Symbol:
Itgb6
Name:
integrin subunit beta 6
RGD ID:
1303119
Description:
Predicted to enable integrin binding activity and molecular function activator activity. Predicted to be involved in several processes, including cell adhesion mediated by integrin; integrin-mediated signaling pathway; and transforming growth factor beta production. Predicted to act upstream of or within several processes, including Langerhans cell differentiation; enamel mineralization; and lung development. Predicted to be located in external side of plasma membrane. Predicted to be part of integrin alphav-beta6 complex. Predicted to be active in cell surface and focal adhesion. Human ortholog(s) of this gene implicated in amelogenesis imperfecta type 1H. Orthologous to human ITGB6 (integrin subunit beta 6); PARTICIPATES IN integrin mediated signaling pathway; arrhythmogenic right ventricular cardiomyopathy pathway; cell-extracellular matrix signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
integrin beta 6; integrin beta-6; integrin, beta 6; MGC94023
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ITGB6 (integrin subunit beta 6) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Itgb6 (integrin beta 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Itgb6 (integrin subunit beta 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ITGB6 (integrin subunit beta 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ITGB6 (integrin subunit beta 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Itgb6 (integrin subunit beta 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ITGB6 (integrin subunit beta 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ITGB6 (integrin subunit beta 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Itgb6 (integrin subunit beta 6) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
ITGB6 (integrin subunit beta 6)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Itgb6 (integrin beta 6)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
itgb6 (integrin, beta 6)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pat-3
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
mys
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
itgb6
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 65,454,964 - 65,579,179 (-) NCBI GRCr8 mRatBN7.2 3 45,046,295 - 45,170,532 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 45,048,044 - 45,121,671 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 48,404,699 - 48,477,782 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 56,988,255 - 57,061,340 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 54,757,778 - 54,831,418 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 46,652,624 - 46,775,362 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 46,652,623 - 46,726,958 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 51,760,871 - 51,883,770 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 42,286,140 - 42,360,793 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 42,182,533 - 42,257,165 (-) NCBI Celera 3 44,745,206 - 44,817,710 (-) NCBI Celera Cytogenetic Map 3 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Itgb6 Rat 1,2-dichloroethane decreases expression ISO Itgb6 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of ITGB6 mRNA CTD PMID:28960355 Itgb6 Rat 1,2-dimethylhydrazine increases expression ISO Itgb6 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ITGB6 mRNA CTD PMID:22206623 Itgb6 Rat 1,2-dimethylhydrazine affects expression ISO Itgb6 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of ITGB6 mRNA CTD PMID:22206623 Itgb6 Rat 1-naphthyl isothiocyanate increases expression ISO Itgb6 (Mus musculus) 6480464 1-Naphthylisothiocyanate results in increased expression of ITGB6 mRNA and 1-Naphthylisothiocyanate results in increased expression of ITGB6 protein CTD PMID:21037076 more ... Itgb6 Rat 1-naphthyl isothiocyanate multiple interactions ISO ITGB6 (Homo sapiens) 6480464 1-Naphthylisothiocyanate results in increased expression of [ITGB6 protein co-treated with ITGA5 protein] more ... CTD PMID:21037076 Itgb6 Rat 1-naphthyl isothiocyanate multiple interactions ISO Itgb6 (Mus musculus) 6480464 [ITGA5 protein co-treated with ITGB6 protein] promotes the reaction [1-Naphthylisothiocyanate results in increased phosphorylation of SMAD2 protein] more ... CTD PMID:21037076 more ... Itgb6 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of ITGB6 mRNA CTD PMID:17557909 Itgb6 Rat 17alpha-ethynylestradiol affects expression ISO ITGB6 (Homo sapiens) 6480464 Ethinyl Estradiol affects the expression of ITGB6 mRNA CTD PMID:26865667 Itgb6 Rat 17beta-estradiol multiple interactions ISO ITGB6 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of ITGB6 mRNA more ... CTD PMID:17404688 more ... Itgb6 Rat 17beta-estradiol decreases expression ISO ITGB6 (Homo sapiens) 6480464 Estradiol results in decreased expression of ITGB6 mRNA CTD PMID:23019147 more ... Itgb6 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO ITGB6 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of ITGB6 mRNA CTD PMID:11007951 Itgb6 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ITGB6 mRNA CTD PMID:33387578 Itgb6 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO ITGB6 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ITGB6 mRNA CTD PMID:23152189 Itgb6 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO ITGB6 (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of ITGB6 mRNA] CTD PMID:11007951 Itgb6 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO ITGB6 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of ITGB6 mRNA CTD PMID:22298810 Itgb6 Rat 2,6-dimethoxyphenol multiple interactions ISO ITGB6 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of ITGB6 protein CTD PMID:38598786 Itgb6 Rat 2-palmitoylglycerol increases expression ISO ITGB6 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of ITGB6 mRNA CTD PMID:37199045 Itgb6 Rat 3,4-methylenedioxymethamphetamine increases methylation ISO Itgb6 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased methylation of ITGB6 promoter CTD PMID:26251327 Itgb6 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Itgb6 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of ITGB6 mRNA CTD PMID:26251327 Itgb6 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of ITGB6 protein CTD PMID:34915118 Itgb6 Rat 4,4'-sulfonyldiphenol increases expression ISO Itgb6 (Mus musculus) 6480464 bisphenol S results in increased expression of ITGB6 mRNA CTD PMID:30951980 Itgb6 Rat 4,4'-sulfonyldiphenol affects methylation ISO Itgb6 (Mus musculus) 6480464 bisphenol S affects the methylation of ITGB6 gene CTD PMID:31683443 Itgb6 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ITGB6 mRNA CTD PMID:36041667 Itgb6 Rat 4-hydroxynon-2-enal decreases expression ISO ITGB6 (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in decreased expression of ITGB6 mRNA CTD PMID:12419474 Itgb6 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of ITGB6 mRNA CTD PMID:22504374 Itgb6 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ITGB6 mRNA CTD PMID:30047161 Itgb6 Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:19480007 Itgb6 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of ITGB6 mRNA CTD PMID:23630614 and PMID:33354967 Itgb6 Rat aflatoxin B1 decreases methylation ISO ITGB6 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of ITGB6 gene CTD PMID:27153756 Itgb6 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of ITGB6 mRNA CTD PMID:35163327 Itgb6 Rat amitriptyline decreases expression EXP 6480464 Amitriptyline results in decreased expression of ITGB6 mRNA CTD PMID:22341215 Itgb6 Rat aristolochic acid A decreases expression ISO ITGB6 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of ITGB6 mRNA CTD PMID:33212167 Itgb6 Rat Azoxymethane multiple interactions ISO Itgb6 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ITGB6 mRNA CTD PMID:29950665 Itgb6 Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of ITGB6 mRNA CTD PMID:21839799 Itgb6 Rat benzo[a]pyrene decreases methylation ISO ITGB6 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of ITGB6 exon CTD PMID:27901495 Itgb6 Rat benzo[a]pyrene affects methylation ISO ITGB6 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ITGB6 promoter CTD PMID:27901495 Itgb6 Rat benzo[a]pyrene decreases expression ISO ITGB6 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ITGB6 mRNA CTD PMID:22178795 Itgb6 Rat benzo[a]pyrene decreases expression ISO Itgb6 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ITGB6 mRNA CTD PMID:21569818 and PMID:22228805 Itgb6 Rat Benzo[k]fluoranthene decreases expression ISO Itgb6 (Mus musculus) 6480464 benzo(k)fluoranthene results in decreased expression of ITGB6 mRNA CTD PMID:26377693 Itgb6 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of ITGB6 mRNA CTD PMID:18164116 Itgb6 Rat bexarotene increases expression ISO ITGB6 (Homo sapiens) 6480464 bexarotene results in increased expression of ITGB6 mRNA CTD PMID:17178900 Itgb6 Rat bis(2-ethylhexyl) phthalate increases expression ISO ITGB6 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of ITGB6 mRNA CTD PMID:31163220 Itgb6 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Itgb6 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of ITGB6 mRNA CTD PMID:34319233 Itgb6 Rat bis(2-ethylhexyl) phthalate decreases expression ISO ITGB6 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of ITGB6 protein CTD PMID:31163220 Itgb6 Rat bisphenol A increases expression ISO Itgb6 (Mus musculus) 6480464 bisphenol A results in increased expression of ITGB6 mRNA CTD PMID:26063408 and PMID:32156529 Itgb6 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ITGB6 mRNA CTD PMID:36041667 Itgb6 Rat bisphenol A increases methylation ISO ITGB6 (Homo sapiens) 6480464 bisphenol A results in increased methylation of ITGB6 gene CTD PMID:31601247 Itgb6 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ITGB6 mRNA CTD PMID:34947998 Itgb6 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ITGB6 mRNA CTD PMID:25181051 more ... Itgb6 Rat bisphenol F increases expression ISO Itgb6 (Mus musculus) 6480464 bisphenol F results in increased expression of ITGB6 mRNA CTD PMID:30951980 Itgb6 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of ITGB6 mRNA CTD PMID:36041667 Itgb6 Rat bortezomib increases expression ISO ITGB6 (Homo sapiens) 6480464 Bortezomib results in increased expression of ITGB6 mRNA CTD PMID:20977926 Itgb6 Rat cadmium atom multiple interactions ISO ITGB6 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ITGB6 mRNA CTD PMID:35301059 Itgb6 Rat cadmium dichloride multiple interactions ISO ITGB6 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of ITGB6 mRNA CTD PMID:35301059 Itgb6 Rat calcitriol multiple interactions ISO ITGB6 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of ITGB6 mRNA CTD PMID:21592394 Itgb6 Rat calcitriol increases expression ISO ITGB6 (Homo sapiens) 6480464 Calcitriol results in increased expression of ITGB6 mRNA CTD PMID:21592394 Itgb6 Rat carbon nanotube increases expression ISO Itgb6 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Itgb6 Rat CGP 52608 multiple interactions ISO ITGB6 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ITGB6 gene] CTD PMID:28238834 Itgb6 Rat chloroprene decreases expression ISO Itgb6 (Mus musculus) 6480464 Chloroprene results in decreased expression of ITGB6 mRNA CTD PMID:23125180 Itgb6 Rat choline multiple interactions ISO Itgb6 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ITGB6 mRNA CTD PMID:20938992 Itgb6 Rat cisplatin multiple interactions ISO ITGB6 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of ITGB6 mRNA CTD PMID:27392435 Itgb6 Rat cisplatin decreases expression ISO ITGB6 (Homo sapiens) 6480464 Cisplatin results in decreased expression of ITGB6 mRNA CTD PMID:27392435 Itgb6 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of ITGB6 mRNA CTD PMID:24386269 Itgb6 Rat cocaine increases expression ISO ITGB6 (Homo sapiens) 6480464 Cocaine results in increased expression of ITGB6 mRNA CTD PMID:18000554 Itgb6 Rat copper atom multiple interactions EXP 6480464 [Copper deficiency co-treated with tetrathiomolybdate] results in decreased expression of ITGB6 mRNA CTD PMID:22276220 Itgb6 Rat copper atom multiple interactions ISO ITGB6 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of ITGB6 mRNA CTD PMID:30911355 Itgb6 Rat copper(0) multiple interactions EXP 6480464 [Copper deficiency co-treated with tetrathiomolybdate] results in decreased expression of ITGB6 mRNA CTD PMID:22276220 Itgb6 Rat copper(0) multiple interactions ISO ITGB6 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of ITGB6 mRNA CTD PMID:30911355 Itgb6 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of ITGB6 mRNA CTD PMID:26577399 Itgb6 Rat cycloheximide multiple interactions ISO ITGB6 (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of ITGB6 mRNA] and Cycloheximide inhibits the reaction [TGFB1 protein results in increased expression of ITGB6 mRNA] CTD PMID:11007951 and PMID:21303922 Itgb6 Rat cyclosporin A decreases expression ISO ITGB6 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ITGB6 mRNA CTD PMID:27989131 Itgb6 Rat cypermethrin increases expression EXP 6480464 cypermethrin results in increased expression of ITGB6 mRNA CTD PMID:22528246 Itgb6 Rat DDE decreases expression ISO ITGB6 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of ITGB6 mRNA CTD PMID:38568856 Itgb6 Rat dextran sulfate multiple interactions ISO Itgb6 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ITGB6 mRNA CTD PMID:29950665 Itgb6 Rat dibutyl phthalate increases expression ISO Itgb6 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of ITGB6 mRNA CTD PMID:21266533 Itgb6 Rat dimethylarsinic acid decreases expression EXP 6480464 Cacodylic Acid results in decreased expression of ITGB6 mRNA CTD PMID:17720352 Itgb6 Rat dorsomorphin multiple interactions ISO ITGB6 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Itgb6 Rat doxorubicin decreases expression ISO Itgb6 (Mus musculus) 6480464 Doxorubicin results in decreased expression of ITGB6 mRNA CTD PMID:28608983 Itgb6 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of ITGB6 mRNA CTD PMID:29391264 Itgb6 Rat folic acid multiple interactions ISO Itgb6 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ITGB6 mRNA CTD PMID:20938992 Itgb6 Rat furan increases methylation EXP 6480464 furan results in increased methylation of ITGB6 gene CTD PMID:22079235 Itgb6 Rat furan increases expression EXP 6480464 furan results in increased expression of ITGB6 mRNA CTD PMID:27387713 Itgb6 Rat furfural multiple interactions ISO ITGB6 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of ITGB6 protein CTD PMID:38598786 Itgb6 Rat gemcitabine multiple interactions ISO ITGB6 (Homo sapiens) 6480464 [ITGB6 co-treated with ITGAV] affects the susceptibility to Gemcitabine CTD PMID:20150628 Itgb6 Rat genistein affects expression ISO ITGB6 (Homo sapiens) 6480464 Genistein affects the expression of ITGB6 mRNA CTD PMID:26865667 Itgb6 Rat genistein decreases expression ISO ITGB6 (Homo sapiens) 6480464 Genistein results in decreased expression of ITGB6 mRNA CTD PMID:23019147 Itgb6 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ITGB6 mRNA CTD PMID:33387578 Itgb6 Rat glyphosate decreases expression ISO ITGB6 (Homo sapiens) 6480464 Glyphosate results in decreased expression of ITGB6 mRNA CTD PMID:31295307 Itgb6 Rat hydrogen peroxide decreases expression ISO ITGB6 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of ITGB6 mRNA CTD PMID:12419474 Itgb6 Rat Indeno[1,2,3-cd]pyrene decreases expression ISO Itgb6 (Mus musculus) 6480464 indeno(1 more ... CTD PMID:26377693 Itgb6 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of ITGB6 mRNA CTD PMID:21396975 Itgb6 Rat L-methionine multiple interactions ISO Itgb6 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of ITGB6 mRNA CTD PMID:20938992 Itgb6 Rat manganese(II) chloride decreases methylation ISO ITGB6 (Homo sapiens) 6480464 manganese chloride results in decreased methylation of ITGB6 gene CTD PMID:27913844 Itgb6 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of ITGB6 mRNA CTD PMID:28801915 Itgb6 Rat manganese(II) chloride increases methylation EXP 6480464 manganese chloride results in increased methylation of ITGB6 gene CTD PMID:28801915 Itgb6 Rat mercury dibromide increases expression ISO ITGB6 (Homo sapiens) 6480464 mercuric bromide results in increased expression of ITGB6 mRNA CTD PMID:26272509 Itgb6 Rat mercury dibromide multiple interactions ISO ITGB6 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ITGB6 mRNA CTD PMID:27188386 Itgb6 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of ITGB6 mRNA CTD PMID:22504374 Itgb6 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of ITGB6 mRNA CTD PMID:30047161 Itgb6 Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of ITGB6 mRNA CTD PMID:28801915 Itgb6 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of ITGB6 mRNA CTD PMID:18164116 Itgb6 Rat nickel atom increases expression ISO ITGB6 (Homo sapiens) 6480464 Nickel results in increased expression of ITGB6 mRNA CTD PMID:25583101 Itgb6 Rat ozone increases expression ISO Itgb6 (Mus musculus) 6480464 Ozone results in increased expression of ITGB6 mRNA CTD PMID:31626304 and PMID:33026818 Itgb6 Rat ozone multiple interactions ISO Itgb6 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of ITGB6 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of ITGB6 mRNA CTD PMID:34911549 Itgb6 Rat paclitaxel decreases expression ISO ITGB6 (Homo sapiens) 6480464 Paclitaxel results in decreased expression of ITGB6 mRNA CTD PMID:19682730 Itgb6 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of ITGB6 mRNA CTD PMID:33387578 Itgb6 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of ITGB6 mRNA CTD PMID:32680482 Itgb6 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of ITGB6 mRNA CTD PMID:35163327 Itgb6 Rat perfluorooctanoic acid decreases expression ISO ITGB6 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of ITGB6 mRNA CTD PMID:37738295 Itgb6 Rat permethrin decreases expression ISO ITGB6 (Homo sapiens) 6480464 Permethrin results in decreased expression of ITGB6 mRNA CTD PMID:37047231 Itgb6 Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of ITGB6 mRNA CTD PMID:30047161 Itgb6 Rat phenylmercury acetate multiple interactions ISO ITGB6 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ITGB6 mRNA CTD PMID:27188386 Itgb6 Rat phorbol 13-acetate 12-myristate multiple interactions ISO ITGB6 (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of ITGB6 mRNA CTD PMID:16979875 Itgb6 Rat pirinixic acid multiple interactions ISO ITGB6 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of ITGB6 mRNA CTD PMID:19710929 Itgb6 Rat pravastatin affects expression ISO Itgb6 (Mus musculus) 6480464 Pravastatin affects the expression of ITGB6 mRNA CTD PMID:27225895 Itgb6 Rat progesterone multiple interactions ISO ITGB6 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of ITGB6 mRNA and [Progesterone co-treated with Estradiol] results in decreased expression of ITGB6 mRNA CTD PMID:17404688 and PMID:20660070 Itgb6 Rat SB 203580 multiple interactions ISO ITGB6 (Homo sapiens) 6480464 SB 203580 inhibits the reaction [TGFB1 protein results in increased expression of ITGB6 mRNA] CTD PMID:21303922 Itgb6 Rat SB 431542 multiple interactions ISO ITGB6 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Itgb6 Rat silicon dioxide decreases expression ISO ITGB6 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of ITGB6 mRNA CTD PMID:25895662 Itgb6 Rat sodium arsenate decreases expression ISO ITGB6 (Homo sapiens) 6480464 sodium arsenate results in decreased expression of ITGB6 mRNA CTD PMID:12727804 Itgb6 Rat sodium arsenite decreases expression ISO ITGB6 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ITGB6 mRNA CTD PMID:12727804 more ... Itgb6 Rat sodium chloride multiple interactions ISO ITGB6 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of ITGB6 protein more ... CTD PMID:38598786 Itgb6 Rat sucrose increases expression EXP 6480464 Sucrose results in increased expression of ITGB6 mRNA CTD PMID:27470987 Itgb6 Rat tert-butyl hydroperoxide decreases expression ISO ITGB6 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of ITGB6 mRNA CTD PMID:12419474 Itgb6 Rat testosterone increases expression ISO ITGB6 (Homo sapiens) 6480464 Testosterone results in increased expression of ITGB6 mRNA CTD PMID:21592394 Itgb6 Rat testosterone increases expression ISO Itgb6 (Mus musculus) 6480464 Testosterone deficiency results in increased expression of ITGB6 mRNA CTD PMID:33848595 Itgb6 Rat testosterone multiple interactions ISO ITGB6 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of ITGB6 mRNA CTD PMID:21592394 Itgb6 Rat tetrachloromethane decreases expression ISO Itgb6 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of ITGB6 mRNA CTD PMID:25827057 Itgb6 Rat tetrathiomolybdate(2-) multiple interactions EXP 6480464 [Copper deficiency co-treated with tetrathiomolybdate] results in decreased expression of ITGB6 mRNA CTD PMID:22276220 Itgb6 Rat Theaflavin 3,3'-digallate affects expression ISO ITGB6 (Homo sapiens) 6480464 theaflavin-3 and 3'-digallate affects the expression of ITGB6 mRNA CTD PMID:34925699 Itgb6 Rat thioacetamide increases expression ISO Itgb6 (Mus musculus) 6480464 Thioacetamide results in increased expression of ITGB6 mRNA CTD PMID:18221819 Itgb6 Rat titanium dioxide increases expression ISO Itgb6 (Mus musculus) 6480464 titanium dioxide results in increased expression of ITGB6 mRNA CTD PMID:23557971 Itgb6 Rat titanium dioxide multiple interactions ISO Itgb6 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ITGB6 mRNA CTD PMID:29950665 Itgb6 Rat titanium dioxide increases expression ISO ITGB6 (Homo sapiens) 6480464 titanium dioxide results in increased expression of ITGB6 mRNA CTD PMID:19695317 Itgb6 Rat trichostatin A increases expression ISO ITGB6 (Homo sapiens) 6480464 trichostatin A results in increased expression of ITGB6 mRNA CTD PMID:24935251 Itgb6 Rat triptonide increases expression ISO Itgb6 (Mus musculus) 6480464 triptonide results in increased expression of ITGB6 mRNA CTD PMID:33045310 Itgb6 Rat valproic acid increases methylation ISO ITGB6 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of ITGB6 gene CTD PMID:29154799 Itgb6 Rat valproic acid increases expression ISO ITGB6 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ITGB6 mRNA CTD PMID:24383497 Itgb6 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of ITGB6 mRNA CTD PMID:19015723 Itgb6 Rat zaragozic acid A affects expression ISO Itgb6 (Mus musculus) 6480464 squalestatin 1 affects the expression of ITGB6 mRNA CTD PMID:27225895 Itgb6 Rat zaragozic acid A decreases expression EXP 6480464 squalestatin 1 results in decreased expression of ITGB6 mRNA CTD PMID:27225895 Itgb6 Rat zinc atom decreases expression ISO ITGB6 (Homo sapiens) 6480464 Zinc results in decreased expression of ITGB6 mRNA CTD PMID:19071009 Itgb6 Rat zinc atom increases expression ISO ITGB6 (Homo sapiens) 6480464 Zinc results in increased expression of ITGB6 mRNA CTD PMID:16870260 Itgb6 Rat zinc atom multiple interactions ISO ITGB6 (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of ITGB6 mRNA CTD PMID:16979875 Itgb6 Rat zinc dichloride increases expression ISO ITGB6 (Homo sapiens) 6480464 zinc chloride results in increased expression of ITGB6 mRNA CTD PMID:16870260 Itgb6 Rat zinc(0) multiple interactions ISO ITGB6 (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of ITGB6 mRNA CTD PMID:16979875 Itgb6 Rat zinc(0) increases expression ISO ITGB6 (Homo sapiens) 6480464 Zinc results in increased expression of ITGB6 mRNA CTD PMID:16870260 Itgb6 Rat zinc(0) decreases expression ISO ITGB6 (Homo sapiens) 6480464 Zinc results in decreased expression of ITGB6 mRNA CTD PMID:19071009
Imported Annotations - KEGG (archival)
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2-palmitoylglycerol (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxynon-2-enal (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (EXP) aflatoxin B1 (EXP,ISO) alpha-Zearalanol (EXP) amitriptyline (EXP) aristolochic acid A (ISO) Azoxymethane (ISO) benzo[a]pyrene (EXP,ISO) Benzo[k]fluoranthene (ISO) beta-naphthoflavone (EXP) bexarotene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) bortezomib (ISO) cadmium atom (ISO) cadmium dichloride (ISO) calcitriol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloroprene (ISO) choline (ISO) cisplatin (ISO) cobalt dichloride (EXP) cocaine (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) Cuprizon (EXP) cycloheximide (ISO) cyclosporin A (ISO) cypermethrin (EXP) DDE (ISO) dextran sulfate (ISO) dibutyl phthalate (ISO) dimethylarsinic acid (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) folic acid (ISO) furan (EXP) furfural (ISO) gemcitabine (ISO) genistein (ISO) gentamycin (EXP) glyphosate (ISO) hydrogen peroxide (ISO) Indeno[1,2,3-cd]pyrene (ISO) indole-3-methanol (EXP) L-methionine (ISO) manganese(II) chloride (EXP,ISO) mercury dibromide (ISO) methimazole (EXP) N-methyl-4-phenylpyridinium (EXP) N-nitrosodiethylamine (EXP) nickel atom (ISO) ozone (ISO) paclitaxel (ISO) paracetamol (EXP) paraquat (EXP) perfluorooctanoic acid (EXP,ISO) permethrin (ISO) phenobarbital (EXP) phenylmercury acetate (ISO) phorbol 13-acetate 12-myristate (ISO) pirinixic acid (ISO) pravastatin (ISO) progesterone (ISO) SB 203580 (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium chloride (ISO) sucrose (EXP) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (ISO) tetrathiomolybdate(2-) (EXP) Theaflavin 3,3'-digallate (ISO) thioacetamide (ISO) titanium dioxide (ISO) trichostatin A (ISO) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP) zaragozic acid A (EXP,ISO) zinc atom (ISO) zinc dichloride (ISO) zinc(0) (ISO)
Biological Process
biological_process (ND) bone development (IEA,ISO) bronchiole development (IEA,ISO) cell adhesion (IEA) cell adhesion mediated by integrin (IBA,IEA,ISO,ISS) cell migration (IBA,ISO) cell morphogenesis (IEA,ISO) cell-cell adhesion (IBA) cell-matrix adhesion (IBA,IEA,ISO) cellular response to ionizing radiation (IEA,ISO) enamel mineralization (IEA,ISO) gene expression (IEA,ISO) hard palate development (IEA,ISO) immune response (IEA,ISO) inflammatory response (IEA,ISO) integrin-mediated signaling pathway (IBA,IEA) Langerhans cell differentiation (IEA,ISO) lung alveolus development (IEA,ISO) memory T cell differentiation (ISO) phospholipid homeostasis (IEA,ISO) response to virus (IEA,ISO) response to wounding (IEA,ISO) skin development (IEA,ISO) surfactant homeostasis (IEA,ISO) transforming growth factor beta production (IEA,ISO) transforming growth factor beta receptor signaling pathway (IEA,ISO) wound healing (IEA,ISO)
Cellular Component
anchoring junction (IEA) cell surface (IBA,IEA,ISO) external side of plasma membrane (IEA,ISO) focal adhesion (IBA,IEA,ISO,ISS) integrin alphav-beta6 complex (IBA,IEA,ISO,ISS) membrane (IEA) plasma membrane (IEA) receptor complex (IEA,ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Integrins: bidirectional, allosteric signaling machines.
Hynes RO Cell 2002 Sep 20;110(6):673-87.
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
Loss of integrin alpha(v)beta6-mediated TGF-beta activation causes Mmp12-dependent emphysema.
Morris DG, etal., Nature 2003 Mar 13;422(6928):169-73.
5.
Inhibition of integrin alphavbeta6 on cholangiocytes blocks transforming growth factor-beta activation and retards biliary fibrosis progression.
Patsenker E, etal., Gastroenterology. 2008 Aug;135(2):660-70. Epub 2008 Apr 16.
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
Integrin alphavbeta6 is a marker of the progression of biliary and portal liver fibrosis and a novel target for antifibrotic therapies.
Popov Y, etal., J Hepatol. 2008 Mar;48(3):453-64. Epub 2008 Jan 14.
8.
GOA pipeline
RGD automated data pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Comprehensive gene review and curation
RGD comprehensive gene curation
12.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
13.
The integrins.
Takada Y, etal., Genome Biol. 2007;8(5):215.
Itgb6 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 65,454,964 - 65,579,179 (-) NCBI GRCr8 mRatBN7.2 3 45,046,295 - 45,170,532 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 45,048,044 - 45,121,671 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 48,404,699 - 48,477,782 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 56,988,255 - 57,061,340 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 54,757,778 - 54,831,418 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 46,652,624 - 46,775,362 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 46,652,623 - 46,726,958 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 51,760,871 - 51,883,770 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 42,286,140 - 42,360,793 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 42,182,533 - 42,257,165 (-) NCBI Celera 3 44,745,206 - 44,817,710 (-) NCBI Celera Cytogenetic Map 3 q21 NCBI
ITGB6 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 160,099,671 - 160,200,272 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 160,099,667 - 160,271,888 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 160,956,182 - 161,056,783 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 160,666,479 - 160,764,836 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 160,783,739 - 160,882,097 NCBI Celera 2 154,569,718 - 154,668,069 (-) NCBI Celera Cytogenetic Map 2 q24.2 NCBI HuRef 2 152,841,567 - 152,939,796 (-) NCBI HuRef CHM1_1 2 160,964,913 - 161,062,919 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 160,557,539 - 160,657,754 (-) NCBI T2T-CHM13v2.0
Itgb6 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 60,428,636 - 60,553,005 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 60,428,636 - 60,552,987 (-) Ensembl GRCm39 Ensembl GRCm38 2 60,598,292 - 60,722,603 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 60,598,292 - 60,722,643 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 60,436,349 - 60,560,660 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 60,399,131 - 60,474,500 (-) NCBI MGSCv36 mm8 Celera 2 62,295,485 - 62,419,857 (-) NCBI Celera Cytogenetic Map 2 C1.1- C1.2 NCBI cM Map 2 34.81 NCBI
Itgb6 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955449 13,448,084 - 13,520,879 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955449 13,387,013 - 13,520,879 (+) NCBI ChiLan1.0 ChiLan1.0
ITGB6 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 62,791,601 - 62,961,884 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 62,806,572 - 62,909,714 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 47,386,913 - 47,496,491 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 164,757,913 - 164,867,426 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 164,764,251 - 164,867,426 (-) Ensembl panpan1.1 panPan2
ITGB6 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 36 5,833,206 - 5,962,699 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 36 5,834,638 - 5,962,633 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 36 5,972,263 - 6,101,021 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 36 5,957,679 - 6,086,682 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 36 5,957,684 - 6,086,586 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 36 5,974,904 - 6,103,502 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 36 6,018,081 - 6,146,821 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 36 6,127,531 - 6,256,234 (-) NCBI UU_Cfam_GSD_1.0
Itgb6 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 122,961,499 - 123,089,078 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936469 18,581,840 - 18,650,123 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936469 18,581,855 - 18,650,109 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ITGB6 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 67,041,522 - 67,175,234 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 67,041,516 - 67,175,409 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 74,181,822 - 74,276,814 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ITGB6 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 45,506,355 - 45,650,979 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 45,504,987 - 45,595,543 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 153,971,887 - 154,066,448 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Itgb6
.
Predicted Target Of
Count of predictions: 46 Count of miRNA genes: 34 Interacting mature miRNAs: 40 Transcripts: ENSRNOT00000011030 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10401810 Kidm53 Kidney mass QTL 53 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 8227194 47233430 Rat 2298542 Neuinf11 Neuroinflammation QTL 11 3.9 nervous system integrity trait (VT:0010566) spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126) 3 15005422 76927699 Rat 1358362 Srcrt2 Stress Responsive Cort QTL 2 2.78 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 38192233 133483320 Rat 737818 Hcar12 Hepatocarcinoma resistance QTL 12 2.6 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 3 29463235 118376539 Rat 9590286 Uminl1 Urine mineral level QTL 1 3.5 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 3 28249687 73249687 Rat 10450816 Scl75 Serum cholesterol level QTL 75 4.4 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 38192233 50749747 Rat 2313093 Bmd77 Bone mineral density QTL 77 2.2 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 3 27494621 50302886 Rat 1581503 Cm58 Cardiac mass QTL 58 2.7 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 43827364 121056321 Rat 12879852 Cm93 Cardiac mass QTL 93 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 18311454 47233430 Rat 12879853 Am5 Aortic mass QTL 5 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 18311454 47233430 Rat 12879854 Kidm63 Kidney mass QTL 63 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 18311454 47233430 Rat 61356 Bp37 Blood pressure QTL 37 3 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 1358905 Hrtrt17 Heart rate QTL 17 5.9 0.000014 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 10861912 89878372 Rat 12879849 Bw180 Body weight QTL 180 0.037 body mass (VT:0001259) body weight (CMO:0000012) 3 18311454 47233430 Rat 70191 BpQTLcluster4 Blood pressure QTL cluster 4 3 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 3 10778704 50302886 Rat 12879850 Cm91 Cardiac mass QTL 91 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 18311454 47233430 Rat 2313101 Bmd76 Bone mineral density QTL 76 3.6 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 3 27494621 50302886 Rat 731172 Bp151 Blood pressure QTL 151 0.04 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 18311454 47233430 Rat 12879851 Cm92 Cardiac mass QTL 92 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 18311454 47233430 Rat 8694196 Abfw2 Abdominal fat weight QTL 2 16.58 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 3 28249687 73249687 Rat 2301971 Cm71 Cardiac mass QTL 71 4.63 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 3 41874578 155617519 Rat 1358885 Bp251 Blood pressure QTL 251 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 2301970 Bw81 Body weight QTL 81 5.19 body mass (VT:0001259) body weight (CMO:0000012) 3 41874578 155617519 Rat 2290452 Scl56 Serum cholesterol level QTL 56 2.26 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 3 1 91609953 Rat 12879868 Am6 Aortic mass QTL 6 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 3 31426403 70668733 Rat 11565451 Bw177 Body weight QTL 177 0.002 body mass (VT:0001259) body weight (CMO:0000012) 3 31426403 70668733 Rat 10450852 Stl33 Serum triglyceride level QTL 33 3.4 0.05 blood LDL triglyceride amount (VT:0010699) blood lipoprotein triglyceride level (CMO:0002685) 3 38192233 50749747 Rat 1358888 Bp264 Blood pressure QTL 264 4.43 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 3 14489145 121056321 Rat 11565452 Kidm57 Kidney mass QTL 57 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 3 31426403 70668733 Rat 4889975 Bmd81 Bone mineral density QTL 81 4.3 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 3 38710365 50302886 Rat 12879866 Cm94 Cardiac mass QTL 94 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 3 31426403 70668733 Rat 12879867 Cm95 Cardiac mass QTL 95 0.047 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 3 31426403 70668733 Rat 1300178 Hrtrt4 Heart rate QTL 4 3.74 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 3 43827364 90905114 Rat 2302055 Pia30 Pristane induced arthritis QTL 30 3.5 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 3 27936919 72936919 Rat 634317 Bw117 Body weight QTL 117 3.58 abdominal fat pad mass (VT:1000711) abdominal fat pad weight to body weight ratio (CMO:0000095) 3 39454637 53296578 Rat 1331795 Rf30 Renal function QTL 30 3.708 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 3 39454637 89115240 Rat 70216 Cm14 Cardiac mass QTL 14 2.1 heart mass (VT:0007028) heart wet weight (CMO:0000069) 3 31172320 163586636 Rat 1354589 Bw31 Body weight QTL 31 3.3 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 78196190 Rat 2303593 Gluco46 Glucose level QTL 46 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 3 28468571 73468571 Rat 1354590 Despr11 Despair related QTL 11 0.000031 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 3 28468571 73468571 Rat 2313079 Bss73 Bone structure and strength QTL 73 1.5 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 3 27494621 50302886 Rat 1331777 Bw24 Body weight QTL 24 3.503 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 89115240 Rat 631647 Bp122 Blood pressure QTL 122 6.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 3 30684642 75684642 Rat 2313076 Bss74 Bone structure and strength QTL 74 2 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 3 27494621 50302886 Rat 1300169 Bp177 Blood pressure QTL 177 2.96 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 3 33703347 61017857 Rat 10450813 Scl74 Serum cholesterol level QTL 74 5.8 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 38192233 50749747 Rat 1559282 Emca5 Estrogen-induced mammary cancer QTL 5 3.9 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 3 43827364 169034231 Rat 2302276 Bw82 Body weight QTL 82 4.32 body mass (VT:0001259) body weight (CMO:0000012) 3 39454637 62951183 Rat 738019 Anxrr10 Anxiety related response QTL 10 3.9 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 3 38517803 83517803 Rat 9590136 Scort3 Serum corticosterone level QTL 3 23.37 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 3 28249687 73249687 Rat 10450804 Scl70 Serum cholesterol level QTL 70 4.7 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 61419 Cia11 Collagen induced arthritis QTL 11 5.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 3 30356773 98535386 Rat 1354597 Kidm13 Kidney mass QTL 13 2.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 3 41874578 104104347 Rat 8552950 Pigfal12 Plasma insulin-like growth factor 1 level QTL 12 7.3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 3 28249687 73249687 Rat 631676 Cm8 Cardiac mass QTL 8 7.03 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 3 16954708 61954708 Rat 10450794 Scl69 Serum cholesterol level QTL 69 6.3 0.001 blood LDL cholesterol amount (VT:0000181) blood low density lipoprotein cholesterol level (CMO:0000053) 3 20714090 65714090 Rat 8694386 Bw159 Body weight QTL 159 4.52 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 3 28249687 73249687 Rat 1354604 Bw36 Body weight QTL 36 2.9 body mass (VT:0001259) body weight (CMO:0000012) 3 33703347 104104347 Rat 2313049 Bss72 Bone structure and strength QTL 72 2.6 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 3 27494621 50302886 Rat 2301400 Cm68 Cardiac mass QTL 68 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 3 31426403 70668733 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
104
90
90
59
25
59
6
217
96
85
45
57
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011030 ⟹ ENSRNOP00000011030
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 3 45,048,044 - 45,121,671 (-) Ensembl Rnor_6.0 Ensembl 3 46,654,373 - 46,726,946 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000086576 ⟹ ENSRNOP00000074271
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 3 46,652,623 - 46,726,958 (-) Ensembl
RefSeq Acc Id:
NM_001004263 ⟹ NP_001004263
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 65,456,690 - 65,530,333 (-) NCBI mRatBN7.2 3 45,048,021 - 45,121,671 (-) NCBI Rnor_6.0 3 46,654,350 - 46,726,946 (-) NCBI Rnor_5.0 3 51,760,871 - 51,883,770 (-) NCBI RGSC_v3.4 3 42,286,140 - 42,360,793 (-) RGD Celera 3 44,745,206 - 44,817,710 (-) RGD
Sequence:
GTCTTAATGAAAGCTTTCGAATTTACAGCTCAAGTTACTTTTCAAAGCAGTTGAAAACTGAACCGAATGGGGATTGAGCTGGTCTGCCTGTTCCTGCTACTTCTAGGAAGGAATGATCACGTCCAAGG
hide sequence
RefSeq Acc Id:
XM_006234232 ⟹ XP_006234294
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 65,454,964 - 65,579,179 (-) NCBI mRatBN7.2 3 45,046,295 - 45,170,532 (-) NCBI Rnor_6.0 3 46,652,624 - 46,775,362 (-) NCBI Rnor_5.0 3 51,760,871 - 51,883,770 (-) NCBI
Sequence:
AATCAGCCAGGCGCTCTGTCACTCACCAGCAGTGTCTCTGCCTAGCGGTGTACACCCACATGCC
hide sequence
RefSeq Acc Id:
XM_006234233 ⟹ XP_006234295
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 3 65,454,964 - 65,530,404 (-) NCBI mRatBN7.2 3 45,046,295 - 45,121,737 (-) NCBI Rnor_6.0 3 46,652,624 - 46,727,265 (-) NCBI Rnor_5.0 3 51,760,871 - 51,883,770 (-) NCBI
Sequence:
TTAGCTTAAGTTCTGGTGTTTTGCTTCACATCCTCACTGCCTTAAACTAAAAATTGTCATAAGAAGCATACATTTAAATCCGTCTTTTGACAGCTCCTTGATTAGCATTTCACTGAAGAGACCGAGTC
hide sequence
RefSeq Acc Id:
NP_001004263 ⟸ NM_001004263
- Peptide Label:
precursor
- UniProtKB:
Q6AYF4 (UniProtKB/Swiss-Prot), A6HLT3 (UniProtKB/TrEMBL)
- Sequence:
MGIELVCLFLLLLGRNDHVQGGCAWSGAETCSDCLLTGPHCAWCSQENFTHLSGAGERCDTPENLLAKGCQLPFIENPVSQVEILQNKPLSVGRQKNSSDIVQIAPQSLVLKLRPGGEQTLQVQVRQT
hide sequence
RefSeq Acc Id:
XP_006234294 ⟸ XM_006234232
- Peptide Label:
isoform X1
- Sequence:
MGIELVCLFLLLLGRNDHVQGGCAWSGAETCSDCLLTGPHCAWCSQENFTHLSGAGERCDTPEN
hide sequence
RefSeq Acc Id:
XP_006234295 ⟸ XM_006234233
- Peptide Label:
isoform X1
- Sequence:
MGIELVCLFLLLLGRNDHVQGGCAWSGAETCSDCLLTGPHCAWCSQENFTHLSGAGERCDTPENLLAKGCQLPFIENPVSQVEILQNKPLSVGRQKNSSDIVQIAPQSLVLKLRPGGEQTLQVQVRQT
hide sequence
Ensembl Acc Id:
ENSRNOP00000074271 ⟸ ENSRNOT00000086576
Ensembl Acc Id:
ENSRNOP00000011030 ⟸ ENSRNOT00000011030
RGD ID: 13692103 Promoter ID: EPDNEW_R2617 Type: initiation region Name: Itgb6_1 Description: integrin beta 6 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 3 46,727,009 - 46,727,069 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2018-05-29
Itgb6
integrin subunit beta 6
Itgb6
integrin beta 6
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2017-05-16
Itgb6
integrin beta 6
Itgb6
integrin subunit beta 6
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-12-23
Itgb6
integrin subunit beta 6
Itgb6
integrin, beta 6
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Itgb6
integrin, beta 6
Symbol and Name status set to approved
1299863 APPROVED
2005-02-14
Itgb6
integrin, beta 6
Symbol and Name status set to provisional
70820 PROVISIONAL
