Symbol:
Ssbp3
Name:
single stranded DNA binding protein 3
RGD ID:
621502
Description:
Predicted to enable transcription coactivator activity. Predicted to be involved in several processes, including head morphogenesis; nervous system development; and positive regulation of anterior head development. Predicted to act upstream of or within hematopoietic progenitor cell differentiation. Predicted to be part of transcription regulator complex. Predicted to be active in nucleus. Orthologous to human SSBP3 (single stranded DNA binding protein 3); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC102549605; MGC124589; sequence-specific single-stranded-DNA-binding protein; single-stranded DNA-binding protein 3; Ssdp; Ssdp3; uncharacterized LOC102549605
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 126,920,145 - 127,057,968 (+) NCBI GRCr8 mRatBN7.2 5 121,691,370 - 121,828,035 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 121,691,393 - 121,827,992 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 124,310,490 - 124,447,492 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 126,033,508 - 126,170,510 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 126,084,812 - 126,221,819 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 126,511,339 - 126,649,830 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 126,511,350 - 126,648,661 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 130,364,154 - 130,500,627 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 127,987,980 - 128,127,771 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 127,993,205 - 128,132,997 (+) NCBI Celera 5 120,438,879 - 120,575,397 (+) NCBI Celera Cytogenetic Map 5 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ssbp3 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO SSBP3 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of SSBP3 mRNA CTD PMID:22079256 Ssbp3 Rat 1,1-dichloroethene decreases expression ISO Ssbp3 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of SSBP3 mRNA CTD PMID:26682919 Ssbp3 Rat 1,2-dimethylhydrazine affects expression ISO Ssbp3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of SSBP3 mRNA CTD PMID:22206623 Ssbp3 Rat 17beta-estradiol increases expression ISO Ssbp3 (Mus musculus) 6480464 Estradiol results in increased expression of SSBP3 mRNA CTD PMID:39298647 Ssbp3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SSBP3 mRNA CTD PMID:15358164 and PMID:21215274 Ssbp3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ssbp3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SSBP3 mRNA CTD PMID:21570461 Ssbp3 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of SSBP3 mRNA CTD PMID:21346803 Ssbp3 Rat 2-butoxyethanol increases expression ISO Ssbp3 (Mus musculus) 6480464 n-butoxyethanol results in increased expression of SSBP3 mRNA CTD PMID:19812364 Ssbp3 Rat 2-hydroxypropanoic acid decreases expression ISO SSBP3 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of SSBP3 mRNA CTD PMID:30851411 Ssbp3 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO SSBP3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of SSBP3 mRNA CTD PMID:28628672 Ssbp3 Rat 4,4'-sulfonyldiphenol multiple interactions ISO SSBP3 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in increased methylation of SSBP3 gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of SSBP3 mRNA CTD PMID:28628672 and PMID:31601247 Ssbp3 Rat 4,4'-sulfonyldiphenol decreases methylation ISO SSBP3 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of SSBP3 gene CTD PMID:31601247 Ssbp3 Rat 4,4'-sulfonyldiphenol increases expression ISO Ssbp3 (Mus musculus) 6480464 bisphenol S results in increased expression of SSBP3 mRNA CTD PMID:39298647 Ssbp3 Rat 4-hydroxynon-2-enal decreases expression ISO Ssbp3 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in decreased expression of SSBP3 mRNA CTD PMID:19191707 Ssbp3 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of SSBP3 mRNA CTD PMID:36843608 Ssbp3 Rat aflatoxin B1 decreases expression ISO SSBP3 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of SSBP3 mRNA CTD PMID:27153756 Ssbp3 Rat all-trans-retinoic acid decreases expression ISO SSBP3 (Homo sapiens) 6480464 Tretinoin results in decreased expression of SSBP3 mRNA CTD PMID:33167477 Ssbp3 Rat arsenite(3-) increases methylation ISO SSBP3 (Homo sapiens) 6480464 arsenite results in increased methylation of SSBP3 promoter CTD PMID:23974009 Ssbp3 Rat arsenous acid decreases expression ISO SSBP3 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of SSBP3 mRNA CTD PMID:22521957 Ssbp3 Rat benzo[a]pyrene decreases expression ISO Ssbp3 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of SSBP3 mRNA CTD PMID:21569818 Ssbp3 Rat benzo[a]pyrene affects methylation ISO SSBP3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SSBP3 intron CTD PMID:30157460 Ssbp3 Rat benzo[a]pyrene decreases methylation ISO SSBP3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of SSBP3 5' UTR CTD PMID:27901495 Ssbp3 Rat benzo[a]pyrene increases expression ISO Ssbp3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SSBP3 mRNA CTD PMID:22228805 Ssbp3 Rat benzo[a]pyrene decreases expression ISO SSBP3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of SSBP3 mRNA CTD PMID:20106945 more ... Ssbp3 Rat benzo[e]pyrene decreases methylation ISO SSBP3 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of SSBP3 intron CTD PMID:30157460 Ssbp3 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Ssbp3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of SSBP3 mRNA CTD PMID:34319233 Ssbp3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of SSBP3 mRNA CTD PMID:25181051 Ssbp3 Rat bisphenol A affects methylation ISO SSBP3 (Homo sapiens) 6480464 bisphenol A affects the methylation of SSBP3 gene CTD PMID:31601247 Ssbp3 Rat bisphenol A multiple interactions ISO SSBP3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of SSBP3 gene CTD PMID:31601247 Ssbp3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SSBP3 mRNA CTD PMID:38750585 Ssbp3 Rat cadmium atom multiple interactions ISO Ssbp3 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SSBP3 mRNA CTD PMID:37325564 Ssbp3 Rat cadmium dichloride multiple interactions ISO Ssbp3 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of SSBP3 mRNA CTD PMID:37325564 Ssbp3 Rat caffeine affects phosphorylation ISO SSBP3 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of SSBP3 protein CTD PMID:35688186 Ssbp3 Rat calcium silicate decreases expression ISO Ssbp3 (Mus musculus) 6480464 calcium silicate results in decreased expression of SSBP3 mRNA CTD PMID:29279043 Ssbp3 Rat carbon nanotube decreases expression ISO Ssbp3 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Ssbp3 Rat CGP 52608 multiple interactions ISO SSBP3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to SSBP3 gene] CTD PMID:28238834 Ssbp3 Rat choline multiple interactions ISO Ssbp3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of SSBP3 mRNA CTD PMID:20938992 Ssbp3 Rat ciguatoxin CTX1B affects expression ISO Ssbp3 (Mus musculus) 6480464 Ciguatoxins affects the expression of SSBP3 mRNA CTD PMID:18353800 Ssbp3 Rat copper atom multiple interactions ISO SSBP3 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of SSBP3 mRNA CTD PMID:20971185 Ssbp3 Rat copper(0) multiple interactions ISO SSBP3 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of SSBP3 mRNA CTD PMID:20971185 Ssbp3 Rat crocidolite asbestos decreases expression ISO Ssbp3 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of SSBP3 mRNA CTD PMID:29279043 Ssbp3 Rat cyclosporin A decreases expression ISO SSBP3 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of SSBP3 mRNA CTD PMID:20106945 Ssbp3 Rat dexamethasone multiple interactions ISO SSBP3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of SSBP3 mRNA CTD PMID:28628672 Ssbp3 Rat diarsenic trioxide decreases expression ISO SSBP3 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of SSBP3 mRNA CTD PMID:22521957 Ssbp3 Rat diazinon increases methylation ISO SSBP3 (Homo sapiens) 6480464 Diazinon results in increased methylation of SSBP3 gene CTD PMID:22964155 Ssbp3 Rat Dibutyl phosphate affects expression ISO SSBP3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SSBP3 mRNA CTD PMID:37042841 Ssbp3 Rat dibutyl phthalate decreases expression ISO Ssbp3 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of SSBP3 mRNA CTD PMID:21266533 Ssbp3 Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of SSBP3 mRNA CTD PMID:36653537 Ssbp3 Rat diquat decreases expression ISO Ssbp3 (Mus musculus) 6480464 Diquat results in decreased expression of SSBP3 protein CTD PMID:36851058 Ssbp3 Rat doxorubicin decreases expression ISO SSBP3 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of SSBP3 mRNA CTD PMID:29803840 Ssbp3 Rat epoxiconazole decreases expression ISO Ssbp3 (Mus musculus) 6480464 epoxiconazole results in decreased expression of SSBP3 mRNA CTD PMID:35436446 Ssbp3 Rat ethanol affects splicing ISO Ssbp3 (Mus musculus) 6480464 Ethanol affects the splicing of SSBP3 mRNA CTD PMID:30319688 Ssbp3 Rat fenthion increases expression ISO Ssbp3 (Mus musculus) 6480464 Fenthion results in increased expression of SSBP3 mRNA CTD PMID:34813904 Ssbp3 Rat folic acid multiple interactions ISO Ssbp3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of SSBP3 mRNA CTD PMID:20938992 Ssbp3 Rat FR900359 affects phosphorylation ISO SSBP3 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of SSBP3 protein CTD PMID:37730182 Ssbp3 Rat fulvestrant multiple interactions ISO SSBP3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of SSBP3 gene and [bisphenol S co-treated with Fulvestrant] results in increased methylation of SSBP3 gene CTD PMID:31601247 Ssbp3 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of SSBP3 mRNA CTD PMID:22061828 and PMID:33387578 Ssbp3 Rat indometacin multiple interactions ISO SSBP3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of SSBP3 mRNA CTD PMID:28628672 Ssbp3 Rat L-methionine multiple interactions ISO Ssbp3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression of SSBP3 mRNA CTD PMID:20938992 Ssbp3 Rat lead diacetate multiple interactions ISO SSBP3 (Homo sapiens) 6480464 [lead acetate co-treated with zinc protoporphyrin] results in increased expression of SSBP3 mRNA CTD PMID:22839698 Ssbp3 Rat methapyrilene decreases methylation ISO SSBP3 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of SSBP3 intron CTD PMID:30157460 Ssbp3 Rat methidathion increases expression ISO Ssbp3 (Mus musculus) 6480464 methidathion results in increased expression of SSBP3 mRNA CTD PMID:34813904 Ssbp3 Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of SSBP3 mRNA CTD PMID:25729387 Ssbp3 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of SSBP3 mRNA CTD PMID:25729387 Ssbp3 Rat paracetamol affects expression ISO Ssbp3 (Mus musculus) 6480464 Acetaminophen affects the expression of SSBP3 mRNA CTD PMID:17562736 Ssbp3 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of SSBP3 mRNA CTD PMID:32479839 and PMID:33387578 Ssbp3 Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of SSBP3 mRNA CTD PMID:15215175 Ssbp3 Rat pirinixic acid decreases expression ISO Ssbp3 (Mus musculus) 6480464 pirinixic acid results in decreased expression of SSBP3 mRNA CTD PMID:18445702 Ssbp3 Rat potassium chromate decreases expression ISO SSBP3 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of SSBP3 mRNA CTD PMID:22079256 Ssbp3 Rat potassium chromate multiple interactions ISO SSBP3 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of SSBP3 mRNA CTD PMID:22079256 Ssbp3 Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Ssbp3 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of SSBP3 mRNA CTD PMID:28903501 Ssbp3 Rat propiconazole decreases expression ISO Ssbp3 (Mus musculus) 6480464 propiconazole results in decreased expression of SSBP3 mRNA CTD PMID:21278054 Ssbp3 Rat pyrogallol increases expression ISO Ssbp3 (Mus musculus) 6480464 Pyrogallol results in increased expression of SSBP3 mRNA CTD PMID:20362636 Ssbp3 Rat rac-lactic acid decreases expression ISO SSBP3 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of SSBP3 mRNA CTD PMID:30851411 Ssbp3 Rat sodium arsenate decreases expression ISO Ssbp3 (Mus musculus) 6480464 sodium arsenate results in decreased expression of SSBP3 mRNA CTD PMID:30953684 Ssbp3 Rat sodium arsenite increases expression ISO SSBP3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SSBP3 mRNA CTD PMID:34032870 Ssbp3 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of SSBP3 mRNA CTD PMID:31150632 Ssbp3 Rat titanium dioxide increases expression ISO Ssbp3 (Mus musculus) 6480464 titanium dioxide results in increased expression of SSBP3 mRNA CTD PMID:29264374 Ssbp3 Rat titanium dioxide decreases methylation ISO Ssbp3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SSBP3 gene CTD PMID:35295148 Ssbp3 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of SSBP3 mRNA CTD PMID:25729387 Ssbp3 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of SSBP3 mRNA CTD PMID:25729387 Ssbp3 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of SSBP3 mRNA CTD PMID:30589522 Ssbp3 Rat triphenyl phosphate affects expression ISO SSBP3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SSBP3 mRNA CTD PMID:37042841 Ssbp3 Rat triptonide affects expression ISO Ssbp3 (Mus musculus) 6480464 triptonide affects the expression of SSBP3 mRNA CTD PMID:33045310 Ssbp3 Rat troglitazone decreases expression ISO Ssbp3 (Mus musculus) 6480464 troglitazone results in decreased expression of SSBP3 mRNA CTD PMID:28973697 Ssbp3 Rat tungsten decreases expression ISO Ssbp3 (Mus musculus) 6480464 Tungsten results in decreased expression of SSBP3 mRNA CTD PMID:30912803 Ssbp3 Rat urethane increases expression ISO SSBP3 (Homo sapiens) 6480464 Urethane results in increased expression of SSBP3 mRNA CTD PMID:28818685 Ssbp3 Rat valproic acid affects expression ISO Ssbp3 (Mus musculus) 6480464 Valproic Acid affects the expression of SSBP3 mRNA CTD PMID:17963808 Ssbp3 Rat zinc protoporphyrin multiple interactions ISO SSBP3 (Homo sapiens) 6480464 [lead acetate co-treated with zinc protoporphyrin] results in increased expression of SSBP3 mRNA CTD PMID:22839698
(-)-epigallocatechin 3-gallate (ISO) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2-butoxyethanol (ISO) 2-hydroxypropanoic acid (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) calcium silicate (ISO) carbon nanotube (ISO) CGP 52608 (ISO) choline (ISO) ciguatoxin CTX1B (ISO) copper atom (ISO) copper(0) (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) diethylstilbestrol (EXP) diquat (ISO) doxorubicin (ISO) epoxiconazole (ISO) ethanol (ISO) fenthion (ISO) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) gentamycin (EXP) indometacin (ISO) L-methionine (ISO) lead diacetate (ISO) methapyrilene (ISO) methidathion (ISO) oxaliplatin (EXP) paracetamol (EXP,ISO) PhIP (EXP) pirinixic acid (ISO) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (ISO) propiconazole (ISO) pyrogallol (ISO) rac-lactic acid (ISO) sodium arsenate (ISO) sodium arsenite (ISO) tetrachloromethane (EXP) titanium dioxide (ISO) topotecan (EXP) triphenyl phosphate (EXP,ISO) triptonide (ISO) troglitazone (ISO) tungsten (ISO) urethane (ISO) valproic acid (ISO) zinc protoporphyrin (ISO)
Biological Process
head development (IEA,ISO) head morphogenesis (IEA,ISO) hematopoietic progenitor cell differentiation (IEA,ISO) mesendoderm development (IEA,ISO) midbrain-hindbrain boundary initiation (IEA,ISO) positive regulation of anterior head development (IEA,ISO) positive regulation of cell population proliferation (IEA,ISO) positive regulation of DNA-templated transcription (IEA,ISO) positive regulation of transcription by RNA polymerase II (IBA,IEA,ISO) prechordal plate formation (IEA,ISO) protein-containing complex assembly (IEA,ISO)
Ssbp3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 126,920,145 - 127,057,968 (+) NCBI GRCr8 mRatBN7.2 5 121,691,370 - 121,828,035 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 121,691,393 - 121,827,992 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 124,310,490 - 124,447,492 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 126,033,508 - 126,170,510 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 126,084,812 - 126,221,819 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 126,511,339 - 126,649,830 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 126,511,350 - 126,648,661 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 130,364,154 - 130,500,627 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 127,987,980 - 128,127,771 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 127,993,205 - 128,132,997 (+) NCBI Celera 5 120,438,879 - 120,575,397 (+) NCBI Celera Cytogenetic Map 5 q34 NCBI
SSBP3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 54,225,432 - 54,413,490 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 54,225,432 - 54,413,479 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 54,691,105 - 54,879,163 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 54,464,783 - 54,644,680 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 54,404,615 - 54,583,917 NCBI Celera 1 52,979,826 - 53,159,767 (-) NCBI Celera Cytogenetic Map 1 p32.3 NCBI HuRef 1 52,806,513 - 52,987,387 (-) NCBI HuRef CHM1_1 1 54,807,651 - 54,988,420 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 54,108,317 - 54,296,354 (-) NCBI T2T-CHM13v2.0
Ssbp3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 106,768,667 - 106,906,891 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 106,767,898 - 106,906,891 (+) Ensembl GRCm39 Ensembl GRCm38 4 106,911,470 - 107,049,694 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 106,910,701 - 107,049,694 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 106,584,075 - 106,722,299 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 106,409,402 - 106,547,626 (+) NCBI MGSCv36 mm8 Celera 4 105,272,425 - 105,410,615 (+) NCBI Celera Cytogenetic Map 4 C7 NCBI cM Map 4 49.9 NCBI
Ssbp3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955464 4,901,151 - 5,047,656 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955464 4,901,150 - 5,049,341 (+) NCBI ChiLan1.0 ChiLan1.0
SSBP3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 172,429,230 - 172,608,737 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 171,570,463 - 171,749,558 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 53,501,656 - 53,680,682 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 55,094,800 - 55,281,039 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 55,094,820 - 55,272,207 (-) Ensembl panpan1.1 panPan2
SSBP3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 54,690,632 - 54,826,691 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 54,662,840 - 54,824,960 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 54,729,165 - 54,893,490 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 54,849,788 - 55,013,185 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 54,849,889 - 55,013,451 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 54,844,717 - 55,009,418 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 54,734,421 - 54,898,735 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 55,123,610 - 55,288,431 (+) NCBI UU_Cfam_GSD_1.0
Ssbp3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 68,458,512 - 68,614,243 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936522 6,802,052 - 6,956,129 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936522 6,802,057 - 6,957,640 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SSBP3
SSBP3
Ssbp3
.
Predicted Target Of
Count of predictions: 36 Count of miRNA genes: 35 Interacting mature miRNAs: 35 Transcripts: ENSRNOT00000011408 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1298070 Scl18 Serum cholesterol level QTL 18 3.7 blood LDL cholesterol amount (VT:0000181) calculated plasma low density lipoprotein cholesterol level (CMO:0001245) 5 79584860 124584860 Rat 7794739 Bp372 Blood pressure QTL 372 0.0058 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 117913688 125222967 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 1582230 Bw78 Body weight QTL 78 3.2 0.0016 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 5 119085612 128034027 Rat 7411582 Foco3 Food consumption QTL 3 7.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 1598859 Cm66 Cardiac mass QTL 66 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 79584860 124584860 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 7411564 Bw135 Body weight QTL 135 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 87468046 132468046 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 7411601 Foco12 Food consumption QTL 12 19.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 1598846 Bp293 Blood pressure QTL 293 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 79584860 124584860 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1358909 Kidm25 Kidney mass QTL 25 1.87 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 90067849 128034027 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298086 Bp156 Blood pressure QTL 156 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 84132602 129132602 Rat 2306971 Anxrr21 Anxiety related response QTL 21 9.47 fear/anxiety-related behavior trait (VT:1000241) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 5 66174080 124160948 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1358895 Bp254 Blood pressure QTL 254 3.6 0.0003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 58829236 128034027 Rat 6903316 Bw113 Body weight QTL 113 2 0.0103 body mass (VT:0001259) body weight (CMO:0000012) 5 87765973 132765973 Rat 1358889 Bp261 Blood pressure QTL 261 2.86 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 90067849 128034027 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
AU046696
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 121,770,462 - 121,770,625 (+) MAPPER mRatBN7.2 Rnor_6.0 5 126,590,714 - 126,590,876 NCBI Rnor6.0 Rnor_5.0 5 130,442,359 - 130,442,521 UniSTS Rnor5.0 RGSC_v3.4 5 128,068,368 - 128,068,530 UniSTS RGSC3.4 Celera 5 120,517,973 - 120,518,135 UniSTS Cytogenetic Map 5 q34 UniSTS
RH130317
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 127,056,761 - 127,056,937 (+) Marker Load Pipeline mRatBN7.2 5 121,827,954 - 121,828,130 (+) MAPPER mRatBN7.2 Rnor_6.0 5 126,648,624 - 126,648,799 NCBI Rnor6.0 Rnor_5.0 5 130,499,421 - 130,499,596 UniSTS Rnor5.0 RGSC_v3.4 5 128,127,711 - 128,127,886 UniSTS RGSC3.4 Celera 5 120,575,337 - 120,575,512 UniSTS RH 3.4 Map 5 807.3 UniSTS Cytogenetic Map 5 q34 UniSTS
AU047859
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 5 130,420,058 - 130,420,280 NCBI Rnor5.0 RGSC_v3.4 5 128,046,344 - 128,046,565 UniSTS RGSC3.4 Celera 5 120,495,899 - 120,496,136 UniSTS Cytogenetic Map 5 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011408 ⟹ ENSRNOP00000011408
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 121,691,393 - 121,827,992 (+) Ensembl Rnor_6.0 Ensembl 5 126,511,350 - 126,648,661 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000096305 ⟹ ENSRNOP00000082297
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 121,691,693 - 121,827,983 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000101748 ⟹ ENSRNOP00000089190
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 121,691,393 - 121,827,722 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000104386 ⟹ ENSRNOP00000080007
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 121,691,393 - 121,827,992 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000112504 ⟹ ENSRNOP00000095848
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 121,691,693 - 121,827,983 (+) Ensembl
RefSeq Acc Id:
NM_053358 ⟹ NP_445810
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 126,920,201 - 127,056,822 (+) NCBI mRatBN7.2 5 121,691,393 - 121,828,015 (+) NCBI Rnor_6.0 5 126,511,350 - 126,648,684 (+) NCBI Rnor_5.0 5 130,364,154 - 130,500,627 (+) NCBI RGSC_v3.4 5 127,987,980 - 128,127,771 (+) RGD Celera 5 120,438,879 - 120,575,397 (+) RGD
Sequence:
GGCGGCGGCAGAGGCAGCGGTGCTGAAGGCGCAGAGGGCGGCGCAGGCGGAGCCGGGTGGCGGGCGCGCGGGCCGCGAGCAAGCGAGCTGCAGGCTTCGGGCGGGCGGCGGCGCAGCTCAGGCCGAGC
hide sequence
RefSeq Acc Id:
XM_006238532 ⟹ XP_006238594
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 126,920,147 - 127,057,968 (+) NCBI mRatBN7.2 5 121,691,378 - 121,828,035 (+) NCBI Rnor_6.0 5 126,511,339 - 126,649,830 (+) NCBI Rnor_5.0 5 130,364,154 - 130,500,627 (+) NCBI
Sequence:
AGACCAGCGGCGGCGGCGGCAGAGGCAGCGGTGCTGAAGGCGCAGAGGGCGGCGCAGGCGGAGCCGGGTGGCGGGCGCGCGGGCCGCGAGCAAGCGAGCTGCAGGCTTCGGGCGGGCGGCGGCGCAGC
hide sequence
RefSeq Acc Id:
XM_006238533 ⟹ XP_006238595
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 126,920,150 - 127,057,968 (+) NCBI mRatBN7.2 5 121,691,380 - 121,828,035 (+) NCBI Rnor_6.0 5 126,511,339 - 126,649,830 (+) NCBI Rnor_5.0 5 130,364,154 - 130,500,627 (+) NCBI
Sequence:
AGACCAGCGGCGGCGGCGGCAGAGGCAGCGGTGCTGAAGGCGCAGAGGGCGGCGCAGGCGGAGC
hide sequence
RefSeq Acc Id:
XM_006238534 ⟹ XP_006238596
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 126,920,150 - 127,057,968 (+) NCBI mRatBN7.2 5 121,691,380 - 121,828,035 (+) NCBI Rnor_6.0 5 126,511,339 - 126,649,830 (+) NCBI Rnor_5.0 5 130,364,154 - 130,500,627 (+) NCBI
Sequence:
AGACCAGCGGCGGCGGCGGCAGAGGCAGCGGTGCTGAAGGCGCAGAGGGCGGCGCAGGCGGAGC
hide sequence
RefSeq Acc Id:
XM_006238535 ⟹ XP_006238597
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 126,920,154 - 127,057,968 (+) NCBI mRatBN7.2 5 121,691,382 - 121,828,031 (+) NCBI Rnor_6.0 5 126,511,339 - 126,649,830 (+) NCBI Rnor_5.0 5 130,364,154 - 130,500,627 (+) NCBI
Sequence:
AGACCAGCGGCGGCGGCGGCAGAGGCAGCGGTGCTGAAGGCGCAGAGGGCGGCGCAGGCGGAGC
hide sequence
RefSeq Acc Id:
XM_006238536 ⟹ XP_006238598
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 126,920,151 - 127,057,968 (+) NCBI mRatBN7.2 5 121,691,380 - 121,828,035 (+) NCBI Rnor_6.0 5 126,511,339 - 126,649,830 (+) NCBI Rnor_5.0 5 130,364,154 - 130,500,627 (+) NCBI
Sequence:
AGACCAGCGGCGGCGGCGGCAGAGGCAGCGGTGCTGAAGGCGCAGAGGGCGGCGCAGGCGGAGC
hide sequence
RefSeq Acc Id:
XM_006238537 ⟹ XP_006238599
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 126,920,154 - 127,057,968 (+) NCBI mRatBN7.2 5 121,691,382 - 121,828,035 (+) NCBI Rnor_6.0 5 126,511,339 - 126,649,830 (+) NCBI Rnor_5.0 5 130,364,154 - 130,500,627 (+) NCBI
Sequence:
AGACCAGCGGCGGCGGCGGCAGAGGCAGCGGTGCTGAAGGCGCAGAGGGCGGCGCAGGCGGAGC
hide sequence
RefSeq Acc Id:
XM_006238538 ⟹ XP_006238600
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 126,920,155 - 127,057,968 (+) NCBI mRatBN7.2 5 121,691,382 - 121,828,035 (+) NCBI Rnor_6.0 5 126,511,339 - 126,649,830 (+) NCBI Rnor_5.0 5 130,364,154 - 130,500,627 (+) NCBI
Sequence:
AGACCAGCGGCGGCGGCGGCAGAGGCAGCGGTGCTGAAGGCGCAGAGGGCGGCGCAGGCGGAGCCGGGTGGCGGGCGCGCGGGCCGCGAGCAAGCGAGCTGCAGGCTTCGGGCGGGCGGCGGCGCAGC
hide sequence
RefSeq Acc Id:
XM_017593663 ⟹ XP_017449152
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 126,995,585 - 127,057,968 (+) NCBI mRatBN7.2 5 121,765,459 - 121,828,035 (+) NCBI Rnor_6.0 5 126,585,536 - 126,649,830 (+) NCBI
Sequence:
AAAAAAGAAAAAAGAAAAAAAGAACGGGGTCACAGGTAAACCACATGTGACCTCGATCCCTTGT
hide sequence
RefSeq Acc Id:
XM_039110867 ⟹ XP_038966795
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 126,995,796 - 127,057,968 (+) NCBI mRatBN7.2 5 121,766,998 - 121,828,035 (+) NCBI
RefSeq Acc Id:
XM_039110869 ⟹ XP_038966797
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 126,962,355 - 127,057,968 (+) NCBI mRatBN7.2 5 121,728,992 - 121,828,035 (+) NCBI
RefSeq Acc Id:
XM_039110871 ⟹ XP_038966799
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 126,962,484 - 127,057,968 (+) NCBI mRatBN7.2 5 121,733,593 - 121,828,035 (+) NCBI
RefSeq Acc Id:
XM_039110872 ⟹ XP_038966800
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 126,963,952 - 127,057,968 (+) NCBI mRatBN7.2 5 121,735,417 - 121,828,031 (+) NCBI
RefSeq Acc Id:
XM_039110873 ⟹ XP_038966801
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 127,039,455 - 127,057,968 (+) NCBI mRatBN7.2 5 121,810,255 - 121,828,035 (+) NCBI
RefSeq Acc Id:
XM_063288492 ⟹ XP_063144562
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 126,920,145 - 127,057,968 (+) NCBI
RefSeq Acc Id:
XM_063288493 ⟹ XP_063144563
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 126,920,150 - 127,057,968 (+) NCBI
RefSeq Acc Id:
XM_063288494 ⟹ XP_063144564
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 126,920,150 - 127,057,968 (+) NCBI
RefSeq Acc Id:
XM_063288495 ⟹ XP_063144565
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 126,920,154 - 127,057,968 (+) NCBI
RefSeq Acc Id:
XM_063288496 ⟹ XP_063144566
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 126,995,808 - 127,057,968 (+) NCBI
RefSeq Acc Id:
XM_063288497 ⟹ XP_063144567
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 127,039,455 - 127,057,968 (+) NCBI
RefSeq Acc Id:
XM_063288498 ⟹ XP_063144568
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 127,039,455 - 127,057,968 (+) NCBI
RefSeq Acc Id:
NP_445810 ⟸ NM_053358
- UniProtKB:
Q9R050 (UniProtKB/Swiss-Prot), Q3B7C9 (UniProtKB/TrEMBL)
- Sequence:
MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPNDGMPGGPIPPGFFQPFMSPR
hide sequence
RefSeq Acc Id:
XP_006238594 ⟸ XM_006238532
- Peptide Label:
isoform X1
- UniProtKB:
Q9R050 (UniProtKB/Swiss-Prot)
- Sequence:
MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPNDGMPGGPIPPGFFQGPPGSQ
hide sequence
RefSeq Acc Id:
XP_006238596 ⟸ XM_006238534
- Peptide Label:
isoform X3
- UniProtKB:
Q9R050 (UniProtKB/Swiss-Prot), A0A8I5ZWL0 (UniProtKB/TrEMBL)
- Sequence:
MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWC
hide sequence
RefSeq Acc Id:
XP_006238595 ⟸ XM_006238533
- Peptide Label:
isoform X2
- UniProtKB:
Q9R050 (UniProtKB/Swiss-Prot)
- Sequence:
MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPNDGMPGGPIPPGFFQGPPGSQ
hide sequence
RefSeq Acc Id:
XP_006238598 ⟸ XM_006238536
- Peptide Label:
isoform X5
- UniProtKB:
Q9R050 (UniProtKB/Swiss-Prot)
- Sequence:
MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWC
hide sequence
RefSeq Acc Id:
XP_006238597 ⟸ XM_006238535
- Peptide Label:
isoform X4
- UniProtKB:
Q9R050 (UniProtKB/Swiss-Prot), A6JYP3 (UniProtKB/TrEMBL)
- Sequence:
MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWC
hide sequence
RefSeq Acc Id:
XP_006238600 ⟸ XM_006238538
- Peptide Label:
isoform X7
- UniProtKB:
Q9R050 (UniProtKB/Swiss-Prot), F7FHV2 (UniProtKB/TrEMBL)
- Sequence:
MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPNDGMPGGPIPPGFFQPFMSPR
hide sequence
RefSeq Acc Id:
XP_006238599 ⟸ XM_006238537
- Peptide Label:
isoform X6
- UniProtKB:
Q9R050 (UniProtKB/Swiss-Prot)
- Sequence:
MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPNDGMPGGPIPPGFFQPFMSPR
hide sequence
RefSeq Acc Id:
XP_017449152 ⟸ XM_017593663
- Peptide Label:
isoform X9
- Sequence:
MFGKLEPSPGTRGETHSLVAPIRLCATHIKSAAAAPSPVLGNIPPNDGMPGGPIPPGFFQGPPGSQPSPHAQPPPHNPSSMMGPHSQPFMSPRYAGGPRPPIRMGNQPPGGVPGTQPLLPNSMDPTRQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000011408 ⟸ ENSRNOT00000011408
RefSeq Acc Id:
XP_038966797 ⟸ XM_039110869
- Peptide Label:
isoform X14
- UniProtKB:
A6JYP5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038966799 ⟸ XM_039110871
- Peptide Label:
isoform X16
- UniProtKB:
A6JYP5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038966800 ⟸ XM_039110872
- Peptide Label:
isoform X17
- UniProtKB:
A6JYP9 (UniProtKB/TrEMBL), A6JYP5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038966795 ⟸ XM_039110867
- Peptide Label:
isoform X13
- UniProtKB:
A6JYP5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038966801 ⟸ XM_039110873
- Peptide Label:
isoform X18
Ensembl Acc Id:
ENSRNOP00000080007 ⟸ ENSRNOT00000104386
Ensembl Acc Id:
ENSRNOP00000089190 ⟸ ENSRNOT00000101748
Ensembl Acc Id:
ENSRNOP00000082297 ⟸ ENSRNOT00000096305
Ensembl Acc Id:
ENSRNOP00000095848 ⟸ ENSRNOT00000112504
RefSeq Acc Id:
XP_063144562 ⟸ XM_063288492
- Peptide Label:
isoform X8
- UniProtKB:
Q9R050 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063144564 ⟸ XM_063288494
- Peptide Label:
isoform X11
- UniProtKB:
Q9R050 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063144563 ⟸ XM_063288493
- Peptide Label:
isoform X10
- UniProtKB:
Q9R050 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063144565 ⟸ XM_063288495
- Peptide Label:
isoform X12
- UniProtKB:
Q9R050 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063144566 ⟸ XM_063288496
- Peptide Label:
isoform X15
- UniProtKB:
A6JYP5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063144567 ⟸ XM_063288497
- Peptide Label:
isoform X19
RefSeq Acc Id:
XP_063144568 ⟸ XM_063288498
- Peptide Label:
isoform X20
RGD ID: 13693886 Promoter ID: EPDNEW_R4411 Type: multiple initiation site Name: Ssbp3_1 Description: single stranded DNA binding protein 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 126,511,336 - 126,511,396 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-07-29
Ssbp3
single stranded DNA binding protein 3
LOC102549605
uncharacterized LOC102549605
Data merged from RGD:7526971
737654 PROVISIONAL
2013-12-17
LOC102549605
uncharacterized LOC102549605
Symbol and Name status set to provisional
70820 PROVISIONAL
2005-11-17
Ssbp3
single stranded DNA binding protein 3
Ssdp3
Symbol updated
1299863 APPROVED
2004-04-22
Ssdp3
single stranded DNA binding protein 3
Ssdp
sequence-specific single-stranded-DNA-binding protein
Symbol and Name updated to reflect Human and Mouse nomenclature
625702 APPROVED
2002-08-07
Ssdp
sequence-specific single-stranded-DNA-binding protein
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_homology
80% homologous to the chicken gene
634142
gene_protein
361 amino acid protein with a mass of 37.7 kDa
634142
