Advanced Search (OLGA)

Gene: Prkar1b (protein kinase cAMP-dependent type I regulatory subunit beta) Rattus norvegicus

Analyze

Symbol:

Prkar1b

Name:

protein kinase cAMP-dependent type I regulatory subunit beta

RGD ID:

3392

Description:

Enables cAMP binding activity and cAMP-dependent protein kinase regulator activity. Involved in positive regulation of excitatory postsynaptic potential; positive regulation of fear response; and positive regulation of long-term synaptic potentiation. Part of cAMP-dependent protein kinase complex. Orthologous to human PRKAR1B (protein kinase cAMP-dependent type I regulatory subunit beta); PARTICIPATES IN protein kinase A (PKA) signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cAMP dependent protein kinase, subunit type 1 beta; cAMP-dependent protein kinase type I-beta regulatory subunit; LOC360774; MGC125243; Prkar1b_mapped; protein kinase cAMP-dependent type 1 regulatory subunit beta; protein kinase, cAMP dependent regulatory, type 1 beta; protein kinase, cAMP dependent regulatory, type I, beta; protein kinase, camp dependent regulatory, type i, beta (mapped); protein kinase, cAMP-dependent, regulatory subunit type I beta; RGD1563094; RIbeta; similar to cAMP-dependent protein kinase type I-beta regulatory subunit

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

Prkar1b^em1Tua ; Prkar1b^em2Tua

Genetic Models:

F344-Prkar1b^em2Tua ; F344-Prkar1b^em1Tua

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	20,606,066 - 20,738,766 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	20,618,757 - 20,738,766 (+)	Ensembl				GRCr8
mRatBN7.2	12	15,492,233 - 15,624,942 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	15,511,801 - 15,624,942 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	16,336,888 - 16,436,081 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	16,960,627 - 17,059,817 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	15,984,377 - 16,082,381 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	17,614,536 - 17,713,567 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	17,614,632 - 17,712,373 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	19,611,694 - 19,708,682 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	16,025,867 - 16,131,129 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	17,279,498 - 17,377,254 (+)	NCBI		Celera
Cytogenetic Map	12	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

hypertension (ISO)

MARBACH-SCHAAF NEURODEVELOPMENTAL SYNDROME (ISO)

Neurodevelopmental Disorders (ISO)

Tremor (IMP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-palmitoylglycerol (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4-hydroxyphenyl retinamide (ISO)

4-vinylcyclohexene dioxide (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP,ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

allethrin (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

C60 fullerene (EXP)

caffeine (ISO)

cefaloridine (EXP)

CGP 52608 (ISO)

chlormequat chloride (EXP)

cisplatin (EXP,ISO)

colforsin daropate hydrochloride (ISO)

coumarin (ISO)

crocidolite asbestos (ISO)

cyhalothrin (EXP)

cypermethrin (EXP)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dimethyl sulfoxide (ISO)

doxorubicin (ISO)

endosulfan (EXP)

ethanol (ISO)

fenvalerate (EXP)

fipronil (EXP)

fulvestrant (ISO)

gentamycin (EXP)

ketoconazole (ISO)

lead(0) (ISO)

methapyrilene (ISO)

methotrexate (ISO)

methoxychlor (EXP)

mono(2-ethylhexyl) phthalate (ISO)

N-ethyl-N-nitrosourea (ISO)

N-methyl-4-phenylpyridinium (EXP)

O-methyleugenol (ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

perfluorooctane-1-sulfonic acid (ISO)

potassium chromate (ISO)

potassium dichromate (ISO)

progesterone (ISO)

pyrethrins (EXP)

quercetin (ISO)

rotenone (EXP,ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

tamoxifen (ISO)

temozolomide (ISO)

tetrachloromethane (EXP,ISO)

thiram (ISO)

titanium dioxide (EXP,ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

trovafloxacin (ISO)

urethane (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating G protein-coupled receptor signaling pathway (IBA)

learning or memory (ISO)

modulation of chemical synaptic transmission (IEA,ISO)

negative regulation of cAMP/PKA signal transduction (IEA,ISO)

positive regulation of excitatory postsynaptic potential (IMP)

positive regulation of fear response (IMP)

positive regulation of long-term synaptic potentiation (IMP)

regulation of protein kinase activity (IDA)

regulation of synaptic vesicle cycle (IEA,ISO)

