Advanced Search (OLGA)

Gene: Eif2b3 (eukaryotic translation initiation factor 2B subunit gamma) Rattus norvegicus

Analyze

Symbol:

Eif2b3

Name:

eukaryotic translation initiation factor 2B subunit gamma

RGD ID:

620821

Description:

Contributes to guanyl-nucleotide exchange factor activity. Involved in several processes, including hippocampus development; response to glucose; and response to heat. Part of eukaryotic translation initiation factor 2B complex. Human ortholog(s) of this gene implicated in leukoencephalopathy with vanishing white matter 3. Orthologous to human EIF2B3 (eukaryotic translation initiation factor 2B subunit gamma); PARTICIPATES IN translation initiation pathway; RNA transport pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

eIF-2B GDP-GTP exchange factor subunit gamma; eIF2B GDP-GTP exchange factor subunit gamma; eukaryotic translation initiation factor 2B, subunit 3; eukaryotic translation initiation factor 2B, subunit 3 (gamma, 58kD); eukaryotic translation initiation factor 2B, subunit 3 gamma; translation initiation factor eIF-2B subunit gamma; translation initiation factor eIF2B subunit gamma

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	135,728,764 - 135,795,276 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	135,728,959 - 135,799,914 (+)	Ensembl				GRCr8
mRatBN7.2	5	130,492,167 - 130,558,692 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	130,492,220 - 130,563,332 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	133,123,091 - 133,188,111 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	134,877,699 - 134,942,722 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	134,900,110 - 134,965,133 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	135,882,946 - 135,949,276 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	135,882,967 - 135,949,818 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	139,677,822 - 139,744,383 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	137,323,754 - 137,398,327 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	129,018,586 - 129,084,980 (+)	NCBI		Celera
RGSC_v3.1	5	137,328,979 - 137,403,552 (+)	NCBI
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Leukoencephalopathies (ISO)

leukoencephalopathy with vanishing white matter (ISO)

leukoencephalopathy with vanishing white matter 1 (ISO)

leukoencephalopathy with vanishing white matter 3 (ISO)

leukoencephalopathy with vanishing white matter 5 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

4-amino-2,6-dinitrotoluene (EXP)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP,ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

beta-hexachlorocyclohexane (ISO)

beta-naphthoflavone (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

cyclosporin A (ISO)

dicrotophos (ISO)

diethylstilbestrol (ISO)

dioxygen (ISO)

endosulfan (EXP)

enzyme inhibitor (ISO)

ethanol (ISO)

fenthion (ISO)

flutamide (EXP)

formaldehyde (ISO)

gamma-hexachlorocyclohexane (EXP)

gentamycin (EXP)

inulin (ISO)

isotretinoin (ISO)

ivermectin (ISO)

methapyrilene (ISO)

methidathion (ISO)

methimazole (EXP)

microcystin RR (ISO)

N-methyl-4-phenylpyridinium (EXP)

paracetamol (EXP)

paraquat (EXP)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (EXP,ISO)

phorone (EXP)

pirinixic acid (EXP,ISO)

pregnenolone 16alpha-carbonitrile (EXP)

resveratrol (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sunitinib (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

central nervous system development (IEA)

cytoplasmic translational initiation (IBA,ISO,ISS)

hippocampus development (IEP)

oligodendrocyte development (ISO,ISS)

positive regulation of translational initiation (ISO)

response to glucose (IDA)

response to heat (IDA)

response to peptide hormone (IDA)

T cell receptor signaling pathway (ISO,ISS)

translation (IEA,TAS)

translational initiation (IEA,ISO,ISS)

Cellular Component

cytoplasm (IEA,ISO,ISS)

cytosol (IEA,ISO)

eukaryotic translation initiation factor 2B complex (IBA,IDA,IEA,ISO,ISS)

Molecular Function

guanyl-nucleotide exchange factor activity (IBA,IDA,IEA,ISO,ISS)

protein binding (ISO)

translation factor activity, RNA binding (ISO,ISS)

translation initiation factor activity (IBA,IEA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

RNA transport pathway (IEA)

translation initiation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Identification of domains within the epsilon-subunit of the translation initiation factor eIF2B that are necessary for guanine nucleotide exchange activity and eIF2B holoprotein formation.	Anthony TG, etal., Biochim Biophys Acta. 2000 Jun 21;1492(1):56-62.
2.	Subunit assembly and guanine nucleotide exchange activity of eukaryotic initiation factor-2B expressed in Sf9 cells.	Fabian JR, etal., J Biol Chem. 1997 May 9;272(19):12359-65.
3.	Reconstitution and purification of eukaryotic initiation factor 2B (eIF2B) expressed in Sf21 insect cells.	Fabian JR, etal., Protein Expr Purif. 1998 Jun;13(1):16-22.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Glucose stimulates the activity of the guanine nucleotide-exchange factor eIF-2B in isolated rat islets of Langerhans.	Gilligan M, etal., J Biol Chem. 1996 Jan 26;271(4):2121-5.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	The mechanism of eukaryotic translation initiation: new insights and challenges.	Hinnebusch AG and Lorsch JR, Cold Spring Harb Perspect Biol. 2012 Oct 1;4(10). pii: a011544. doi: 10.1101/cshperspect.a011544.
8.	Developmental changes of eukaryotic initiation factor 2B subunits in rat hippocampus.	Inamura N, etal., Neurosci Lett. 2003 Jul 31;346(1-2):117-9.
9.	Regulation of eukaryotic initiation factor-2B activity in muscle of diabetic rats.	Karinch AM, etal., Am J Physiol. 1993 Jan;264(1 Pt 1):E101-8.
10.	Expression, purification, and crystallization of Schizosaccharomyces pombe eIF2B.	Kashiwagi K, etal., J Struct Funct Genomics. 2016 Mar;17(1):33-8. doi: 10.1007/s10969-016-9203-3. Epub 2016 Mar 29.
11.	Regulation of guanine nucleotide exchange through phosphorylation of eukaryotic initiation factor eIF2alpha. Role of the alpha- and delta-subunits of eiF2b.	Kimball SR, etal., J Biol Chem. 1998 May 22;273(21):12841-5.
12.	Possible mechanisms involved in the down-regulation of translation during transient global ischaemia in the rat brain.	Martin de la Vega C, etal., Biochem J. 2001 Aug 1;357(Pt 3):819-26.
13.	Increased activity of eukaryotic initiation factor 2B in PC12 cells in response to differentiation by nerve growth factor.	Munoz F, etal., J Neurochem. 1998 Nov;71(5):1905-11.
14.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
15.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
16.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
17.	Cloning of cDNA for the gamma-subunit of mammalian translation initiation factor 2B, the guanine nucleotide-exchange factor for eukaryotic initiation factor 2.	Price NT, etal., Biochem J 1996 Sep 1;318 ( Pt 2):631-6.
18.	GOA pipeline	RGD automated data pipeline
19.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
20.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
21.	Effect of CCK and intracellular calcium to regulate eIF2B and protein synthesis in rat pancreatic acinar cells.	Sans MD, etal., Am J Physiol Gastrointest Liver Physiol. 2002 Feb;282(2):G267-76.
22.	Inactivation of eIF2B and phosphorylation of PHAS-I in heat-shocked rat hepatoma cells.	Scheper GC, etal., J Biol Chem. 1997 Oct 24;272(43):26850-6.
23.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
24.	Mutations in each of the five subunits of translation initiation factor eIF2B can cause leukoencephalopathy with vanishing white matter.	van der Knaap MS, etal., Ann Neurol 2002 Feb;51(2):264-70.

