Hcar2 (hydroxycarboxylic acid receptor 2)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Hcar2 (hydroxycarboxylic acid receptor 2) Rattus norvegicus

Analyze

Symbol:

Hcar2

Name:

hydroxycarboxylic acid receptor 2

RGD ID:

727952

Description:

Enables nicotinic acid receptor activity. Involved in negative regulation of lipid catabolic process and positive regulation of adiponectin secretion. Predicted to be located in cell junction. Predicted to be active in plasma membrane. Orthologous to several human genes including HCAR2 (hydroxycarboxylic acid receptor 2); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

G protein-coupled receptor 109A; G protein-coupled receptor 109B; G protein-coupled receptor Hm74b; G-protein coupled receptor 109; G-protein coupled receptor 109A; G-protein coupled receptor HM74; Gpr109a; Gpr109b; Hm74; HM74b; interferon-gamma inducible gene, Puma-g; niacin receptor 1; Niacr1; nicotinic acid receptor; protein PUMA-G; Pumag; rHM74b

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	12	32,726,252 - 32,728,238 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	32,726,184 - 32,728,504 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	33,904,918 - 33,906,000 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	34,516,272 - 34,517,354 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	33,568,158 - 33,569,240 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	38,160,464 - 38,161,546 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	38,160,464 - 38,161,546 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	40,029,980 - 40,031,062 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	33,863,876 - 33,864,958 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	33,727,263 - 33,728,346 (+)	NCBI
Celera	12	34,412,699 - 34,413,781 (+)	NCBI		Celera
Cytogenetic Map	12	q15	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Flushing (ISO)

genetic disease (ISO)

psoriasis (ISO)

schizophrenia (ISO)

Skin Neoplasms (ISO)

squamous cell carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-alpha-phellandrene (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2-hydroxypropanoic acid (ISO)

3',5'-cyclic AMP (ISO)

3-hydroxybutyric acid (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3-phenylpropionic acid (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-phellandrene (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cholesterol (ISO)

cisplatin (ISO)

citraconic acid (ISO)

colforsin daropate hydrochloride (ISO)

cyclosporin A (ISO)

dexamethasone (EXP,ISO)

dioxygen (EXP)

folic acid (ISO)

gentamycin (EXP)

glyphosate (EXP)

gold atom (ISO)

gold(0) (ISO)

indometacin (ISO)

leflunomide (ISO)

lipopolysaccharide (ISO)

Muraglitazar (EXP)

nicotinic acid (EXP,ISO)

paracetamol (EXP)

protein kinase inhibitor (ISO)

pyrazoles (EXP,ISO)

rac-lactic acid (ISO)

rotenone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (EXP,ISO)

sodium arsenite (ISO)

Tesaglitazar (EXP)

tetrachloromethane (EXP)

tetrazoles (ISO)

thioacetamide (EXP)

trans-cinnamic acid (ISO)

trichloroethene (EXP)

troglitazone (EXP)

urethane (ISO)

UTP (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

G protein-coupled receptor signaling pathway (IBA)

negative regulation of lipid catabolic process (IDA)

neutrophil apoptotic process (ISO)

positive regulation of adiponectin secretion (IDA)

positive regulation of neutrophil apoptotic process (ISO,ISS)

purinergic nucleotide receptor signaling pathway (IEA)

Cellular Component

cell junction (ISO)

plasma membrane (IBA,ISO,ISS)

Molecular Function

GTP binding (IEA)

nicotinic acid receptor activity (IBA,IDA)

purinergic nucleotide receptor activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	NCBI rat LocusLink and RefSeq merged data October 15, 2003	NCBI rat LocusLink and RefSeq merged data October 15, 2003
4.	Niacin stimulates adiponectin secretion through the GPR109A receptor.	Plaisance EP, etal., Am J Physiol Endocrinol Metab. 2009 Mar;296(3):E549-58. doi: 10.1152/ajpendo.91004.2008. Epub 2009 Jan 13.
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Molecular identification of nicotinic acid receptor.	Soga T, etal., Biochem Biophys Res Commun 2003 Mar 28;303(1):364-9.