Cellular Component

cAMP-dependent protein kinase complex (IBA,IDA,IEA,ISO)

cytoplasm (IEA,ISO)

cytosol (IBA)

glutamatergic synapse (IEA,ISO)

hippocampal mossy fiber to CA3 synapse (IEA,ISO)

multivesicular body (IEA,ISO)

plasma membrane (IEA,ISO,ISS)

postsynapse (IEA,ISO)

Schaffer collateral - CA1 synapse (IEA,ISO)

synapse (IEA,ISO)

Molecular Function

cAMP binding (IBA,IDA,IEA)

cAMP-dependent protein kinase inhibitor activity (IBA,IEA,ISO)

cAMP-dependent protein kinase regulator activity (IDA,IEA,ISO)

nucleotide binding (IEA)

protein binding (ISO)

protein kinase A catalytic subunit binding (IBA,IC,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

protein kinase A (PKA) signaling pathway (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal excitatory postsynaptic potential (IMP)

decreased freezing behavior (IMP)

increased thermal nociceptive threshold (IMP)

increased vertical activity (IMP)

reduced long-term potentiation (IMP)

References

References - curated

#	Reference Title	Reference Citation
1.	Differential effects of haloperidol and clozapine on cAMP binding, protein kinase A (PKA) activity, and mRNA and protein expression of selective regulatory and catalytic subunit isoforms of PKA in rat brain.	Dwivedi Y, etal., J Pharmacol Exp Ther. 2002 Apr;301(1):197-209.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Deficiency of the RIβ subunit of protein kinase A causes body tremor and impaired fear conditioning memory in rats.	Hoang Trung H, etal., Sci Rep. 2021 Jan 21;11(1):2039. doi: 10.1038/s41598-021-81515-x.
4.	An active protein kinase A (PKA) is involved in meiotic arrest of rat growing oocytes.	Kovo M, etal., Reproduction. 2006 Jul;132(1):33-43.
5.	Rat RI beta isoform of type I regulatory subunit of cyclic adenosine monophosphate-dependent protein kinase: cDNA sequence analysis, mRNA tissue specificity, and rat/mouse difference in expression in testis.	Massa JS, etal., Mol Reprod Dev 1990 Jun;26(2):129-33.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Clustered distribution of cAMP-dependent protein kinase regulatory isoform RI alpha during the development of the rat brain.	Mucignat-Caretta C and Caretta A, J Comp Neurol. 2002 Sep 30;451(4):324-33.
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	GOA pipeline	RGD automated data pipeline
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Concordance of murine quantitative trait loci for salt-induced hypertension with rat and human loci.	Sugiyama F, etal., Genomics 2001 Jan 1;71(1):70-7.
12.	Localized effects of cAMP mediated by distinct routes of protein kinase A.	Tasken K and Aandahl EM, Physiol Rev. 2004 Jan;84(1):137-67.

Additional References at PubMed

PMID:7568030	PMID:8548807	PMID:9054501	PMID:12477932	PMID:21502359	PMID:21812984	PMID:24413018	PMID:30053369

Genomics

Comparative Map Data

Prkar1b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	20,606,066 - 20,738,766 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	12	20,618,757 - 20,738,766 (+)	Ensembl				GRCr8
mRatBN7.2	12	15,492,233 - 15,624,942 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	15,511,801 - 15,624,942 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	12	16,336,888 - 16,436,081 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	16,960,627 - 17,059,817 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	15,984,377 - 16,082,381 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	17,614,536 - 17,713,567 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	17,614,632 - 17,712,373 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	12	19,611,694 - 19,708,682 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	12	16,025,867 - 16,131,129 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	12	17,279,498 - 17,377,254 (+)	NCBI		Celera
Cytogenetic Map	12	q11	NCBI

PRKAR1B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	549,197 - 728,934 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	549,196 - 728,268 (-)	Ensembl			hg38	GRCh38
GRCh37	7	588,834 - 767,313 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	555,913 - 718,659 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	7	558,390 - 735,169 (-)	NCBI		Celera
Cytogenetic Map	7	p22.3	NCBI
HuRef	7	507,400 - 685,578 (-)	NCBI		HuRef
CHM1_1	7	588,428 - 766,905 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	650,161 - 832,029 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	650,549 - 825,534 (-)	NCBI

Prkar1b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	139,003,059 - 139,136,458 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	139,003,061 - 139,135,756 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	139,017,304 - 139,150,703 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	139,017,306 - 139,150,001 (-)	Ensembl			mm10	GRCm38
MGSCv37	5	139,493,258 - 139,605,706 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	139,270,948 - 139,383,333 (-)	NCBI		MGSCv36	mm8
Celera	5	136,072,385 - 136,181,556 (-)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	77.74	NCBI

Prkar1b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955460	8,357,637 - 8,460,396 (-)	Ensembl
ChiLan1.0	NW_004955460	8,357,890 - 8,479,875 (-)	NCBI	ChiLan1.0	ChiLan1.0

PRKAR1B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	5,484,409 - 5,661,348 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	53,809,101 - 53,986,014 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	700,691 - 876,497 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	923,668 - 1,097,792 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	923,668 - 1,097,456 (-)	Ensembl			panPan2	panpan1.1

PRKAR1B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	16,135,406 - 16,248,567 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	16,135,715 - 16,247,465 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	17,607,212 - 17,720,355 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	16,264,735 - 16,377,921 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	16,265,043 - 16,382,743 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	16,067,389 - 16,180,517 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	15,993,837 - 16,106,858 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	16,283,599 - 16,396,577 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Prkar1b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	144,047,325 - 144,167,636 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936754	842,343 - 963,024 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936754	842,697 - 963,002 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PRKAR1B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	343,139 - 425,165 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	343,124 - 425,154 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	190,914 - 227,592 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PRKAR1B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	20,838,247 - 21,016,196 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	20,853,763 - 21,016,257 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666090	658,653 - 842,505 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Prkar1b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	26,202,375 - 26,315,352 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624740	26,202,882 - 26,315,987 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Prkar1b
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	16	14,066,291 - 14,184,001 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Prkar1b
1363 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	504
Count of miRNA genes:	230
Interacting mature miRNAs:	286
Transcripts:	ENSRNOT00000031896
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312418	Kidm41	Kidney mass QTL 41	3.7	0.0001	kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	12	5921918	25247790	Rat
61443	Btemp2	Thermal response to stress QTL 2	3.3	0.000094	body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	12	20139028	26430640	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	11200494	52308831	Rat
2306789	Ean6	Experimental allergic neuritis QTL 6	4.9		nervous system integrity trait (VT:0010566)	experimental autoimmune neuritis severity score (CMO:0001528)	12	1	29775522	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	3489416	48489416	Rat
1331739	Hrtrt14	Heart rate QTL 14	3.56232		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	12	1	38687564	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	18473041	52308831	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200497	52308831	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	15264248	52308831	Rat
61331	Eau2	Experimental allergic uveoretinitis QTL 2		0.0005	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	12	1	33700600	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	11743528	52308831	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	11200494	52308831	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	1	38635130	Rat
6893681	Bw109	Body weight QTL 109	2.3	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28133365	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	12233000	30490641	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	17464979	46784661	Rat
1300174	Bw15	Body weight QTL 15	2.93		body mass (VT:0001259)	body weight loss (CMO:0001399)	12	1	28606299	Rat
1331786	Kidm11	Kidney mass QTL 11	3.571		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	12	16187438	52308831	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	1	33700556	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	16135029	52308831	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	51213550	Rat
1331763	Wbc2	White blood cell count QTL 2	3.162		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	12	11200494	52308831	Rat
61416	Pia4	Pristane induced arthritis QTL 4	8.4		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	12	18749469	36488809	Rat
7204484	Bp358	Blood pressure QTL 358		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	1	24849755	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	11200494	52308831	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	41361854	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	18749469	34312613	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	2747694	47747694	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	18473041	52308831	Rat
2303568	Bw88	Body weight QTL 88	3		body mass (VT:0001259)	body weight (CMO:0000012)	12	1	28606299	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	3087180	48087180	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
7243862	Mcs30	Mammary carcinoma susceptibility QTL 30	8.62		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	12	5633306	50633306	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	16135029	52308831	Rat
2293086	Iddm30	Insulin dependent diabetes mellitus QTL 30	3.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	7901625	33938215	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	11200494	52308831	Rat
1331755	Bp219	Blood pressure QTL 219	3.041		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	16187438	33700556	Rat

Markers in Region

RH132420

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	15,624,642 - 15,624,850 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	17,713,268 - 17,713,475	NCBI	Rnor6.0
Rnor_5.0	12	19,708,394 - 19,708,601	UniSTS	Rnor5.0
RGSC_v3.4	12	16,130,841 - 16,131,048	UniSTS	RGSC3.4
Celera	12	17,376,966 - 17,377,173	UniSTS
RH 3.4 Map	12	245.9	UniSTS
Cytogenetic Map	12	q11	UniSTS

Prkar1b

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	15,624,102 - 15,624,853 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	17,712,728 - 17,713,478	NCBI	Rnor6.0
Rnor_5.0	12	19,707,854 - 19,708,604	UniSTS	Rnor5.0
RGSC_v3.4	12	16,130,301 - 16,131,051	UniSTS	RGSC3.4
Celera	12	17,376,426 - 17,377,176	UniSTS
Cytogenetic Map	12	q11	UniSTS

Genetic Models

This gene Prkar1b is modified in the following models/strains:

F344-Prkar1b^em2Tua F344-Prkar1b^em1Tua

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	40	59	6	304	140	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001033679	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001418675	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008768942	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089115	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089116	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089117	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089118	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC121192	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC091371	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC104679	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212815	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000031896 ⟹ ENSRNOP00000033202

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	20,640,241 - 20,738,766 (+)	Ensembl
mRatBN7.2 Ensembl	12	15,526,431 - 15,624,926 (+)	Ensembl
Rnor_6.0 Ensembl	12	17,614,632 - 17,712,373 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100560 ⟹ ENSRNOP00000097684

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	15,528,188 - 15,624,938 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101865 ⟹ ENSRNOP00000083988

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	20,618,757 - 20,738,764 (+)	Ensembl
mRatBN7.2 Ensembl	12	15,511,801 - 15,624,933 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117175 ⟹ ENSRNOP00000085372

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	12	20,625,911 - 20,738,750 (+)	Ensembl
mRatBN7.2 Ensembl	12	15,528,061 - 15,624,942 (+)	Ensembl

RefSeq Acc Id:

NM_001033679 ⟹ NP_001028851

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	20,640,241 - 20,738,766 (+)	NCBI
mRatBN7.2	12	15,526,403 - 15,624,942 (+)	NCBI
Rnor_6.0	12	17,614,565 - 17,713,556 (+)	NCBI
Rnor_5.0	12	19,611,694 - 19,708,682 (+)	NCBI
RGSC_v3.4	12	16,025,867 - 16,131,129 (+)	RGD
Celera	12	17,279,498 - 17,377,254 (+)	RGD

Sequence:

show sequence

CTACTCCCCACCTGGAGCTCAACGCCAAGATCTGAGTTTGACACAGGCTTACCAAGCCTGGCGC
ATGATGAGTCCACAGATCATGTGTGTCTCAGTGTGTGGGGAAGGCATGGGATGGGACCCTGTGG
AAATAAGTCAGTCACATGCTGAAGGCTGTGCTCAGACTACAGGGCTGGAGGAAAACAGGCAGAT
CCTGGCTCGGCAGAAGTCAAACTCACAGTGTGATTCCCACGATGAGGAGATCTCCCCAACACCT
CCAAATCCTGTGGTAAAGGCACGTCGTCGACGGGGTGGCGTGAGTGCTGAAGTCTACACTGAGG
AAGATGCCGTCTCCTACGTGAGGAAGGTCATTCCCAAGGACTATAAGACCATGACTGCGCTGGC
CAAGGCCATTTCTAAGAACGTGCTCTTTTCTCACCTGGATGACAACGAGAGAAGTGACATATTC
GATGCCATGTTTCCTGTCACCCACATCGATGGGGAAACAGTCATACAGCAAGGGAACGAAGGGG
ATAATTTCTACGTGATTGACCAAGGAGAAGTAGACGTATATGTGAACGGGGAGTGGGTGACCAA
CATCAGTGAGGGGGGAAGCTTCGGGGAGCTGGCCCTCATCTACGGCACCCCTAGAGCGGCTACT
GTGAAGGCCAAAACGGACCTCAAGCTCTGGGGCATCGACCGTGACAGCTACAGGCGCATCCTCA
TGGGAAGCACACTGAGGAAACGCAAGATGTATGAGGAATTCCTCAGCAAAGTCTCCATCTTAGA
GTCTCTGGAGAAGTGGGAACGCCTCACTGTAGCTGATGCCCTGGAGCCTGTGCAGTTTGAAGAT
GGAGAGAAAATCGTTGTGCAGGGGGAGCCTGGGGATGATTTCTACATCATCACAGAGGGTACTG
CTTCAGTCCTCCAGCGACGATCCCCCAACGAGGAGTATGTGGAGGTGGGGCGCCTTGGACCCTC
TGACTACTTTGGAGAGATTGCCCTGCTGCTGAACCGGCCCCGTGCAGCCACTGTGGTGGCACGG
GGTCCCCTCAAGTGTGTGAAGTTGGACCGGCCTCGTTTTGAGCGTGTCCTGGGCCCCTGCTCTG
AGATCCTGAAGAGAAACATCCAGCGTTACAACAGCTTCATCTCCCTAACTGTCTGAGCTTGTAT
TCCACCTGCACCCTTGGGGGCCTCCCCACGTGGCCCTGTGACCCATTCCCTATGCCAGGGGCCT
GGGAGCTGCTGGTTAGTGGCTGGGTGGGGCTGGTGCCTAGCACGGAGCCTCTCCTTTCTCTGGA
CTCAATTTTGGAGTAAATAACCATCTTGTGCTTTTTAAAAACAAAGGGCAAGTGGCAACTGCAT
CCCCAGACCAGGGAAGCGACAGCTGGCTCCCACAGTGGCCCTGTAGCCTTATCTTGGGGCCACC
CTATCCCCTTTCCAAGTCTTCTGGGAATTCTTGTCTGATCCCCGGACTTGAACTGGCCCTGTGT
CCTGCCAGGTCTCAAGAGTGGGGCTGTGGCTACCCTTGTAGCTTTCCCCCAGAGCTGGGAGTTA
GTCAGAACACTGTCCCTGGTCCTTGTAAGCTTCTCCGAGGTCTAGGCCCAGGTGTAATAGTAAG
CTATGATCCCAGAAAGTCAGGAGGTGGTGGCCGAGCCCACTCATTTACTCTTGGAAAGTCTGTT
TCTGGGTAGGCCAGGCACCCCTGACCTCATGTCAGGACAGTTGGCCAAGCCTGTGACCCCTTAC
TGGCTGGATGCCCAGATTGGGCAGGAAGTATGGCTGATGGTGGGGCTTTCCAAAAGTGATGAGT
GAGTCTGGGCTGACTTCTCATCTCCTGGAGCCCAGGAGCTATGGCTCTGTCAACCTGCCTATTG
GAGACCCAAAGGGACAGCAAGGAACTCCAACTTTCTGGTTAAAGCTGTAGGTTTGAGCCTTCCC
AGACTCTCTGTGTAACGCCCGAGTCCCTGTCCCCTGACTCCCAAACCTCTCTGCTCCCTTACAA
GAGGGGATAATGTATTGAAACCAGGCTTGACCCCACATCCCTAAACCATCAACAGTGGACTGTG
ATATGAGCCAGCCAGGCCCGAGGGCCACATGAGTGTCCACAACTGCTCAGTGTCCTCTGGATGA
CCAGCATGTCATGAGACAGTGTGATCAACCTTTGTCTGCCCCGCTGTGCACGTCTAGGTGACCC
TTCCAGCTGACCATCAGCTCCCTGCTGTGTGGCCCTGGCCATGTGTGTCTTGCCTGCACTGTGG
ACTATCTGTGGATTCTGTGGCCCTGTTCCCCCATCCCCTATTTATGTCACCAAGTGCTGCATGA
ACTATTAAATGTGCAATGAAGAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001418675 ⟹ NP_001405604

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	20,625,924 - 20,738,766 (+)	NCBI
mRatBN7.2	12	15,512,085 - 15,624,942 (+)	NCBI

RefSeq Acc Id:

XM_039089115 ⟹ XP_038945043

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	20,625,584 - 20,738,766 (+)	NCBI
mRatBN7.2	12	15,511,751 - 15,624,942 (+)	NCBI

RefSeq Acc Id:

XM_039089116 ⟹ XP_038945044

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	20,624,811 - 20,738,766 (+)	NCBI
mRatBN7.2	12	15,511,310 - 15,624,942 (+)	NCBI

RefSeq Acc Id:

XM_039089117 ⟹ XP_038945045

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	20,606,066 - 20,738,766 (+)	NCBI
mRatBN7.2	12	15,492,233 - 15,624,942 (+)	NCBI

RefSeq Acc Id:

XM_039089118 ⟹ XP_038945046

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	20,692,276 - 20,738,766 (+)	NCBI
mRatBN7.2	12	15,578,440 - 15,624,942 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001028851	(Get FASTA)	NCBI Sequence Viewer
	NP_001405604	(Get FASTA)	NCBI Sequence Viewer
	XP_038945043	(Get FASTA)	NCBI Sequence Viewer
	XP_038945044	(Get FASTA)	NCBI Sequence Viewer
	XP_038945045	(Get FASTA)	NCBI Sequence Viewer
	XP_038945046	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91371	(Get FASTA)	NCBI Sequence Viewer
	AAI04680	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000033202
	ENSRNOP00000083988
	ENSRNOP00000083988.1
GenBank Protein	P81377	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001028851 ⟸ NM_001033679
- Peptide Label:	isoform 2
- UniProtKB:	Q3SWU5 (UniProtKB/TrEMBL), F1M9X5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MMSPQIMCVSVCGEGMGWDPVEISQSHAEGCAQTTGLEENRQILARQKSNSQCDSHDEEISPTP PNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFSHLDDNERSDIF DAMFPVTHIDGETVIQQGNEGDNFYVIDQGEVDVYVNGEWVTNISEGGSFGELALIYGTPRAAT VKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFED GEKIVVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVAR GPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV hide sequence

Ensembl Acc Id:

ENSRNOP00000033202 ⟸ ENSRNOT00000031896

RefSeq Acc Id:	XP_038945045 ⟸ XM_039089117
- Peptide Label:	isoform X1
- UniProtKB:	P81377 (UniProtKB/Swiss-Prot), A0A8I6A184 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038945044 ⟸ XM_039089116
- Peptide Label:	isoform X1
- UniProtKB:	P81377 (UniProtKB/Swiss-Prot), A0A8I6A184 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038945043 ⟸ XM_039089115
- Peptide Label:	isoform X1
- UniProtKB:	P81377 (UniProtKB/Swiss-Prot), A0A8I6A184 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038945046 ⟸ XM_039089118
- Peptide Label:	isoform X2
- UniProtKB:	Q5BJR2 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000085372 ⟸ ENSRNOT00000117175

Ensembl Acc Id:

ENSRNOP00000097684 ⟸ ENSRNOT00000100560

Ensembl Acc Id:

ENSRNOP00000083988 ⟸ ENSRNOT00000101865

RefSeq Acc Id:	NP_001405604 ⟸ NM_001418675
- Peptide Label:	isoform 1
- UniProtKB:	P81377 (UniProtKB/Swiss-Prot), A0A8I6A184 (UniProtKB/TrEMBL)

Protein Domains

Cyclic nucleotide-binding

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P81377-F1-model_v2	AlphaFold	P81377	1-381	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698474

Promoter ID:

EPDNEW_R8997

Type:

multiple initiation site

Name:

Prkar1b_1

Description:

protein kinase cAMP-dependent type 1 regulatory subunit beta

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	17,614,537 - 17,614,597	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3392	AgrOrtholog
BioCyc Gene	G2FUF-19879	BioCyc
Ensembl Genes	ENSRNOG00000028733	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000031896	ENTREZGENE
	ENSRNOT00000101865	ENTREZGENE
	ENSRNOT00000101865.1	UniProtKB/Swiss-Prot
Gene3D-CATH	2.60.120.10	UniProtKB/Swiss-Prot
	cAMP-dependent protein kinase regulatory subunit, dimerization-anchoring domain	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7319686	IMAGE-MGC_LOAD
	IMAGE:7456971	IMAGE-MGC_LOAD
InterPro	cAMP-dep_kinase_reg_chain	UniProtKB/Swiss-Prot
	cAMP_dep_PK_reg_su	UniProtKB/Swiss-Prot
	cAMP_dep_PK_reg_su_I/II_a/b	UniProtKB/Swiss-Prot
	cNMP-bd-like	UniProtKB/Swiss-Prot
	cNMP-bd_CS	UniProtKB/Swiss-Prot
	cNMP-bd_dom	UniProtKB/Swiss-Prot
	RIbeta_DD	UniProtKB/Swiss-Prot
	RmlC-like_jellyroll	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109438	IMAGE-MGC_LOAD
	MGC:125243	IMAGE-MGC_LOAD
NCBI Gene	25521	ENTREZGENE
PANTHER	CAMP-DEPENDENT PROTEIN KINASE REGULATORY CHAIN	UniProtKB/Swiss-Prot
	CAMP-DEPENDENT PROTEIN KINASE TYPE I-BETA REGULATORY SUBUNIT	UniProtKB/Swiss-Prot
Pfam	cNMP_binding	UniProtKB/Swiss-Prot
	RIIa	UniProtKB/Swiss-Prot
PhenoGen	Prkar1b	PhenoGen
PIRSF	PK_regulatory	UniProtKB/Swiss-Prot
PRINTS	CAMPKINASE	UniProtKB/Swiss-Prot
PROSITE	CNMP_BINDING_1	UniProtKB/Swiss-Prot
	CNMP_BINDING_2	UniProtKB/Swiss-Prot
	CNMP_BINDING_3	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000028733	RatGTEx
SMART	cNMP	UniProtKB/Swiss-Prot
	RIIa	UniProtKB/Swiss-Prot
Superfamily-SCOP	Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit	UniProtKB/Swiss-Prot
	SSF51206	UniProtKB/Swiss-Prot
UniProt	A0A8I6A184	ENTREZGENE, UniProtKB/TrEMBL
	F1M9X5	ENTREZGENE, UniProtKB/TrEMBL
	KAP1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q3SWU5	ENTREZGENE, UniProtKB/TrEMBL
	Q5BJR2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-04-03	Prkar1b	protein kinase cAMP-dependent type I regulatory subunit beta	Prkar1b	protein kinase cAMP-dependent type 1 regulatory subunit beta	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-02-03	Prkar1b	protein kinase cAMP-dependent type 1 regulatory subunit beta	Prkar1b	protein kinase, cAMP-dependent, regulatory subunit type I beta	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-11-30	Prkar1b	protein kinase, cAMP-dependent, regulatory subunit type I beta	Prkar1b	protein kinase, cAMP dependent regulatory, type I, beta	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2007-02-05	Prkar1b	protein kinase, cAMP dependent regulatory, type I, beta	RGD1563094_predicted	similar to cAMP-dependent protein kinase type I-beta regulatory subunit (predicted)	Data merged from RGD:1563094	737654	APPROVED
2007-02-05	Prkar1b	protein kinase, cAMP dependent regulatory, type I, beta	Prkar1b_mapped	protein kinase, cAMP dependent regulatory, type I, beta (mapped)	gene upgraded from "mapped" status	1299863	APPROVED
2006-11-19	Prkar1b	protein kinase, cAMP dependent regulatory, type I, beta			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-19	Prkar1b_mapped	protein kinase, cAMP dependent regulatory, type I, beta(mapped)	Prkar1b	protein kinase, cAMP dependent regulatory, type I, beta	Symbol set to symbol_mapped, name set to name (mapped)	1582166	APPROVED
2006-03-07	RGD1563094_predicted	similar to cAMP-dependent protein kinase type I-beta regulatory subunit (predicted)	LOC360774	similar to cAMP-dependent protein kinase type I-beta regulatory subunit	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC360774	similar to cAMP-dependent protein kinase type I-beta regulatory subunit			Symbol and Name status set to provisional	70820	PROVISIONAL
2003-04-09	Prkar1b	protein kinase, cAMP dependent regulatory, type I, beta		protein kinase, cAMP dependent regulatory, type 1 beta	Name updated	629478	APPROVED
2001-10-24	Prkar1b	protein kinase, cAMP dependent regulatory, type 1 beta			Name updated to reflect Human and Mouse nomenclature	68913	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Mammalian Phenotype