Additional References at PubMed

PMID:8626696	PMID:10900014	PMID:11323413	PMID:15054402	PMID:15060152	PMID:15217090	PMID:15489334	PMID:16289705	PMID:31505169

Genomics

Comparative Map Data

Eif2b3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	135,728,764 - 135,795,276 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	135,728,959 - 135,799,914 (+)	Ensembl				GRCr8
mRatBN7.2	5	130,492,167 - 130,558,692 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	130,492,220 - 130,563,332 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	133,123,091 - 133,188,111 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	134,877,699 - 134,942,722 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	134,900,110 - 134,965,133 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	135,882,946 - 135,949,276 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	135,882,967 - 135,949,818 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	139,677,822 - 139,744,383 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	137,323,754 - 137,398,327 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	129,018,586 - 129,084,980 (+)	NCBI		Celera
RGSC_v3.1	5	137,328,979 - 137,403,552 (+)	NCBI
Cytogenetic Map	5	q36	NCBI

EIF2B3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	44,850,522 - 44,986,595 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	44,850,522 - 44,986,722 (-)	Ensembl			hg38	GRCh38
GRCh37	1	45,316,194 - 45,452,267 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	45,089,037 - 45,224,869 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	44,985,606 - 45,121,349	NCBI
Celera	1	43,598,935 - 43,735,148 (-)	NCBI		Celera
Cytogenetic Map	1	p34.1	NCBI
HuRef	1	43,428,607 - 43,564,682 (-)	NCBI		HuRef
CHM1_1	1	45,432,292 - 45,568,970 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	44,721,756 - 44,858,197 (-)	NCBI		T2T-CHM13v2.0

Eif2b3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	116,876,559 - 116,944,049 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	116,876,599 - 116,944,503 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	117,019,399 - 117,086,852 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	117,019,402 - 117,087,306 (+)	Ensembl			mm10	GRCm38
MGSCv37	4	116,692,013 - 116,759,457 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	116,517,334 - 116,585,238 (+)	NCBI		MGSCv36	mm8
Celera	4	115,754,605 - 115,822,241 (+)	NCBI		Celera
Cytogenetic Map	4	D1	NCBI
cM Map	4	53.41	NCBI

Eif2b3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955464	13,254,228 - 13,378,832 (+)	Ensembl
ChiLan1.0	NW_004955464	13,254,228 - 13,378,832 (+)	NCBI	ChiLan1.0	ChiLan1.0

EIF2B3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	181,821,005 - 181,956,859 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	180,962,564 - 181,098,380 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	44,154,600 - 44,290,407 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	45,520,587 - 45,655,424 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	45,525,137 - 45,650,259 (-)	Ensembl			panPan2	panpan1.1

EIF2B3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	15,337,421 - 15,481,427 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	15,337,483 - 15,481,425 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	15,458,142 - 15,601,622 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	15,492,735 - 15,636,800 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	15,492,756 - 15,636,794 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	15,289,691 - 15,433,641 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	15,357,619 - 15,501,550 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	15,429,796 - 15,574,243 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Eif2b3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	60,250,716 - 60,362,626 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	26,075,204 - 26,187,459 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	26,075,503 - 26,187,459 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

EIF2B3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	166,353,934 - 166,494,698 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	166,353,918 - 166,487,581 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	153,765,212 - 153,900,676 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

EIF2B3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	87,800,695 - 87,945,574 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	87,800,670 - 87,945,569 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666033	28,995,636 - 29,143,641 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Eif2b3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624906	733,146 - 892,362 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624906	733,148 - 882,690 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Eif2b3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	40,647,828 - 40,711,199 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Eif2b3
224 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	29
Count of miRNA genes:	28
Interacting mature miRNAs:	29
Transcripts:	ENSRNOT00000024841
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	102105698	152749382	Rat
2303586	Gluco52	Glucose level QTL 52	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	100826632	145826632	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	130249266	172190305	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	44924861	153890773	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	116702075	161702075	Rat
1354583	Despr3	Despair related QTL3	4.98	0.0002	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	5	132930505	172190305	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	38207390	136631402	Rat
1300122	Wbc1	White blood cell count QTL 1	2.75		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	5	130678987	145274255	Rat
7365049	Bp359	Blood pressure QTL 359			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	133308734	140009902	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	99905133	172190305	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	134369218	156289444	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	133789363	172190305	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	92583776	137583776	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	134369199	172190305	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	112142946	157142946	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	112142946	157142946	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	110770739	155770739	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	133081618	172190305	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	112142946	157142946	Rat
1581505	Rf54	Renal function QTL 54			kidney physiology trait (VT:0002136)	kidney 20-HETE level (CMO:0001854)	5	133270647	172190305	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	92583776	137583776	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	133789363	172190305	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	98972960	143972960	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	125969677	172190305	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	92583776	137583776	Rat
2303618	Vencon1	Ventilatory control QTL 1	3.8		respiration trait (VT:0001943)	oxygen consumption (CMO:0002169)	5	100826632	145826632	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	111236572	156236572	Rat
7394710	Emca12	Estrogen-induced mammary cancer QTL 12			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	94034903	139034903	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	131708216	172190305	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	114131300	159131300	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	125969677	156302135	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	60601597	137492949	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	112142946	157142946	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	116702075	161702075	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	112142946	157142946	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	116702075	161702075	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	36460764	136631402	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	74335621	156302135	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	116702075	161702075	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	70969494	136328156	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	114131300	159131300	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	133081618	172190305	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	92881678	137881678	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	104262817	153890625	Rat

Markers in Region

D5Got52

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	130,517,403 - 130,517,585 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	135,908,126 - 135,908,305	NCBI	Rnor6.0
Rnor_5.0	5	139,702,964 - 139,703,143	UniSTS	Rnor5.0
RGSC_v3.4	5	137,349,459 - 137,349,639	RGD	RGSC3.4
RGSC_v3.4	5	137,349,460 - 137,349,639	UniSTS	RGSC3.4
Celera	5	129,043,883 - 129,044,062	UniSTS
RGSC_v3.1	5	137,354,686 - 137,354,865	RGD
RH 3.4 Map	5	826.4	RGD
RH 3.4 Map	5	826.4	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_133609	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006238630	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109223	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063287117	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC119459	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC072507	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U38253	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024841 ⟹ ENSRNOP00000024841

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	135,731,881 - 135,795,853 (+)	Ensembl
mRatBN7.2 Ensembl	5	130,492,220 - 130,559,277 (+)	Ensembl
Rnor_6.0 Ensembl	5	135,882,967 - 135,949,818 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094985 ⟹ ENSRNOP00000077189

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	135,728,959 - 135,799,844 (+)	Ensembl
mRatBN7.2 Ensembl	5	130,492,220 - 130,563,262 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000097401 ⟹ ENSRNOP00000088850

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	135,731,881 - 135,799,914 (+)	Ensembl
mRatBN7.2 Ensembl	5	130,492,265 - 130,563,332 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104975 ⟹ ENSRNOP00000078081

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	135,728,959 - 135,790,710 (+)	Ensembl
mRatBN7.2 Ensembl	5	130,492,220 - 130,554,126 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000109617 ⟹ ENSRNOP00000095520

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	135,728,959 - 135,795,275 (+)	Ensembl
mRatBN7.2 Ensembl	5	130,495,306 - 130,559,277 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111764 ⟹ ENSRNOP00000078465

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	135,728,959 - 135,799,914 (+)	Ensembl
mRatBN7.2 Ensembl	5	130,492,369 - 130,559,277 (+)	Ensembl

RefSeq Acc Id:

NM_133609 ⟹ NP_598293

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	135,728,842 - 135,795,276 (+)	NCBI
mRatBN7.2	5	130,492,245 - 130,558,692 (+)	NCBI
Rnor_6.0	5	135,882,978 - 135,949,276 (+)	NCBI
Rnor_5.0	5	139,677,822 - 139,744,383 (+)	NCBI
RGSC_v3.4	5	137,323,754 - 137,398,327 (+)	RGD
Celera	5	129,018,586 - 129,084,980 (+)	RGD

Sequence:

show sequence

CAGCGTGGGGAGCGCTGGGAGCGGCTACGGCGTGCGGGGAGCTGAGGTAAAGCCGGGGCTAGTA
CGGTACCAGGCGGTGCACGAGCTGGCTAAGCAAGATTTGTAAAAATGGAGTTTCAAGCCGTAGT
TATGGCCGTCGGTGGGGGATCTCGGATGACAGACTTGACTTCCAGCATTCCCAAGCCTCTGCTT
CCAGTTGGAAACAAACCTTTAATTTGGTACCCGCTGAACCTGCTTGAGCGAGTTGGATTTGAAG
AAGTCATCGTGGTTACAACCAAAGATGTCCAAAAGGCTCTGTGTGCAGAGTTCAAGATGAAATT
GAAGCCAGATATTGTGTGCATTCCTGATGAGGCAGACATGGGGACTGCAGATTCTCTACGCCAC
ATATATCCAAAACTTAAGACTGATGTGCTGGTCCTGGGCTGCGATCTGATAACAGATGTTGCCT
TACACGAGGTTGTGGACCTGTTCAGAGCTTACGATGCATCACTTGCCATGTTAATGAGGAAAGG
ACAAGAGAGCACAGAACCAGTTCCAGGTCAGAAGGGGAAAAAAAAAACAGTGGAGCAGCGTGAC
TTCATTGGAGTGGACAGCACAGGAAAAAGGCTGCTCTTTATGGCTAATGAAGCAGACTTGGATG
AAGAGCTGGTCATTAAGGGATCCATCCTGCAGAAGCACCCTAGGATACATTTCCAGACAGGCCT
TGTGGATGCTCATCTCTACTGCTTGAAGAAATATGTTGTGGATTTCTTAATGGAAAATAAGTCA
ATCACTTCTATCCGAAGCGAACTGATTCCATACCTAGTAAGAAAACAGTTTTCCTCAGCCTCCT
CACAGCAAAGGCAGGAAGACAAAGAAGAGGATCTAAAGAAAAAGGAGCCCAAGTCTTTAGATAT
TTACAGTTTTATAAAAAAAGACAACACTCTGACTTTGGCTCCCTATGATGCCTGCTGGAATGCT
TTTCGAAGAGACAAGTGGGAAGATTTGTCTAGATCACAGGTTCGCTGCTATGTCCACATCATGA
AGGAAGGACTTTGCTCTCGAGTAAGCACACTGGGACTCTACATGGAAGCCAACAGACAGGTACC
CAAATTGCTGTCTGTTCTTTGTCCTGAGGAATCAATGATCCATCCATCAGCCCAGATTGCCAAC
AAACACCTGATTGGAGCCGACAGCCTTATCGGGTCAGATACACAAGTTGGAGAGAAGTCATCTA
TTAAACGATCTGTCATTGGCTCATCCTGTGTCATCAGAGACAGAGTAACTGTTACCAACTGCCT
TCTCATGAACTCTGTCACCGTGGAAGAAGGGAGCAGCATCCATGGCAGCGTCATCTGCAACAAC
GCCGTGGTCGAGGCGGGCGCGGAGATCAGGGACTGTTTAATTGGAAGTGGTCAGAGGATTGAAG
CCAAAGCTAAACGCATGAACGAGGTGATCGTGGGAAATGACCAGCTCATGGAGATCTGAATCCT
GAACAAGTCTGACCCCTTCCTTTTGGCCCCAAAACTACAGATGTTGGCTGGCCCACCTGTTTGA
CTCTGTATTTATTTTTCAATAAAGAAGAATTTCCAGGCTGTAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006238630 ⟹ XP_006238692

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	135,728,764 - 135,795,276 (+)	NCBI
mRatBN7.2	5	130,492,167 - 130,558,692 (+)	NCBI
Rnor_6.0	5	135,882,946 - 135,949,276 (+)	NCBI
Rnor_5.0	5	139,677,822 - 139,744,383 (+)	NCBI

Sequence:

show sequence

CGCGCCTGCGCCTTTGGCTTGTCAGCCGGAGGCAGCGTGGGGAGCGCTGGGAGCGGCTACGGCG
TGCGGGGAGCTGAGATTTGTAAAAATGGAGTTTCAAGCCGTAGTTATGGCCGTCGGTGGGGGAT
CTCGGATGACAGACTTGACTTCCAGCATTCCCAAGCCTCTGCTTCCAGTTGGAAACAAACCTTT
AATTTGGTACCCGCTGAACCTGCTTGAGCGAGTTGGATTTGAAGAAGTCATCGTGGTTACAACC
AAAGATGTCCAAAAGGCTCTGTGTGCAGAGTTCAAGATGAAATTGAAGCCAGATATTGTGTGCA
TTCCTGATGAGGCAGACATGGGGACTGCAGATTCTCTACGCCACATATATCCAAAACTTAAGAC
TGATGTGCTGGTCCTGGGCTGCGATCTGATAACAGATGTTGCCTTACACGAGGTTGTGGACCTG
TTCAGAGCTTACGATGCATCACTTGCCATGTTAATGAGGAAAGGACAAGAGAGCACAGAACCAG
TTCCAGGTCAGAAGGGGAAAAAAAAAACAGTGGAGCAGCGTGACTTCATTGGAGTGGACAGCAC
AGGAAAAAGGCTGCTCTTTATGGCTAATGAAGCAGACTTGGATGAAGAGCTGGTCATTAAGGGA
TCCATCCTGCAGAAGCACCCTAGGATACATTTCCAGACAGGCCTTGTGGATGCTCATCTCTACT
GCTTGAAGAAATATGTTGTGGATTTCTTAATGGAAAATAAGTCAATCACTTCTATCCGAAGCGA
ACTGATTCCATACCTAGTAAGAAAACAGTTTTCCTCAGCCTCCTCACAGCAAAGGCAGGAAGAC
AAAGAAGAGGATCTAAAGAAAAAGGAGCCCAAGTCTTTAGATATTTACAGTTTTATAAAAAAAG
ACAACACTCTGACTTTGGCTCCCTATGATGCCTGCTGGAATGCTTTTCGAAGAGACAAGTGGGA
AGATTTGTCTAGATCACAGGTTCGCTGCTATGTCCACATCATGAAGGAAGGACTTTGCTCTCGA
GTAAGCACACTGGGACTCTACATGGAAGCCAACAGACAGGTACCCAAATTGCTGTCTGTTCTTT
GTCCTGAGGAATCAATGATCCATCCATCAGCCCAGATTGCCAACAAACACCTGATTGGAGCCGA
CAGCCTTATCGGGTCAGATACACAAGTTGGAGAGAAGTCATCTATTAAACGATCTGTCATTGGC
TCATCCTGTGTCATCAGAGACAGAGTAACTGTTACCAACTGCCTTCTCATGAACTCTGTCACCG
TGGAAGAAGGGAGCAGCATCCATGGCAGCGTCATCTGCAACAACGCCGTGGTCGAGGCGGGCGC
GGAGATCAGGGACTGTTTAATTGGAAGTGGTCAGAGGATTGAAGCCAAAGCTAAACGCATGAAC
GAGGTGATCGTGGGAAATGACCAGCTCATGGAGATCTGAATCCTGAACAAGTCTGACCCCTTCC
TTTTGGCCCCAAAACTACAGATGTTGGCTGGCCCACCTGTTTGACTCTGTATTTATTTTTCAAT
AAAGAAGAATTTCCAGGCTGTA

hide sequence

RefSeq Acc Id:

XM_039109223 ⟹ XP_038965151

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	135,754,637 - 135,795,276 (+)	NCBI
mRatBN7.2	5	130,518,073 - 130,558,692 (+)	NCBI

RefSeq Acc Id:

XM_063287117 ⟹ XP_063143187

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	135,728,924 - 135,795,276 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_598293	(Get FASTA)	NCBI Sequence Viewer
	XP_006238692	(Get FASTA)	NCBI Sequence Viewer
	XP_038965151	(Get FASTA)	NCBI Sequence Viewer
	XP_063143187	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC52788	(Get FASTA)	NCBI Sequence Viewer
	AAH72507	(Get FASTA)	NCBI Sequence Viewer
	EDL90236	(Get FASTA)	NCBI Sequence Viewer
	EDL90237	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024841
	ENSRNOP00000088850.1
	ENSRNOP00000095520
GenBank Protein	P70541	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_598293 ⟸ NM_133609

- UniProtKB:

Q6IN08 (UniProtKB/Swiss-Prot), P70541 (UniProtKB/Swiss-Prot), A6JZB6 (UniProtKB/TrEMBL), A0A8I6APB6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTKDVQKALC
AEFKMKLKPDIVCIPDEADMGTADSLRHIYPKLKTDVLVLGCDLITDVALHEVVDLFRAYDASL
AMLMRKGQESTEPVPGQKGKKKTVEQRDFIGVDSTGKRLLFMANEADLDEELVIKGSILQKHPR
IHFQTGLVDAHLYCLKKYVVDFLMENKSITSIRSELIPYLVRKQFSSASSQQRQEDKEEDLKKK
EPKSLDIYSFIKKDNTLTLAPYDACWNAFRRDKWEDLSRSQVRCYVHIMKEGLCSRVSTLGLYM
EANRQVPKLLSVLCPEESMIHPSAQIANKHLIGADSLIGSDTQVGEKSSIKRSVIGSSCVIRDR
VTVTNCLLMNSVTVEEGSSIHGSVICNNAVVEAGAEIRDCLIGSGQRIEAKAKRMNEVIVGNDQ
LMEI

hide sequence

RefSeq Acc Id:	XP_006238692 ⟸ XM_006238630
- Peptide Label:	isoform X2
- UniProtKB:	Q6IN08 (UniProtKB/Swiss-Prot), P70541 (UniProtKB/Swiss-Prot), A6JZB6 (UniProtKB/TrEMBL), A0A8I6APB6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTKDVQKALC AEFKMKLKPDIVCIPDEADMGTADSLRHIYPKLKTDVLVLGCDLITDVALHEVVDLFRAYDASL AMLMRKGQESTEPVPGQKGKKKTVEQRDFIGVDSTGKRLLFMANEADLDEELVIKGSILQKHPR IHFQTGLVDAHLYCLKKYVVDFLMENKSITSIRSELIPYLVRKQFSSASSQQRQEDKEEDLKKK EPKSLDIYSFIKKDNTLTLAPYDACWNAFRRDKWEDLSRSQVRCYVHIMKEGLCSRVSTLGLYM EANRQVPKLLSVLCPEESMIHPSAQIANKHLIGADSLIGSDTQVGEKSSIKRSVIGSSCVIRDR VTVTNCLLMNSVTVEEGSSIHGSVICNNAVVEAGAEIRDCLIGSGQRIEAKAKRMNEVIVGNDQ LMEI hide sequence

Ensembl Acc Id:

ENSRNOP00000024841 ⟸ ENSRNOT00000024841

RefSeq Acc Id:	XP_038965151 ⟸ XM_039109223
- Peptide Label:	isoform X3

Ensembl Acc Id:

ENSRNOP00000088850 ⟸ ENSRNOT00000097401

Ensembl Acc Id:

ENSRNOP00000078081 ⟸ ENSRNOT00000104975

Ensembl Acc Id:

ENSRNOP00000095520 ⟸ ENSRNOT00000109617

Ensembl Acc Id:

ENSRNOP00000077189 ⟸ ENSRNOT00000094985

Ensembl Acc Id:

ENSRNOP00000078465 ⟸ ENSRNOT00000111764

RefSeq Acc Id:	XP_063143187 ⟸ XM_063287117
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6APB6 (UniProtKB/TrEMBL), A0A8I5ZKY2 (UniProtKB/TrEMBL)

Protein Domains

Nucleotidyl transferase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P70541-F1-model_v2	AlphaFold	P70541	1-452	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693946

Promoter ID:

EPDNEW_R4471

Type:

initiation region

Name:

Eif2b3_1

Description:

eukaryotic translation initiation factor 2B subunit gamma

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	135,882,966 - 135,883,026	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620821	AgrOrtholog
BioCyc Gene	G2FUF-40221	BioCyc
Ensembl Genes	ENSRNOG00000018375	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000024841	ENTREZGENE
	ENSRNOT00000097401.1	UniProtKB/Swiss-Prot
	ENSRNOT00000109617	ENTREZGENE
Gene3D-CATH	Hexapeptide repeat proteins	UniProtKB/Swiss-Prot
	Spore Coat Polysaccharide Biosynthesis Protein SpsA, Chain A	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7099973	IMAGE-MGC_LOAD
InterPro	eIF2B_gamma	UniProtKB/Swiss-Prot
	NTP_transferase_dom	UniProtKB/Swiss-Prot
	Nucleotide-diphossugar_trans	UniProtKB/Swiss-Prot
KEGG Report	rno:171145	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:91499	IMAGE-MGC_LOAD
NCBI Gene	171145	ENTREZGENE
PANTHER	TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT GAMMA	UniProtKB/Swiss-Prot
	TRANSLATION INITIATION FACTOR EIF-2B SUBUNIT GAMMA	UniProtKB/Swiss-Prot
Pfam	LbH_EIF2B	UniProtKB/Swiss-Prot
	NTP_transferase	UniProtKB/Swiss-Prot
PhenoGen	Eif2b3	PhenoGen
RatGTEx	ENSRNOG00000018375	RatGTEx
Superfamily-SCOP	SSF53448	UniProtKB/Swiss-Prot
UniProt	A0A8I5Y606_RAT	UniProtKB/TrEMBL
	A0A8I5Y9W9_RAT	UniProtKB/TrEMBL
	A0A8I5ZKY2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6APB6	ENTREZGENE
	A0A8L2QD14_RAT	UniProtKB/TrEMBL
	A6JZB6	ENTREZGENE, UniProtKB/TrEMBL
	EI2BG_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q6IN08	ENTREZGENE
UniProt Secondary	Q6IN08	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-07	Eif2b3	eukaryotic translation initiation factor 2B subunit gamma	Eif2b3	eukaryotic translation initiation factor 2B, subunit 3 gamma	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-03-31	Eif2b3	eukaryotic translation initiation factor 2B, subunit 3 gamma	Eif2b3	eukaryotic translation initiation factor 2B, subunit 3	Name changed	629549	APPROVED
2011-04-29	Eif2b3	eukaryotic translation initiation factor 2B, subunit 3	Eif2b3	eukaryotic translation initiation factor 2B, subunit 3 gamma	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-25	Eif2b3	eukaryotic translation initiation factor 2B, subunit 3 gamma	Eif2b3	eukaryotic translation initiation factor 2B, subunit 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-25	Eif2b3	eukaryotic translation initiation factor 2B, subunit 3	Eif2b3	eukaryotic translation initiation factor 2B, subunit 3 gamma	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	Eif2b3	eukaryotic translation initiation factor 2B, subunit 3 gamma		eukaryotic translation initiation factor 2B, subunit 3 (gamma, 58kD)	Name updated	1299863	APPROVED
2002-08-07	Eif2b3	eukaryotic translation initiation factor 2B, subunit 3 (gamma, 58kD)			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains P-loop region (nucleotide-binding)and I-patch region (isoleucine hexamer repeat domain)	728627
gene_homology	shares 19% sequence identity with yeast eIF2B-gamma	728627

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - KEGG (archival)