Advanced Search (OLGA)

Gene: Hcar2 (hydroxycarboxylic acid receptor 2) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Hcar2

Name:

hydroxycarboxylic acid receptor 2

RGD ID:

727952

Description:

Enables nicotinic acid receptor activity. Involved in negative regulation of lipid catabolic process and positive regulation of adiponectin secretion. Predicted to be located in cell junction. Predicted to be active in plasma membrane. Orthologous to several human genes including HCAR2 (hydroxycarboxylic acid receptor 2); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

G protein-coupled receptor 109A; G protein-coupled receptor 109B; G protein-coupled receptor Hm74b; G-protein coupled receptor 109; G-protein coupled receptor 109A; G-protein coupled receptor HM74; Gpr109a; Gpr109b; Hm74; HM74b; interferon-gamma inducible gene, Puma-g; niacin receptor 1; Niacr1; nicotinic acid receptor; protein PUMA-G; Pumag; rHM74b

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	38,387,163 - 38,389,149 (+)	NCBI		GRCr8
mRatBN7.2	12	32,726,252 - 32,728,238 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	32,726,184 - 32,728,504 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	33,904,918 - 33,906,000 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	34,516,272 - 34,517,354 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	33,568,158 - 33,569,240 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	38,160,464 - 38,161,546 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	38,160,464 - 38,161,546 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	40,029,980 - 40,031,062 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	33,863,876 - 33,864,958 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	33,727,263 - 33,728,346 (+)	NCBI
Celera	12	34,412,699 - 34,413,781 (+)	NCBI		Celera
Cytogenetic Map	12	q15	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Hcar2	Rat	short chain acyl-CoA dehydrogenase deficiency		ISO	HCAR2 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Deficiency of butyryl-CoA dehydrogenase	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Hcar2	Rat	Flushing		ISO	HCAR2 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:16322797
Hcar2	Rat	psoriasis		ISO	HCAR2 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:18722346
Hcar2	Rat	schizophrenia		ISO	HCAR2 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:18639743
Hcar2	Rat	Skin Neoplasms		ISO	HCAR2 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:21655214
Hcar2	Rat	squamous cell carcinoma		ISO	HCAR2 (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:21655214

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Hcar2	Rat	(+)-schisandrin B	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of HCAR2 mRNA]	CTD	PMID:31150632
Hcar2	Rat	(-)-alpha-phellandrene	increases expression	ISO	HCAR2 (Homo sapiens)	6480464	alpha phellandrene results in increased expression of HCAR2 mRNA	CTD	PMID:25075043
Hcar2	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in decreased expression of HCAR2 mRNA	CTD	PMID:26496021
Hcar2	Rat	17beta-estradiol	decreases expression	ISO	HCAR2 (Homo sapiens)	6480464	Estradiol results in decreased expression of HCAR2 mRNA	CTD	PMID:31614463 and PMID:36828454
Hcar2	Rat	17beta-estradiol	multiple interactions	ISO	HCAR2 (Homo sapiens)	6480464	[Estradiol co-treated with TGFB1 protein] results in decreased expression of HCAR2 mRNA	CTD	PMID:30165855
Hcar2	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of HCAR2 mRNA	CTD	PMID:33387578
Hcar2	Rat	2-hydroxypropanoic acid	decreases expression	ISO	HCAR2 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of HCAR2 mRNA	CTD	PMID:30851411
Hcar2	Rat	3',5'-cyclic AMP	multiple interactions	ISO	HCAR2 (Homo sapiens)	6480464	[3-Hydroxybutyric Acid results in increased activity of HCAR2 protein] inhibits the reaction [Colforsin results in increased abundance of Cyclic AMP] more ...	CTD	PMID:17124637 and PMID:19223991
Hcar2	Rat	3',5'-cyclic AMP	decreases abundance	ISO	HCAR2 (Homo sapiens)	6480464	HCAR2 protein results in decreased abundance of Cyclic AMP	CTD	PMID:20655299
Hcar2	Rat	3-hydroxybutyric acid	increases activity	ISO	HCAR2 (Homo sapiens)	6480464	3-Hydroxybutyric Acid results in increased activity of HCAR2 protein	CTD	PMID:19223991
Hcar2	Rat	3-hydroxybutyric acid	multiple interactions	ISO	HCAR2 (Homo sapiens)	6480464	3-Hydroxybutyric Acid binds to and results in increased activity of HCAR2 protein and [3-Hydroxybutyric Acid results in increased activity of HCAR2 protein] inhibits the reaction [Colforsin results in increased abundance of Cyclic AMP]	CTD	PMID:15929991 and PMID:19223991
Hcar2	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	HCAR2 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of HCAR2 mRNA	CTD	PMID:28628672
Hcar2	Rat	3-phenylpropionic acid	multiple interactions	ISO	HCAR2 (Homo sapiens)	6480464	3-phenylpropionic acid binds to and results in increased activity of HCAR2 protein	CTD	PMID:31378678
Hcar2	Rat	acrylamide	decreases expression	EXP		6480464	Acrylamide results in decreased expression of HCAR2 mRNA	CTD	PMID:28959563
Hcar2	Rat	aflatoxin B1	increases methylation	ISO	HCAR2 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of HCAR2 gene	CTD	PMID:27153756
Hcar2	Rat	all-trans-retinoic acid	increases expression	ISO	HCAR2 (Homo sapiens)	6480464	Tretinoin results in increased expression of HCAR2 mRNA	CTD	PMID:33167477
Hcar2	Rat	alpha-phellandrene	increases expression	ISO	HCAR2 (Homo sapiens)	6480464	alpha phellandrene results in increased expression of HCAR2 mRNA	CTD	PMID:25075043
Hcar2	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in increased expression of HCAR2 mRNA	CTD	PMID:35163327
Hcar2	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of HCAR2 mRNA	CTD	PMID:16483693
Hcar2	Rat	aristolochic acid A	increases expression	ISO	HCAR2 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of HCAR2 mRNA	CTD	PMID:33212167
Hcar2	Rat	benzo[a]pyrene	increases mutagenesis	ISO	HCAR2 (Homo sapiens)	6480464	Benzo(a)pyrene results in increased mutagenesis of HCAR2 gene	CTD	PMID:25435355
Hcar2	Rat	benzo[a]pyrene	decreases methylation	ISO	HCAR2 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of HCAR2 exon	CTD	PMID:27901495
Hcar2	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of HCAR2 mRNA	CTD	PMID:25181051
Hcar2	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in decreased expression of HCAR2 mRNA	CTD	PMID:26496021
Hcar2	Rat	bisphenol F	multiple interactions	ISO	HCAR2 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of HCAR2 mRNA	CTD	PMID:28628672
Hcar2	Rat	cadmium atom	multiple interactions	ISO	HCAR2 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of HCAR2 mRNA	CTD	PMID:35301059
Hcar2	Rat	cadmium dichloride	multiple interactions	ISO	HCAR2 (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of HCAR2 mRNA	CTD	PMID:35301059
Hcar2	Rat	cholesterol	multiple interactions	ISO	HCAR2 (Homo sapiens)	6480464	[HCAR2 protein results in decreased expression of ABCA1 protein] which results in decreased export of Cholesterol	CTD	PMID:20655299
Hcar2	Rat	cisplatin	increases expression	ISO	HCAR2 (Homo sapiens)	6480464	Cisplatin results in increased expression of HCAR2 mRNA	CTD	PMID:27392435
Hcar2	Rat	citraconic acid	multiple interactions	ISO	HCAR2 (Homo sapiens)	6480464	citraconic acid binds to and results in increased activity of HCAR2 protein	CTD	PMID:18722346
Hcar2	Rat	colforsin daropate hydrochloride	multiple interactions	ISO	HCAR2 (Homo sapiens)	6480464	[3-Hydroxybutyric Acid results in increased activity of HCAR2 protein] inhibits the reaction [Colforsin results in increased abundance of Cyclic AMP] more ...	CTD	PMID:17124637 and PMID:19223991
Hcar2	Rat	cyclosporin A	increases methylation	ISO	HCAR2 (Homo sapiens)	6480464	Cyclosporine results in increased methylation of HCAR2 promoter	CTD	PMID:27989131
Hcar2	Rat	dexamethasone	decreases expression	EXP		6480464	Dexamethasone results in decreased expression of HCAR2 mRNA	CTD	PMID:27478807
Hcar2	Rat	dexamethasone	multiple interactions	ISO	HCAR2 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of HCAR2 mRNA	CTD	PMID:28628672
Hcar2	Rat	Dibutyl phosphate	affects expression	ISO	HCAR2 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of HCAR2 mRNA	CTD	PMID:37042841
Hcar2	Rat	dioxygen	multiple interactions	EXP		6480464	[Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of HCAR2 mRNA	CTD	PMID:33729688
Hcar2	Rat	emodin	multiple interactions	ISO	HCAR2 (Homo sapiens)	6480464	Emodin inhibits the reaction [Niacin results in increased activity of HCAR2 protein]	CTD	PMID:30155694
Hcar2	Rat	folic acid	decreases expression	ISO	HCAR2 (Homo sapiens)	6480464	Folic Acid results in decreased expression of HCAR2 mRNA	CTD	PMID:21867686
Hcar2	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of HCAR2 mRNA	CTD	PMID:33387578
Hcar2	Rat	glyphosate	increases methylation	EXP		6480464	Glyphosate results in increased methylation of HCAR2 gene	CTD	PMID:31011160
Hcar2	Rat	gold atom	increases expression	ISO	HCAR2 (Homo sapiens)	6480464	Gold results in increased expression of HCAR2 mRNA	CTD	PMID:29705079
Hcar2	Rat	gold(0)	increases expression	ISO	HCAR2 (Homo sapiens)	6480464	Gold results in increased expression of HCAR2 mRNA	CTD	PMID:29705079
Hcar2	Rat	GSK-J4	increases expression	ISO	HCAR2 (Homo sapiens)	6480464	GSK-J4 results in increased expression of HCAR2 mRNA	CTD	PMID:29301935
Hcar2	Rat	indometacin	multiple interactions	ISO	HCAR2 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of HCAR2 mRNA	CTD	PMID:28628672
Hcar2	Rat	leflunomide	increases expression	ISO	HCAR2 (Homo sapiens)	6480464	leflunomide results in increased expression of HCAR2 mRNA	CTD	PMID:28988120
Hcar2	Rat	lipopolysaccharide	multiple interactions	ISO	HCAR2 (Homo sapiens)	6480464	[S-(1 more ...	CTD	PMID:35811015
Hcar2	Rat	lipopolysaccharide	increases expression	ISO	HCAR2 (Homo sapiens)	6480464	Lipopolysaccharides results in increased expression of HCAR2 mRNA	CTD	PMID:35811015
Hcar2	Rat	Muraglitazar	decreases expression	EXP		6480464	muraglitazar results in decreased expression of HCAR2 mRNA	CTD	PMID:21515302
Hcar2	Rat	nicotinic acid	multiple interactions	ISO	HCAR2 (Homo sapiens)	6480464	[Niacin binds to and results in increased activity of HCAR2 protein] which results in increased phosphorylation of MAPK1 protein more ...	CTD	PMID:16018973 more ...
Hcar2	Rat	nicotinic acid	affects binding	ISO	HCAR2 (Homo sapiens)	6480464	Niacin binds to HCAR2 protein	CTD	PMID:16099840
Hcar2	Rat	nicotinic acid	increases activity	ISO	HCAR2 (Homo sapiens)	6480464	Niacin results in increased activity of HCAR2 protein	CTD	PMID:15929991 more ...
Hcar2	Rat	nicotinic acid	multiple interactions	EXP		6480464	[Niacin analog binds to and results in increased activity of HCAR2 protein] which results in decreased abundance of Fatty Acids more ...	CTD	PMID:17804224 and PMID:19309152
Hcar2	Rat	okadaic acid	increases expression	ISO	HCAR2 (Homo sapiens)	6480464	Okadaic Acid results in increased expression of HCAR2 mRNA	CTD	PMID:38832940
Hcar2	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of HCAR2 mRNA	CTD	PMID:33387578
Hcar2	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in increased expression of HCAR2 mRNA	CTD	PMID:35163327
Hcar2	Rat	perfluorooctanoic acid	increases expression	EXP		6480464	perfluorooctanoic acid results in increased expression of HCAR2 mRNA	CTD	PMID:35163327
Hcar2	Rat	protein kinase inhibitor	multiple interactions	ISO	HCAR2 (Homo sapiens)	6480464	Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in increased expression of HCAR2 mRNA]	CTD	PMID:28003376
Hcar2	Rat	pyrazoles	multiple interactions	ISO	HCAR2 (Homo sapiens)	6480464	Pyrazoles binds to and results in increased activity of HCAR2 protein	CTD	PMID:17588745 and PMID:17804224
Hcar2	Rat	pyrazoles	multiple interactions	EXP		6480464	[Pyrazoles binds to and results in increased activity of HCAR2 protein] which results in decreased abundance of Fatty Acids more ...	CTD	PMID:17804224
Hcar2	Rat	rac-lactic acid	decreases expression	ISO	HCAR2 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of HCAR2 mRNA	CTD	PMID:30851411
Hcar2	Rat	rotenone	increases expression	ISO	HCAR2 (Homo sapiens)	6480464	Rotenone results in increased expression of HCAR2 mRNA	CTD	PMID:29955902
Hcar2	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	HCAR2 (Homo sapiens)	6480464	[S-(1 more ...	CTD	PMID:35811015
Hcar2	Rat	silicon dioxide	increases expression	ISO	HCAR2 (Homo sapiens)	6480464	Silicon Dioxide analog results in increased expression of HCAR2 mRNA	CTD	PMID:25895662
Hcar2	Rat	silicon dioxide	increases expression	EXP		6480464	Silicon Dioxide results in increased expression of HCAR2 mRNA	CTD	PMID:22431001
Hcar2	Rat	sodium arsenite	decreases expression	ISO	HCAR2 (Homo sapiens)	6480464	sodium arsenite results in decreased expression of HCAR2 mRNA	CTD	PMID:28595984
Hcar2	Rat	sodium arsenite	increases expression	ISO	HCAR2 (Homo sapiens)	6480464	sodium arsenite results in increased expression of HCAR2 mRNA	CTD	PMID:34032870
Hcar2	Rat	Tesaglitazar	decreases expression	EXP		6480464	tesaglitazar results in decreased expression of HCAR2 mRNA	CTD	PMID:21515302
Hcar2	Rat	tetrachloromethane	multiple interactions	EXP		6480464	schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of HCAR2 mRNA]	CTD	PMID:31150632
Hcar2	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of HCAR2 mRNA	CTD	PMID:31150632
Hcar2	Rat	tetrazoles	multiple interactions	ISO	HCAR2 (Homo sapiens)	6480464	[Tetrazoles analog binds to and results in increased activity of HCAR2 protein] which results in decreased abundance of Fatty Acids more ...	CTD	PMID:20363624
Hcar2	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of HCAR2 mRNA	CTD	PMID:34492290
Hcar2	Rat	trans-cinnamic acid	affects binding	ISO	HCAR2 (Homo sapiens)	6480464	cinnamic acid binds to HCAR2 protein	CTD	PMID:21167710
Hcar2	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of HCAR2 mRNA	CTD	PMID:33387578
Hcar2	Rat	triphenyl phosphate	affects expression	ISO	HCAR2 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of HCAR2 mRNA	CTD	PMID:37042841
Hcar2	Rat	troglitazone	decreases expression	EXP		6480464	troglitazone results in decreased expression of HCAR2 mRNA	CTD	PMID:21515302
Hcar2	Rat	urethane	decreases expression	ISO	HCAR2 (Homo sapiens)	6480464	Urethane results in decreased expression of HCAR2 mRNA	CTD	PMID:28818685
Hcar2	Rat	UTP	multiple interactions	ISO	HCAR2 (Homo sapiens)	6480464	[Nicotinic Acids results in increased activity of HCAR2 protein] promotes the reaction [[Uridine Triphosphate results in increased phosphorylation of and results in increased activity of MAPK1 protein] which results in increased abundance of Arachidonic Acids] and [Nicotinic Acids results in increased activity of HCAR2 protein] promotes the reaction [[Uridine Triphosphate results in increased phosphorylation of and results in increased activity of MAPK3 protein] which results in increased abundance of Arachidonic Acids]	CTD	PMID:16674924

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Hcar2	Rat	apoptotic process	involved_in	IEA	UniProtKB-KW:KW-0053	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Hcar2	Rat	G protein-coupled receptor signaling pathway	involved_in	IBA	MGI:1933383 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Hcar2	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Hcar2	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	InterPro:IPR000276	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Hcar2	Rat	G protein-coupled receptor signaling pathway	involved_in	IEA	UniProtKB:Q9EP66 and ensembl:ENSMUSP00000054104	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Hcar2	Rat	negative regulation of lipid catabolic process	involved_in	IDA		8553927	PMID:19141678	UniProt
Hcar2	Rat	neutrophil apoptotic process	involved_in	ISO	HCAR2 (Homo sapiens)	1624291	PMID:17932499	RGD	PMID:17932499
Hcar2	Rat	positive regulation of adiponectin secretion	involved_in	IDA		8553927	PMID:19141678	UniProt
Hcar2	Rat	positive regulation of neutrophil apoptotic process	involved_in	ISS	UniProtKB:Q8TDS4	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Hcar2	Rat	positive regulation of neutrophil apoptotic process	involved_in	ISO	HCAR2 (Homo sapiens)	1624291	PMID:17932499	RGD	PMID:17932499
Hcar2	Rat	purinergic nucleotide receptor signaling pathway	involved_in	IEA	GO:0001614	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Hcar2	Rat	signal transduction	involved_in	IEA	UniProtKB-KW:KW-0807	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Hcar2	Rat	cell junction	located_in	ISO	HCAR2 (Homo sapiens)	1624291		RGD	GO_REF:0000052
Hcar2	Rat	membrane	located_in	IEA	InterPro:IPR000276 and InterPro:IPR017452	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Hcar2	Rat	membrane	located_in	IEA	UniProtKB:Q9EP66 and ensembl:ENSMUSP00000054104	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Hcar2	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Hcar2	Rat	plasma membrane	located_in	ISS	UniProtKB:Q8TDS4	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Hcar2	Rat	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Hcar2	Rat	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Hcar2	Rat	plasma membrane	is_active_in	IBA	PANTHER:PTN002917540 and UniProtKB:Q8TDS4	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Hcar2	Rat	plasma membrane	located_in	ISO	HCAR2 (Homo sapiens)	1624291	PMID:17932499	RGD	PMID:17932499

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Hcar2	Rat	G protein-coupled receptor activity	enables	IEA	UniProtKB-KW:KW-0297	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Hcar2	Rat	G protein-coupled receptor activity	enables	IEA	InterPro:IPR000276	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Hcar2	Rat	G protein-coupled receptor activity	enables	IEA	UniProtKB:Q9EP66 and ensembl:ENSMUSP00000054104	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Hcar2	Rat	GTP binding	enables	IEA	UniProtKB:Q9EP66 and ensembl:ENSMUSP00000054104	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Hcar2	Rat	nicotinic acid receptor activity	enables	IDA		8553927	PMID:19141678	UniProt
Hcar2	Rat	nicotinic acid receptor activity	enables	IBA	PANTHER:PTN000660533 and Hcar2 (Rattus norvegicus)	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Hcar2	Rat	purinergic nucleotide receptor activity	enables	IEA	UniProtKB:Q9EP66 and ensembl:ENSMUSP00000054104	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	NCBI rat LocusLink and RefSeq merged data October 15, 2003	NCBI rat LocusLink and RefSeq merged data October 15, 2003
4.	Niacin stimulates adiponectin secretion through the GPR109A receptor.	Plaisance EP, etal., Am J Physiol Endocrinol Metab. 2009 Mar;296(3):E549-58. doi: 10.1152/ajpendo.91004.2008. Epub 2009 Jan 13.
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Molecular identification of nicotinic acid receptor.	Soga T, etal., Biochem Biophys Res Commun 2003 Mar 28;303(1):364-9.

PMID:12522134	PMID:17932499	PMID:19047060	PMID:25622782	PMID:36796675

Hcar2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	38,387,163 - 38,389,149 (+)	NCBI		GRCr8
mRatBN7.2	12	32,726,252 - 32,728,238 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	32,726,184 - 32,728,504 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	33,904,918 - 33,906,000 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	34,516,272 - 34,517,354 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	33,568,158 - 33,569,240 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	38,160,464 - 38,161,546 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	38,160,464 - 38,161,546 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	40,029,980 - 40,031,062 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	33,863,876 - 33,864,958 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	33,727,263 - 33,728,346 (+)	NCBI
Celera	12	34,412,699 - 34,413,781 (+)	NCBI		Celera
Cytogenetic Map	12	q15	NCBI

HCAR2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	122,701,293 - 122,703,357 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	122,701,293 - 122,703,357 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	123,185,840 - 123,187,904 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	121,751,793 - 121,753,857 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	121,710,720 - 121,712,784	NCBI
Celera	12	122,792,105 - 122,794,164 (-)	NCBI		Celera
Cytogenetic Map	12	q24.31	NCBI
HuRef	12	120,146,199 - 120,148,263 (-)	NCBI		HuRef
CHM1_1	12	123,154,148 - 123,156,212 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	122,696,704 - 122,698,768 (-)	NCBI		T2T-CHM13v2.0

Hcar2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955482	6,007,307 - 6,009,353 (+)	NCBI	ChiLan1.0	ChiLan1.0

HCAR2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	130,794,646 - 130,800,178 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	130,791,022 - 130,796,501 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	120,305,297 - 120,308,463 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	124,512,812 - 124,523,387 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

HCAR2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	6,748,415 - 6,750,509 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	6,909,373 - 6,911,477 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	6,997,607 - 6,999,707 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	6,997,738 - 6,998,829 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	6,929,608 - 6,931,708 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	7,023,319 - 7,025,423 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	6,976,781 - 6,978,885 (+)	NCBI		UU_Cfam_GSD_1.0

LOC101978400
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	157,577,983 - 157,580,165 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936558	1,899,313 - 1,901,409 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HCAR2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	14	30,117,014 - 30,119,293 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	31,807,258 - 31,807,879 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Variants in Hcar2
4 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	109
Count of miRNA genes:	94
Interacting mature miRNAs:	98
Transcripts:	ENSRNOT00000032249
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
8693635	Alc28	Alcohol consumption QTL 28	2.7	0.439	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	23081340	44726024	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	15872653	32974238	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	24139202	36638073	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	28064433	46669029	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1556747	Calcic1	Intracellular calcium level QTL 1		3.6	platelet calcium amount (VT:0010500)	platelet intracellular calcium level (CMO:0000922)	12	28064433	40130419	Rat
631829	Alc6	Alcohol consumption QTL 6	4.7		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	28607526	37691617	Rat
8693658	Alc33	Alcohol consumption QTL 33	2.1	0.68	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	12	23081340	43551788	Rat
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	19835789	38193007	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	32103174	45899022	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	28064433	45899022	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	28064557	40218380	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
7387292	Kidm42	Kidney mass QTL 42	3.03	0.0004	kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	12	1	36247923	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat

D4Mgh4

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	78,878,504 - 78,878,711 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	79,570,971 - 79,571,177	NCBI	Rnor6.0
Rnor_6.0	4	79,555,067 - 79,555,273	NCBI	Rnor6.0
Rnor_5.0	4	144,230,964 - 144,231,170	UniSTS	Rnor5.0
Rnor_5.0	4	144,244,763 - 144,244,969	UniSTS	Rnor5.0
RGSC_v3.4	4	78,035,196 - 78,035,403	RGD	RGSC3.4
RGSC_v3.4	4	78,035,197 - 78,035,403	UniSTS	RGSC3.4
RGSC_v3.1	4	78,311,326 - 78,311,533	RGD
Celera	4	73,792,358 - 73,792,564	UniSTS
RH 3.4 Map	4	504.3	RGD
RH 3.4 Map	4	504.3	UniSTS
RH 2.0 Map	4	551.7	RGD
SHRSP x BN Map	4	37.38	RGD
FHH x ACI Map	4	46.9099	RGD
Cytogenetic Map	4	q24	UniSTS

D4Rat40

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	4	106,848,959 - 106,849,106 (+)	Marker Load Pipeline
Rnor_5.0	4	165,920,699 - 165,920,847	NCBI	Rnor5.0
RGSC_v3.4	4	106,554,769 - 106,554,916	RGD	RGSC3.4
RGSC_v3.1	4	106,799,250 - 106,799,397	RGD
SHRSP x BN Map	4	48.75	RGD
SHRSP x BN Map	4	48.75	UniSTS
Cytogenetic Map	12	q15	UniSTS

D4Rat47

Rat Assembly	Chr	Position (strand)	Source
RH 3.4 Map	4	692.1	UniSTS
RH 3.4 Map	4	692.1	RGD
SHRSP x BN Map	4	54.41	UniSTS
SHRSP x BN Map	4	54.41	RGD
FHH x ACI Map	4	66.84	RGD
Cytogenetic Map	12	q15	UniSTS

BI294736

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	32,727,638 - 32,727,856 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	38,161,769 - 38,161,986	NCBI	Rnor6.0
Rnor_5.0	12	40,031,285 - 40,031,502	UniSTS	Rnor5.0
RGSC_v3.4	12	33,865,181 - 33,865,398	UniSTS	RGSC3.4
Celera	12	34,414,004 - 34,414,221	UniSTS
RH 3.4 Map	12	539.11	UniSTS
Cytogenetic Map	12	q15	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	7	32	84	91	90	59	25	59	6	194	77	64	42	49	31


RefSeq Transcripts	NM_181476	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB103062	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000012	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000032249 ⟹ ENSRNOP00000036057

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	32,726,184 - 32,728,504 (+)	Ensembl
Rnor_6.0 Ensembl	12	38,160,464 - 38,161,546 (+)	Ensembl

RefSeq Acc Id:

NM_181476 ⟹ NP_852141

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	12	38,387,163 - 38,389,149 (+)	NCBI
mRatBN7.2	12	32,726,252 - 32,728,238 (+)	NCBI
Rnor_6.0	12	38,160,464 - 38,161,546 (+)	NCBI
Rnor_5.0	12	40,029,980 - 40,031,062 (+)	NCBI
RGSC_v3.4	12	33,863,876 - 33,864,958 (+)	RGD
Celera	12	34,412,699 - 34,413,781 (+)	RGD

Sequence:

show sequence

ATGAGCAAGCAGAACCACTTTCTGGTGATAAACGGCAAGAACTGCTGTGTGTTCCGAGATGAAAACATCGCCAAGGTCCTGCCGCCGGTGTTGGGGCTGGAGTTTGTGTTTGGACTCCTGGGTAATGG
CCTTGCCTTGTGGATCTTCTGTTTCCATCTCAAATCCTGGAAATCCAGCCGGATTTTCTTGTTCAACCTGGCCGTGGCTGACTTTCTCCTGATCATTTGCTTGCCGTTCTTGACGGACAACTATGTCC
AGAACTGGGACTGGAGGTTCGGGAGCATCCCCTGCCGCGTGATGCTCTTCATGTTGGCCATGAACCGACAGGGCAGCATCATCTTCCTCACGGTGGTGGCTGTGGACAGGTACTTCAGGGTGGTCCAC
CCGCACCACTTCCTGAACAAGATCTCCAACCGGACGGCGGCCATCATCTCTTGCTTCCTGTGGGGCATCACCATCGGCCTGACAGTCCACCTCCTCTACACGGACATGATGACCCGAAACGGCGATGC
AAACCTGTGCAGCAGTTTTAGCATCTGCTACACTTTCAGGTGGCACGATGCAATGTTCCTCTTGGAATTCTTCCTGCCCCTGGGCATCATCCTGTTCTGCTCTGGCAGGATCATTTGGAGCCTAAGGC
AGAGACAGATGGACAGGCACGTCAAGATCAAGAGGGCCATCAACTTCATCATGGTGGTTGCCATTGTGTTTGTCATCTGCTTCCTGCCCAGTGTGGCCGTGAGGATCCGCATCTTCTGGCTCCTCTAC
AAACACAACGTGAGGAACTGTGACATCTACTCCTCTGTGGACTTGGCCTTCTTCACCACCCTTAGCTTTACCTACATGAACAGCATGCTCGACCCGGTGGTCTACTATTTCTCCAGCCCATCTTTCCC
CAACTTCTTCTCCACGTGCATCAACCGTTGCCTTCGAAGGAAAACCTTGGGCGAACCAGATAATAACCGGAGCACGAGTGTGGAGCTCACGGGGGACCCCAGCACAATCAGAAGTATTCCAGGGGCAT
TAATGACTGACCCCAGTGAGCCAGGCAGCCCCCCTTATCTGGCTTCCACATCTCGTTAA

hide sequence


Protein RefSeqs	NP_852141	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAC58009	(Get FASTA)	NCBI Sequence Viewer
	EDM13619	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000036057.1
	ENSRNOP00000098813
GenBank Protein	Q80Z39	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_852141 ⟸ NM_181476

- UniProtKB:

Q80Z39 (UniProtKB/Swiss-Prot), A6J130 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSKQNHFLVINGKNCCVFRDENIAKVLPPVLGLEFVFGLLGNGLALWIFCFHLKSWKSSRIFLFNLAVADFLLIICLPFLTDNYVQNWDWRFGSIPCRVMLFMLAMNRQGSIIFLTVVAVDRYFRVVH
PHHFLNKISNRTAAIISCFLWGITIGLTVHLLYTDMMTRNGDANLCSSFSICYTFRWHDAMFLLEFFLPLGIILFCSGRIIWSLRQRQMDRHVKIKRAINFIMVVAIVFVICFLPSVAVRIRIFWLLY
KHNVRNCDIYSSVDLAFFTTLSFTYMNSMLDPVVYYFSSPSFPNFFSTCINRCLRRKTLGEPDNNRSTSVELTGDPSTIRSIPGALMTDPSEPGSPPYLASTSR

hide sequence

Ensembl Acc Id:

ENSRNOP00000036057 ⟸ ENSRNOT00000032249

Protein Domains

G-protein coupled receptors family 1 profile

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q80Z39-F1-model_v2	AlphaFold	Q80Z39	1-360	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13698624

Promoter ID:

EPDNEW_R9147

Type:

single initiation site

Name:

Hcar2_1

Description:

hydroxycarboxylic acid receptor 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	12	38,160,382 - 38,160,442	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-19324	BioCyc
Ensembl Genes	ENSRNOG00000026653	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00000071408	ENTREZGENE
Ensembl Transcript	ENSRNOT00000032249.2	UniProtKB/Swiss-Prot
	ENSRNOT00000156924	ENTREZGENE
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	HCARs	UniProtKB/Swiss-Prot
KEGG Report	rno:353250	UniProtKB/Swiss-Prot
NCBI Gene	353250	ENTREZGENE
PANTHER	HYDROXYCARBOXYLIC ACID RECEPTOR 2	UniProtKB/Swiss-Prot
	HYDROXYCARBOXYLIC ACID RECEPTOR 2	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PhenoGen	Hcar2	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000026653	RatGTEx
	ENSRNOG00000071408	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	A6J130	ENTREZGENE, UniProtKB/TrEMBL
	HCAR2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-02	Hcar2	hydroxycarboxylic acid receptor 2	Niacr1	niacin receptor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-02-23	Niacr1	niacin receptor 1	Gpr109a	G protein-coupled receptor 109A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-11-07	Gpr109a	G protein-coupled receptor 109A	Gpr109b	G protein-coupled receptor 109B	Symbol and Name updated to reflect Human and Mouse nomenclature	1299863	APPROVED
2005-07-08	Gpr109b	G protein-coupled receptor 109B	Pumag	interferon-gamma inducible gene, Puma-g	Symbol and Name updated	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD