProtKB/TrEMBL)
RGD ID: 13701505 Promoter ID: EPDNEW_R12029 Type: initiation region Name: Itgb2_1 Description: integrin subunit beta 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 11,815,664 - 11,815,724 EPDNEW
BioCyc Gene G2FUF-4238 BioCyc
Ensembl Genes ENSRNOG00000001224 Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000001639 ENTREZGENE
ENSRNOT00000001639.7 UniProtKB/TrEMBL
ENSRNOT00000101048.1 UniProtKB/TrEMBL
ENSRNOT00000119404 ENTREZGENE
ENSRNOT00000119404.1 UniProtKB/TrEMBL
Gene3D-CATH 3.40.50.410 UniProtKB/TrEMBL
4.10.1240.30 UniProtKB/TrEMBL
6.20.50.10 UniProtKB/TrEMBL
Cytochrome c1, transmembrane anchor, C-terminal UniProtKB/TrEMBL
Laminin UniProtKB/TrEMBL
ligand-binding face of the semaphorins, domain 2 UniProtKB/TrEMBL
ntegrin, alpha v. Chain A, domain 3 UniProtKB/TrEMBL
IMAGE_CLONE IMAGE:7124173 IMAGE-MGC_LOAD
IMAGE:7932515 IMAGE-MGC_LOAD
InterPro Integin_beta_N UniProtKB/TrEMBL
Integrin_bsu UniProtKB/TrEMBL
Integrin_bsu-2_C UniProtKB/TrEMBL
Integrin_bsu_cyt UniProtKB/TrEMBL
Integrin_bsu_N UniProtKB/TrEMBL
Integrin_bsu_tail UniProtKB/TrEMBL
Integrin_bsu_tail_dom_sf UniProtKB/TrEMBL
Integrin_dom UniProtKB/TrEMBL
Plexin-like_fold UniProtKB/TrEMBL
vWFA_dom_sf UniProtKB/TrEMBL
KEGG Report rno:309684 UniProtKB/TrEMBL
MGC_CLONE MGC:188433 IMAGE-MGC_LOAD
MGC:94072 IMAGE-MGC_LOAD
NCBI Gene 309684 ENTREZGENE
PANTHER Integrin_beta_C UniProtKB/TrEMBL
PTHR10082:SF15 UniProtKB/TrEMBL
Pfam Integrin_b_cyt UniProtKB/TrEMBL
Integrin_B_tail UniProtKB/TrEMBL
Integrin_beta UniProtKB/TrEMBL
PSI_integrin UniProtKB/TrEMBL
PhenoGen Itgb2 PhenoGen
PIRSF Integrin_B UniProtKB/TrEMBL
PRINTS INTEGRINB UniProtKB/TrEMBL
PROSITE INTEGRIN_BETA UniProtKB/TrEMBL
RatGTEx ENSRNOG00000001224 RatGTEx
SMART INB UniProtKB/TrEMBL
Integrin_b_cyt UniProtKB/TrEMBL
Integrin_B_tail UniProtKB/TrEMBL
PSI UniProtKB/TrEMBL
Superfamily-SCOP EGF/Laminin UniProtKB/TrEMBL
Integrin_bsu_tail UniProtKB/TrEMBL
Plexin repeat UniProtKB/TrEMBL
SSF53300 UniProtKB/TrEMBL
SSF69179 UniProtKB/TrEMBL
UniProt A0A8I5ZTY9_RAT UniProtKB/TrEMBL
A0A8I5ZVL1_RAT UniProtKB/TrEMBL
A0A9K3Y824 ENTREZGENE, UniProtKB/TrEMBL
A6JK86 ENTREZGENE, UniProtKB/TrEMBL
B2RYB8 ENTREZGENE, UniProtKB/TrEMBL
F7F4S8 ENTREZGENE
Q4KLK5_RAT UniProtKB/TrEMBL
UniProt Secondary F7F4S8 UniProtKB/TrEMBL
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-05-18
Itgb2
integrin subunit beta 2
Itgb2
integrin, beta 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2009-12-15
Itgb2
integrin, beta 2
Itgb2
integrin beta 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Itgb2
integrin beta 2
Itgb2_predicted
integrin beta 2 (predicted)
Symbol and Name updated
1559027 APPROVED