Additional References at PubMed

PMID:12522134	PMID:17932499	PMID:19047060	PMID:25622782	PMID:36796675

Genomics

Comparative Map Data

Hcar2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	12	32,726,252 - 32,728,238 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	32,726,184 - 32,728,504 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	33,904,918 - 33,906,000 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	34,516,272 - 34,517,354 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	33,568,158 - 33,569,240 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	38,160,464 - 38,161,546 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	38,160,464 - 38,161,546 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	40,029,980 - 40,031,062 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	12	33,863,876 - 33,864,958 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	12	33,727,263 - 33,728,346 (+)	NCBI
Celera	12	34,412,699 - 34,413,781 (+)	NCBI		Celera
Cytogenetic Map	12	q15	NCBI

HCAR2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	122,701,293 - 122,703,357 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	122,701,293 - 122,703,357 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	123,185,840 - 123,187,904 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	121,751,793 - 121,753,857 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	121,710,720 - 121,712,784	NCBI
Celera	12	122,792,105 - 122,794,164 (-)	NCBI		Celera
Cytogenetic Map	12	q24.31	NCBI
HuRef	12	120,146,199 - 120,148,263 (-)	NCBI		HuRef
CHM1_1	12	123,154,148 - 123,156,212 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	12	122,696,704 - 122,698,768 (-)	NCBI		T2T-CHM13v2.0

Hcar2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955482	6,007,307 - 6,009,353 (+)	NCBI	ChiLan1.0	ChiLan1.0

HCAR2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	12	130,791,022 - 130,796,501 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	120,305,297 - 120,308,463 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	124,512,812 - 124,523,387 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

HCAR2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	6,748,415 - 6,750,509 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	6,909,373 - 6,911,477 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	6,997,607 - 6,999,707 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	6,997,738 - 6,998,829 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	6,929,608 - 6,931,708 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	7,023,319 - 7,025,423 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	6,976,781 - 6,978,885 (+)	NCBI		UU_Cfam_GSD_1.0

LOC101978400
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	157,577,983 - 157,580,165 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936558	1,899,313 - 1,901,409 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HCAR2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	14	30,117,014 - 30,119,293 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	31,807,258 - 31,807,879 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Variants

Variants in Hcar2
4 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	109
Count of miRNA genes:	94
Interacting mature miRNAs:	98
Transcripts:	ENSRNOT00000032249
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1598855	Bp294	Blood pressure QTL 294	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	1	34851688	Rat
7411660	Foco28	Food consumption QTL 28	10.9	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
9590086	Insglur6	Insulin/glucose ratio QTL 6	18.97	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	12	1	42110980	Rat
8694179	Bw150	Body weight QTL 150	2.9	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
7411586	Foco5	Food consumption QTL 5	5.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411595	Foco9	Food consumption QTL 9	4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	1	42110980	Rat
7411545	Bw128	Body weight QTL 128	5.2	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	12	1	42110980	Rat
9590147	Scort7	Serum corticosterone level QTL 7	13.61	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	12	1	42110980	Rat
2303575	Insul14	Insulin level QTL 14	4		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	12	1	42450532	Rat
737979	Pia22	Pristane induced arthritis QTL 22	53.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	1	44465750	Rat
634351	Apr5	Acute phase response QTL 5	6.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	12	1	44503507	Rat
2302042	Pia38	Pristane induced arthritis QTL 38	3.5	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	1	44503507	Rat
634350	Apr4	Acute phase response QTL 4	6		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	1172005	46172005	Rat
8552918	Pigfal7	Plasma insulin-like growth factor 1 level QTL 7			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411547	Bw129	Body weight QTL 129		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	5564495	46669029	Rat
7411597	Foco10	Food consumption QTL 10		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
7411641	Foco19	Food consumption QTL 19	27.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552964	Pigfal17	Plasma insulin-like growth factor 1 level QTL 17	3.5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564495	46669029	Rat
7411588	Foco6	Food consumption QTL 6		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	5564495	46669029	Rat
8552912	Pigfal6	Plasma insulin-like growth factor 1 level QTL 6	5		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	12	5564498	46669029	Rat
10059594	Kidm46	Kidney mass QTL 46	3.79	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	12	6107579	46669029	Rat
1302792	Scl21	Serum cholesterol level QTL 21	3.8	0.0011	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	12	7196730	46669029	Rat
1549829	Scl48	Serum cholesterol level QTL 48	5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	12	9603277	46669029	Rat
2293699	Bss49	Bone structure and strength QTL 49	5.61	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	12	10474137	46669029	Rat
2300186	Bmd59	Bone mineral density QTL 59	7.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	12	10474137	46669029	Rat
1331761	Bp218	Blood pressure QTL 218	2.973		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	12	11073825	45055165	Rat
61404	Bw120	Body weight QTL 120	5.1		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	12	12351619	46669029	Rat
1641928	Alcrsp5	Alcohol response QTL 5			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	12	12812385	46669029	Rat
2303569	Gluco44	Glucose level QTL 44	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	12812385	46669029	Rat
1549902	Bp269	Blood pressure QTL 269			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	13182736	46669029	Rat
1549912	Bp268	Blood pressure QTL 268			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	13182736	46669029	Rat
2302060	Pia37	Pristane induced arthritis QTL 37	6.1	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	12	13198157	46669029	Rat
61421	Cia12	Collagen induced arthritis QTL 12	4.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	13635523	35682913	Rat
631543	Bp83	Blood pressure QTL 83	5.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	15550826	38478808	Rat
2293684	Bmd26	Bone mineral density QTL 26	4.4	0.0002	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	12	15872653	32974238	Rat
631560	Apr1	Acute phase response QTL 1	6.1		orosomucoid 1 amount (VT:0010541)	plasma orosomucoid 1 level (CMO:0001467)	12	19144362	46669029	Rat
737822	Alc10	Alcohol consumption QTL 10	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	19610870	40218516	Rat
5684888	Pia42	Pristane induced arthritis QTL 42			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610870	42828880	Rat
61324	Eae5	Experimental allergic encephalomyelitis QTL 5	14		nervous system integrity trait (VT:0010566)	percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402)	12	19610870	46669029	Rat
1298081	Cia25	Collagen induced arthritis QTL 25	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	12	19610889	35682913	Rat
70213	Niddm27	Non-insulin dependent diabetes mellitus QTL 27	3.72		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	12	19835789	38193007	Rat
7411643	Foco20	Food consumption QTL 20		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	12	20328819	46669029	Rat
70169	Eae13	Experimental allergic encephalomyelitis QTL 13		0.032	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	12	24139202	36638073	Rat
1556747	Calcic1	Intracellular calcium level QTL 1		3.6	platelet calcium amount (VT:0010500)	platelet intracellular calcium level (CMO:0000922)	12	28064433	40130419	Rat
1300175	Cm5	Cardiac mass QTL 5	3.78		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	12	28064433	45899022	Rat
1600386	Calcic2	Intracellular calcium level QTL 2		0.001	platelet physiology trait (VT:0005464)	platelet intracellular calcium level (CMO:0000922)	12	28064433	46669029	Rat
1331787	Rf41	Renal function QTL 41	2.998		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	12	28064557	40218380	Rat
631829	Alc6	Alcohol consumption QTL 6	4.7		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	12	28607526	37691617	Rat
1300162	Bp188	Blood pressure QTL 188	3.19		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	12	32103174	45899022	Rat

Markers in Region

D4Mgh4

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	78,878,504 - 78,878,711 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	79,570,971 - 79,571,177	NCBI	Rnor6.0
Rnor_6.0	4	79,555,067 - 79,555,273	NCBI	Rnor6.0
Rnor_5.0	4	144,230,964 - 144,231,170	UniSTS	Rnor5.0
Rnor_5.0	4	144,244,763 - 144,244,969	UniSTS	Rnor5.0
RGSC_v3.4	4	78,035,196 - 78,035,403	RGD	RGSC3.4
RGSC_v3.4	4	78,035,197 - 78,035,403	UniSTS	RGSC3.4
RGSC_v3.1	4	78,311,326 - 78,311,533	RGD
Celera	4	73,792,358 - 73,792,564	UniSTS
RH 3.4 Map	4	504.3	UniSTS
RH 3.4 Map	4	504.3	RGD
RH 2.0 Map	4	551.7	RGD
SHRSP x BN Map	4	37.38	RGD
FHH x ACI Map	4	46.9099	RGD
Cytogenetic Map	4	q24	UniSTS

D4Rat40

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	4	165,920,699 - 165,920,847	NCBI	Rnor5.0
RGSC_v3.4	4	106,554,769 - 106,554,916	RGD	RGSC3.4
RGSC_v3.1	4	106,799,250 - 106,799,397	RGD
SHRSP x BN Map	4	48.75	RGD
SHRSP x BN Map	4	48.75	UniSTS
Cytogenetic Map	12	q15	UniSTS

D4Rat47

Rat Assembly	Chr	Position (strand)	Source
RH 3.4 Map	4	692.1	RGD
RH 3.4 Map	4	692.1	UniSTS
SHRSP x BN Map	4	54.41	UniSTS
SHRSP x BN Map	4	54.41	RGD
FHH x ACI Map	4	66.84	RGD
Cytogenetic Map	12	q15	UniSTS

BI294736

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	12	32,727,638 - 32,727,856 (+)	MAPPER	mRatBN7.2
Rnor_6.0	12	38,161,769 - 38,161,986	NCBI	Rnor6.0
Rnor_5.0	12	40,031,285 - 40,031,502	UniSTS	Rnor5.0
RGSC_v3.4	12	33,865,181 - 33,865,398	UniSTS	RGSC3.4
Celera	12	34,414,004 - 34,414,221	UniSTS
RH 3.4 Map	12	539.11	UniSTS
Cytogenetic Map	12	q15	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium					11						1	3
Low	3		31	15	8	15	2	2	18	8	10	8	2
Below cutoff		26	26	26		26	5	5	30	24	24		5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_181476	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB103062	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000228	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000032249 ⟹ ENSRNOP00000036057

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	12	32,726,184 - 32,728,504 (+)	Ensembl
Rnor_6.0 Ensembl	12	38,160,464 - 38,161,546 (+)	Ensembl

RefSeq Acc Id:

NM_181476 ⟹ NP_852141

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	12	32,726,252 - 32,728,238 (+)	NCBI
Rnor_6.0	12	38,160,464 - 38,161,546 (+)	NCBI
Rnor_5.0	12	40,029,980 - 40,031,062 (+)	NCBI
RGSC_v3.4	12	33,863,876 - 33,864,958 (+)	RGD
Celera	12	34,412,699 - 34,413,781 (+)	RGD

Sequence:

show sequence

ATGAGCAAGCAGAACCACTTTCTGGTGATAAACGGCAAGAACTGCTGTGTGTTCCGAGATGAAA
ACATCGCCAAGGTCCTGCCGCCGGTGTTGGGGCTGGAGTTTGTGTTTGGACTCCTGGGTAATGG
CCTTGCCTTGTGGATCTTCTGTTTCCATCTCAAATCCTGGAAATCCAGCCGGATTTTCTTGTTC
AACCTGGCCGTGGCTGACTTTCTCCTGATCATTTGCTTGCCGTTCTTGACGGACAACTATGTCC
AGAACTGGGACTGGAGGTTCGGGAGCATCCCCTGCCGCGTGATGCTCTTCATGTTGGCCATGAA
CCGACAGGGCAGCATCATCTTCCTCACGGTGGTGGCTGTGGACAGGTACTTCAGGGTGGTCCAC
CCGCACCACTTCCTGAACAAGATCTCCAACCGGACGGCGGCCATCATCTCTTGCTTCCTGTGGG
GCATCACCATCGGCCTGACAGTCCACCTCCTCTACACGGACATGATGACCCGAAACGGCGATGC
AAACCTGTGCAGCAGTTTTAGCATCTGCTACACTTTCAGGTGGCACGATGCAATGTTCCTCTTG
GAATTCTTCCTGCCCCTGGGCATCATCCTGTTCTGCTCTGGCAGGATCATTTGGAGCCTAAGGC
AGAGACAGATGGACAGGCACGTCAAGATCAAGAGGGCCATCAACTTCATCATGGTGGTTGCCAT
TGTGTTTGTCATCTGCTTCCTGCCCAGTGTGGCCGTGAGGATCCGCATCTTCTGGCTCCTCTAC
AAACACAACGTGAGGAACTGTGACATCTACTCCTCTGTGGACTTGGCCTTCTTCACCACCCTTA
GCTTTACCTACATGAACAGCATGCTCGACCCGGTGGTCTACTATTTCTCCAGCCCATCTTTCCC
CAACTTCTTCTCCACGTGCATCAACCGTTGCCTTCGAAGGAAAACCTTGGGCGAACCAGATAAT
AACCGGAGCACGAGTGTGGAGCTCACGGGGGACCCCAGCACAATCAGAAGTATTCCAGGGGCAT
TAATGACTGACCCCAGTGAGCCAGGCAGCCCCCCTTATCTGGCTTCCACATCTCGTTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_852141	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAC58009	(Get FASTA)	NCBI Sequence Viewer
	EDM13619	(Get FASTA)	NCBI Sequence Viewer
	Q80Z39	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_852141 ⟸ NM_181476

- UniProtKB:

Q80Z39 (UniProtKB/Swiss-Prot), A6J130 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSKQNHFLVINGKNCCVFRDENIAKVLPPVLGLEFVFGLLGNGLALWIFCFHLKSWKSSRIFLF
NLAVADFLLIICLPFLTDNYVQNWDWRFGSIPCRVMLFMLAMNRQGSIIFLTVVAVDRYFRVVH
PHHFLNKISNRTAAIISCFLWGITIGLTVHLLYTDMMTRNGDANLCSSFSICYTFRWHDAMFLL
EFFLPLGIILFCSGRIIWSLRQRQMDRHVKIKRAINFIMVVAIVFVICFLPSVAVRIRIFWLLY
KHNVRNCDIYSSVDLAFFTTLSFTYMNSMLDPVVYYFSSPSFPNFFSTCINRCLRRKTLGEPDN
NRSTSVELTGDPSTIRSIPGALMTDPSEPGSPPYLASTSR

hide sequence

RefSeq Acc Id:

ENSRNOP00000036057 ⟸ ENSRNOT00000032249

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q80Z39-F1-model_v2	AlphaFold	Q80Z39	1-360	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:727952	AgrOrtholog
BioCyc Gene	G2FUF-19324	BioCyc
Ensembl Genes	ENSRNOG00000026653	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000036057	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000032249	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:353250	UniProtKB/Swiss-Prot
NCBI Gene	353250	ENTREZGENE
PANTHER	HYDROXYCARBOXYLIC ACID RECEPTOR 2	UniProtKB/Swiss-Prot
	HYDROXYCARBOXYLIC ACID RECEPTOR 2	UniProtKB/Swiss-Prot
	HYDROXYCARBOXYLIC ACID RECEPTOR 2	UniProtKB/TrEMBL
	HYDROXYCARBOXYLIC ACID RECEPTOR 2	UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Hcar2	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6J130	ENTREZGENE, UniProtKB/TrEMBL
	HCAR2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-08-02	Hcar2	hydroxycarboxylic acid receptor 2	Niacr1	niacin receptor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-02-23	Niacr1	niacin receptor 1	Gpr109a	G protein-coupled receptor 109A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-11-07	Gpr109a	G protein-coupled receptor 109A	Gpr109b	G protein-coupled receptor 109B	Symbol and Name updated to reflect Human and Mouse nomenclature	1299863	APPROVED
2005-07-08	Gpr109b	G protein-coupled receptor 109B	Pumag	interferon-gamma inducible gene, Puma-g	Symbol and Name updated	1299863	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD