Symbol:
Atp6v0a2
Name:
ATPase H+ transporting V0 subunit a2
RGD ID:
621006
Description:
Predicted to enable proton-transporting ATPase activity, rotational mechanism. Predicted to be involved in cellular response to increased oxygen levels and intracellular iron ion homeostasis. Predicted to be located in several cellular components, including acrosomal vesicle; focal adhesion; and perinuclear region of cytoplasm. Predicted to be part of proton-transporting V-type ATPase, V0 domain. Human ortholog(s) of this gene implicated in autosomal recessive cutis laxa type IIA and wrinkly skin syndrome. Orthologous to human ATP6V0A2 (ATPase H+ transporting V0 subunit a2); PARTICIPATES IN oxidative phosphorylation pathway; phagocytosis pathway; rheumatoid arthritis pathway; INTERACTS WITH 6-propyl-2-thiouracil; ammonium chloride; amphetamine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ATPase, H+ transporting, lysosomal V0 subunit a isoform 2; ATPase, H+ transporting, lysosomal V0 subunit A2; Cc1-3; J6b7; LOC304467; T-cell expressing clone j6; Tj6; V-type proton ATPase 116 kDa subunit a; V-type proton ATPase 116 kDa subunit a 2; V-type proton ATPase 116 kDa subunit a isoform 2; V-type proton ATPase 116 kDa subunit a2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 37,608,211 - 37,640,860 (-) NCBI GRCr8 mRatBN7.2 12 31,947,220 - 31,979,875 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 31,822,733 - 32,007,069 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 33,129,001 - 33,158,515 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 33,740,320 - 33,769,838 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 32,792,188 - 32,821,709 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 37,368,321 - 37,398,233 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 37,363,906 - 37,425,596 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 39,238,423 - 39,269,298 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 33,061,611 - 33,092,421 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 32,941,066 - 32,949,116 (-) NCBI Celera 12 33,639,711 - 33,670,024 (-) NCBI Celera Cytogenetic Map 12 q15 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Atp6v0a2 Rat 1,2-dimethylhydrazine decreases expression ISO Atp6v0a2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of ATP6V0A2 mRNA CTD PMID:22206623 Atp6v0a2 Rat 17beta-estradiol decreases expression ISO Atp6v0a2 (Mus musculus) 6480464 Estradiol results in decreased expression of ATP6V0A2 mRNA CTD PMID:39298647 Atp6v0a2 Rat 17beta-estradiol increases expression ISO ATP6V0A2 (Homo sapiens) 6480464 Estradiol results in increased expression of ATP6V0A2 mRNA CTD PMID:31614463 Atp6v0a2 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO ATP6V0A2 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of ATP6V0A2 mRNA CTD PMID:29581250 Atp6v0a2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl affects expression ISO Atp6v0a2 (Mus musculus) 6480464 2 more ... CTD PMID:24680724 Atp6v0a2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Atp6v0a2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ATP6V0A2 mRNA CTD PMID:21570461 and PMID:24680724 Atp6v0a2 Rat 2-hydroxypropanoic acid decreases expression ISO ATP6V0A2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of ATP6V0A2 mRNA CTD PMID:30851411 Atp6v0a2 Rat 2-methylcholine affects expression ISO ATP6V0A2 (Homo sapiens) 6480464 beta-methylcholine affects the expression of ATP6V0A2 mRNA CTD PMID:21179406 Atp6v0a2 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Atp6v0a2 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of ATP6V0A2 mRNA CTD PMID:26251327 Atp6v0a2 Rat 3,4-methylenedioxymethamphetamine increases methylation ISO Atp6v0a2 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased methylation of ATP6V0A2 promoter CTD PMID:26251327 Atp6v0a2 Rat 4,4'-sulfonyldiphenol decreases expression ISO Atp6v0a2 (Mus musculus) 6480464 bisphenol S results in decreased expression of ATP6V0A2 mRNA CTD PMID:39298647 Atp6v0a2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of ATP6V0A2 mRNA CTD PMID:24780913 Atp6v0a2 Rat acrylamide affects methylation ISO Atp6v0a2 (Mus musculus) 6480464 Acrylamide affects the methylation of ATP6V0A2 gene CTD PMID:35032568 Atp6v0a2 Rat aflatoxin B1 decreases expression ISO Atp6v0a2 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of ATP6V0A2 mRNA CTD PMID:19770486 Atp6v0a2 Rat all-trans-retinoic acid decreases expression ISO ATP6V0A2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of ATP6V0A2 mRNA CTD PMID:15498508 and PMID:33167477 Atp6v0a2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ATP6V0A2 mRNA CTD PMID:16483693 Atp6v0a2 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of ATP6V0A2 mRNA CTD PMID:30779732 Atp6v0a2 Rat arsane multiple interactions ISO ATP6V0A2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ATP6V0A2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ATP6V0A2 mRNA CTD PMID:39836092 Atp6v0a2 Rat arsenic atom multiple interactions ISO ATP6V0A2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ATP6V0A2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ATP6V0A2 mRNA CTD PMID:39836092 Atp6v0a2 Rat atrazine decreases expression ISO ATP6V0A2 (Homo sapiens) 6480464 Atrazine results in decreased expression of ATP6V0A2 mRNA CTD PMID:22378314 Atp6v0a2 Rat Azoxymethane multiple interactions ISO Atp6v0a2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ATP6V0A2 mRNA CTD PMID:29950665 Atp6v0a2 Rat benzo[a]pyrene increases methylation ISO ATP6V0A2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ATP6V0A2 promoter CTD PMID:27901495 Atp6v0a2 Rat benzo[a]pyrene diol epoxide I decreases expression ISO ATP6V0A2 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Atp6v0a2 Rat bis(2-chloroethyl) sulfide increases expression ISO Atp6v0a2 (Mus musculus) 6480464 Mustard Gas results in increased expression of ATP6V0A2 mRNA CTD PMID:15674844 Atp6v0a2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ATP6V0A2 mRNA CTD PMID:25181051 and PMID:34947998 Atp6v0a2 Rat bisphenol A decreases expression ISO ATP6V0A2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of ATP6V0A2 mRNA CTD PMID:34748853 Atp6v0a2 Rat caffeine affects phosphorylation ISO ATP6V0A2 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of ATP6V0A2 protein CTD PMID:35688186 Atp6v0a2 Rat clofibrate multiple interactions ISO Atp6v0a2 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ATP6V0A2 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of ATP6V0A2 mRNA] CTD PMID:17585979 Atp6v0a2 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of ATP6V0A2 mRNA CTD PMID:24386269 Atp6v0a2 Rat coumarin affects phosphorylation ISO ATP6V0A2 (Homo sapiens) 6480464 coumarin affects the phosphorylation of ATP6V0A2 protein CTD PMID:35688186 Atp6v0a2 Rat cyclosporin A increases expression ISO ATP6V0A2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of ATP6V0A2 mRNA CTD PMID:20106945 Atp6v0a2 Rat daidzein multiple interactions ISO ATP6V0A2 (Homo sapiens) 6480464 [Genistein co-treated with daidzein co-treated with glycitein] results in decreased expression of ATP6V0A2 mRNA CTD PMID:16963248 Atp6v0a2 Rat dextran sulfate multiple interactions ISO Atp6v0a2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ATP6V0A2 mRNA CTD PMID:29950665 Atp6v0a2 Rat diazinon increases methylation ISO ATP6V0A2 (Homo sapiens) 6480464 Diazinon results in increased methylation of ATP6V0A2 gene CTD PMID:22964155 Atp6v0a2 Rat diquat decreases expression ISO Atp6v0a2 (Mus musculus) 6480464 Diquat results in decreased expression of ATP6V0A2 protein CTD PMID:36851058 Atp6v0a2 Rat dorsomorphin multiple interactions ISO ATP6V0A2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Atp6v0a2 Rat entinostat multiple interactions ISO ATP6V0A2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ATP6V0A2 mRNA CTD PMID:27188386 Atp6v0a2 Rat entinostat decreases expression ISO ATP6V0A2 (Homo sapiens) 6480464 entinostat results in decreased expression of ATP6V0A2 mRNA CTD PMID:26272509 Atp6v0a2 Rat epoxiconazole decreases expression ISO Atp6v0a2 (Mus musculus) 6480464 epoxiconazole results in decreased expression of ATP6V0A2 mRNA CTD PMID:35436446 Atp6v0a2 Rat ethanol increases expression ISO Atp6v0a2 (Mus musculus) 6480464 Ethanol results in increased expression of ATP6V0A2 mRNA CTD PMID:30319688 Atp6v0a2 Rat ethanol multiple interactions ISO Atp6v0a2 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of ATP6V0A2 mRNA CTD PMID:30319688 Atp6v0a2 Rat folic acid decreases expression ISO Atp6v0a2 (Mus musculus) 6480464 Folic Acid results in decreased expression of ATP6V0A2 mRNA CTD PMID:25629700 Atp6v0a2 Rat FR900359 increases phosphorylation ISO ATP6V0A2 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of ATP6V0A2 protein CTD PMID:37730182 Atp6v0a2 Rat genistein multiple interactions ISO ATP6V0A2 (Homo sapiens) 6480464 [Genistein co-treated with daidzein co-treated with glycitein] results in decreased expression of ATP6V0A2 mRNA CTD PMID:16963248 Atp6v0a2 Rat genistein increases expression EXP 6480464 Genistein results in increased expression of ATP6V0A2 protein CTD PMID:24552547 Atp6v0a2 Rat glycitein multiple interactions ISO ATP6V0A2 (Homo sapiens) 6480464 [Genistein co-treated with daidzein co-treated with glycitein] results in decreased expression of ATP6V0A2 mRNA CTD PMID:16963248 Atp6v0a2 Rat glyphosate decreases expression ISO ATP6V0A2 (Homo sapiens) 6480464 Glyphosate results in decreased expression of ATP6V0A2 mRNA CTD PMID:34748853 Atp6v0a2 Rat hydroxyurea decreases expression ISO ATP6V0A2 (Homo sapiens) 6480464 Hydroxyurea results in decreased expression of ATP6V0A2 mRNA CTD PMID:34748853 Atp6v0a2 Rat inulin multiple interactions ISO Atp6v0a2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of ATP6V0A2 mRNA CTD PMID:36331819 Atp6v0a2 Rat lead(0) affects expression ISO ATP6V0A2 (Homo sapiens) 6480464 Lead affects the expression of ATP6V0A2 mRNA CTD PMID:28903495 Atp6v0a2 Rat manganese atom multiple interactions ISO ATP6V0A2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ATP6V0A2 mRNA CTD PMID:39836092 Atp6v0a2 Rat manganese(0) multiple interactions ISO ATP6V0A2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ATP6V0A2 mRNA CTD PMID:39836092 Atp6v0a2 Rat manganese(II) chloride multiple interactions ISO ATP6V0A2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ATP6V0A2 mRNA CTD PMID:39836092 Atp6v0a2 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of ATP6V0A2 gene and [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of ATP6V0A2 mRNA CTD PMID:28659758 and PMID:33148267 Atp6v0a2 Rat nitrates multiple interactions ISO Atp6v0a2 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of ATP6V0A2 mRNA CTD PMID:35964746 Atp6v0a2 Rat panobinostat multiple interactions ISO ATP6V0A2 (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ATP6V0A2 mRNA CTD PMID:27188386 Atp6v0a2 Rat panobinostat decreases expression ISO ATP6V0A2 (Homo sapiens) 6480464 panobinostat results in decreased expression of ATP6V0A2 mRNA CTD PMID:26272509 Atp6v0a2 Rat paracetamol multiple interactions ISO Atp6v0a2 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ATP6V0A2 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of ATP6V0A2 mRNA] CTD PMID:17585979 Atp6v0a2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Atp6v0a2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of ATP6V0A2 mRNA CTD PMID:36331819 Atp6v0a2 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of ATP6V0A2 gene and [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of ATP6V0A2 mRNA CTD PMID:28659758 and PMID:33148267 Atp6v0a2 Rat phenobarbital increases expression ISO Atp6v0a2 (Mus musculus) 6480464 Phenobarbital results in increased expression of ATP6V0A2 mRNA CTD PMID:19270015 Atp6v0a2 Rat pirinixic acid increases expression ISO Atp6v0a2 (Mus musculus) 6480464 pirinixic acid results in increased expression of ATP6V0A2 mRNA CTD PMID:18301758 and PMID:23811191 Atp6v0a2 Rat poly(I:C) multiple interactions ISO ATP6V0A2 (Homo sapiens) 6480464 [TL8-506 co-treated with Poly I-C] results in increased expression of ATP6V0A2 mRNA CTD PMID:35688559 Atp6v0a2 Rat Pyridostigmine bromide multiple interactions EXP 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of ATP6V0A2 mRNA CTD PMID:28659758 Atp6v0a2 Rat quinolin-8-ol decreases expression ISO ATP6V0A2 (Homo sapiens) 6480464 Oxyquinoline results in decreased expression of ATP6V0A2 mRNA CTD PMID:21632981 Atp6v0a2 Rat rac-lactic acid decreases expression ISO ATP6V0A2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of ATP6V0A2 mRNA CTD PMID:30851411 Atp6v0a2 Rat rotenone increases expression ISO ATP6V0A2 (Homo sapiens) 6480464 Rotenone results in increased expression of ATP6V0A2 mRNA CTD PMID:31648047 Atp6v0a2 Rat sarin decreases expression ISO ATP6V0A2 (Homo sapiens) 6480464 Sarin results in decreased expression of ATP6V0A2 mRNA CTD PMID:19522546 Atp6v0a2 Rat SB 431542 multiple interactions ISO ATP6V0A2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Atp6v0a2 Rat sodium arsenite increases expression ISO ATP6V0A2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ATP6V0A2 mRNA CTD PMID:38568856 Atp6v0a2 Rat sodium arsenite multiple interactions ISO ATP6V0A2 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ATP6V0A2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ATP6V0A2 mRNA CTD PMID:39836092 Atp6v0a2 Rat sunitinib increases expression ISO ATP6V0A2 (Homo sapiens) 6480464 Sunitinib results in increased expression of ATP6V0A2 mRNA CTD PMID:31533062 Atp6v0a2 Rat tamibarotene decreases expression ISO ATP6V0A2 (Homo sapiens) 6480464 tamibarotene results in decreased expression of ATP6V0A2 mRNA CTD PMID:15498508 Atp6v0a2 Rat temozolomide increases expression ISO ATP6V0A2 (Homo sapiens) 6480464 Temozolomide results in increased expression of ATP6V0A2 mRNA CTD PMID:31758290 Atp6v0a2 Rat testosterone affects expression ISO Atp6v0a2 (Mus musculus) 6480464 Testosterone affects the expression of ATP6V0A2 mRNA CTD PMID:20403060 Atp6v0a2 Rat thapsigargin increases expression ISO ATP6V0A2 (Homo sapiens) 6480464 Thapsigargin results in increased expression of ATP6V0A2 mRNA CTD PMID:29453283 Atp6v0a2 Rat titanium dioxide multiple interactions ISO Atp6v0a2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of ATP6V0A2 mRNA CTD PMID:29950665 Atp6v0a2 Rat tunicamycin increases expression ISO ATP6V0A2 (Homo sapiens) 6480464 Tunicamycin results in increased expression of ATP6V0A2 mRNA CTD PMID:29453283 Atp6v0a2 Rat valproic acid affects expression ISO Atp6v0a2 (Mus musculus) 6480464 Valproic Acid affects the expression of ATP6V0A2 mRNA CTD PMID:17292431 Atp6v0a2 Rat valproic acid multiple interactions ISO ATP6V0A2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of ATP6V0A2 mRNA CTD PMID:27188386 Atp6v0a2 Rat valproic acid decreases expression ISO ATP6V0A2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ATP6V0A2 mRNA CTD PMID:23179753 more ... Atp6v0a2 Rat valproic acid affects expression ISO ATP6V0A2 (Homo sapiens) 6480464 Valproic Acid affects the expression of ATP6V0A2 mRNA CTD PMID:25979313 Atp6v0a2 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of ATP6V0A2 mRNA CTD PMID:19015723 Atp6v0a2 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of ATP6V0A2 mRNA CTD PMID:23034163
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) amphetamine (EXP) arsane (ISO) arsenic atom (ISO) atrazine (ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) caffeine (ISO) clofibrate (ISO) cobalt dichloride (EXP) coumarin (ISO) cyclosporin A (ISO) daidzein (ISO) dextran sulfate (ISO) diazinon (ISO) diquat (ISO) dorsomorphin (ISO) entinostat (ISO) epoxiconazole (ISO) ethanol (ISO) folic acid (ISO) FR900359 (ISO) genistein (EXP,ISO) glycitein (ISO) glyphosate (ISO) hydroxyurea (ISO) inulin (ISO) lead(0) (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) N,N-diethyl-m-toluamide (EXP) nitrates (ISO) panobinostat (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) permethrin (EXP) phenobarbital (ISO) pirinixic acid (ISO) poly(I:C) (ISO) Pyridostigmine bromide (EXP) quinolin-8-ol (ISO) rac-lactic acid (ISO) rotenone (ISO) sarin (ISO) SB 431542 (ISO) sodium arsenite (ISO) sunitinib (ISO) tamibarotene (ISO) temozolomide (ISO) testosterone (ISO) thapsigargin (ISO) titanium dioxide (ISO) tunicamycin (ISO) valproic acid (ISO) vinclozolin (EXP)
Atp6v0a2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 37,608,211 - 37,640,860 (-) NCBI GRCr8 mRatBN7.2 12 31,947,220 - 31,979,875 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 31,822,733 - 32,007,069 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 33,129,001 - 33,158,515 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 33,740,320 - 33,769,838 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 32,792,188 - 32,821,709 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 37,368,321 - 37,398,233 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 37,363,906 - 37,425,596 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 39,238,423 - 39,269,298 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 33,061,611 - 33,092,421 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 32,941,066 - 32,949,116 (-) NCBI Celera 12 33,639,711 - 33,670,024 (-) NCBI Celera Cytogenetic Map 12 q15 NCBI
ATP6V0A2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 123,712,353 - 123,761,755 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 123,712,353 - 123,761,755 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 124,196,900 - 124,246,302 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 122,762,818 - 122,810,394 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 122,721,744 - 122,769,321 NCBI Celera 12 123,793,121 - 123,842,693 (+) NCBI Celera Cytogenetic Map 12 q24.31 NCBI HuRef 12 121,158,054 - 121,207,491 (+) NCBI HuRef CHM1_1 12 124,017,815 - 124,067,195 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 123,711,219 - 123,760,679 (+) NCBI T2T-CHM13v2.0
Atp6v0a2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 124,767,117 - 124,801,519 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 124,766,641 - 124,801,519 (+) Ensembl GRCm39 Ensembl GRCm38 5 124,629,052 - 124,724,455 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 124,628,576 - 124,724,455 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 125,079,648 - 125,097,437 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv37 5 125,192,573 - 125,202,524 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 125,001,189 - 125,011,627 (+) NCBI MGSCv36 mm8 Celera 5 121,704,480 - 121,735,509 (+) NCBI Celera Cytogenetic Map 5 F NCBI cM Map 5 63.7 NCBI
Atp6v0a2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955482 5,311,434 - 5,337,697 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955482 5,311,434 - 5,337,684 (-) NCBI ChiLan1.0 ChiLan1.0
ATP6V0A2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 131,787,497 - 131,834,937 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 131,783,904 - 131,831,213 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 121,297,959 - 121,343,294 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 125,522,886 - 125,569,858 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 125,522,886 - 125,569,858 (+) Ensembl panpan1.1 panPan2
ATP6V0A2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 26 5,911,319 - 5,952,773 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 26 5,912,887 - 5,952,306 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 26 6,074,169 - 6,115,619 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 26 6,161,361 - 6,202,794 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 26 6,162,010 - 6,229,946 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 26 6,094,884 - 6,136,318 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 26 6,187,243 - 6,228,453 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 26 6,140,432 - 6,181,874 (-) NCBI UU_Cfam_GSD_1.0
Atp6v0a2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 158,344,853 - 158,374,799 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936558 1,103,135 - 1,134,573 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936558 1,104,627 - 1,138,487 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ATP6V0A2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 29,250,405 - 29,297,683 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 29,250,400 - 29,297,697 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 30,944,213 - 30,989,982 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ATP6V0A2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 119,042,465 - 119,095,380 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 119,042,525 - 119,097,450 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 126,179,187 - 126,233,498 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Atp6v0a2
.
Predicted Target Of
Count of predictions: 255 Count of miRNA genes: 160 Interacting mature miRNAs: 183 Transcripts: ENSRNOT00000001349, ENSRNOT00000049316, ENSRNOT00000057966 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631560 Apr1 Acute phase response QTL 1 6.1 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 19144362 46669029 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 8693635 Alc28 Alcohol consumption QTL 28 2.7 0.439 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 12 23081340 44726024 Rat 61324 Eae5 Experimental allergic encephalomyelitis QTL 5 14 nervous system integrity trait (VT:0010566) percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402) 12 19610870 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 737822 Alc10 Alcohol consumption QTL 10 2.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 12 19610870 40218516 Rat 2293684 Bmd26 Bone mineral density QTL 26 4.4 0.0002 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 12 15872653 32974238 Rat 70169 Eae13 Experimental allergic encephalomyelitis QTL 13 0.032 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 12 24139202 36638073 Rat 1600386 Calcic2 Intracellular calcium level QTL 2 0.001 platelet physiology trait (VT:0005464) platelet intracellular calcium level (CMO:0000922) 12 28064433 46669029 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 1556747 Calcic1 Intracellular calcium level QTL 1 3.6 platelet calcium amount (VT:0010500) platelet intracellular calcium level (CMO:0000922) 12 28064433 40130419 Rat 631829 Alc6 Alcohol consumption QTL 6 4.7 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 12 28607526 37691617 Rat 8693658 Alc33 Alcohol consumption QTL 33 2.1 0.68 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 12 23081340 43551788 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 1300157 Rf21 Renal function QTL 21 4.4 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 12 9318216 32103380 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 1298081 Cia25 Collagen induced arthritis QTL 25 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610889 35682913 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 70213 Niddm27 Non-insulin dependent diabetes mellitus QTL 27 3.72 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 19835789 38193007 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 7411643 Foco20 Food consumption QTL 20 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 20328819 46669029 Rat 5684888 Pia42 Pristane induced arthritis QTL 42 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610870 42828880 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 1300175 Cm5 Cardiac mass QTL 5 3.78 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 12 28064433 45899022 Rat 1331787 Rf41 Renal function QTL 41 2.998 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 12 28064557 40218380 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 61421 Cia12 Collagen induced arthritis QTL 12 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 13635523 35682913 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 631543 Bp83 Blood pressure QTL 83 5.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 15550826 38478808 Rat
BF395959
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 31,986,499 - 31,986,623 (+) MAPPER mRatBN7.2 Rnor_6.0 12 37,404,956 - 37,405,079 NCBI Rnor6.0 Rnor_5.0 12 39,276,021 - 39,276,144 UniSTS Rnor5.0 RGSC_v3.4 12 33,099,144 - 33,099,267 UniSTS RGSC3.4 Celera 12 33,676,746 - 33,676,869 UniSTS RH 3.4 Map 12 550.9 UniSTS Cytogenetic Map 12 q15 UniSTS
RH141592
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 31,947,277 - 31,947,462 (+) MAPPER mRatBN7.2 Rnor_6.0 12 37,365,736 - 37,365,920 NCBI Rnor6.0 Rnor_5.0 12 39,235,838 - 39,236,022 UniSTS Rnor5.0 RGSC_v3.4 12 33,059,026 - 33,059,210 UniSTS RGSC3.4 Celera 12 33,637,126 - 33,637,310 UniSTS RH 3.4 Map 12 558.8 UniSTS Cytogenetic Map 12 q15 UniSTS
BE110564
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 31,949,576 - 31,949,736 (+) MAPPER mRatBN7.2 Rnor_6.0 12 37,368,035 - 37,368,194 NCBI Rnor6.0 Rnor_5.0 12 39,238,137 - 39,238,296 UniSTS Rnor5.0 RGSC_v3.4 12 33,061,325 - 33,061,484 UniSTS RGSC3.4 Celera 12 33,639,425 - 33,639,584 UniSTS RH 3.4 Map 12 568.11 UniSTS Cytogenetic Map 12 q15 UniSTS
RH141862
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 31,949,162 - 31,949,361 (+) MAPPER mRatBN7.2 Rnor_6.0 12 37,367,621 - 37,367,819 NCBI Rnor6.0 Rnor_5.0 12 39,237,723 - 39,237,921 UniSTS Rnor5.0 RGSC_v3.4 12 33,060,911 - 33,061,109 UniSTS RGSC3.4 Celera 12 33,639,011 - 33,639,209 UniSTS RH 3.4 Map 12 565.9 UniSTS Cytogenetic Map 12 q15 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
3
11
43
82
57
60
41
19
41
160
73
74
35
41
19
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000083401 ⟹ ENSRNOP00000068905
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 31,949,022 - 31,979,862 (-) Ensembl Rnor_6.0 Ensembl 12 37,367,474 - 37,398,329 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000084553 ⟹ ENSRNOP00000072568
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 31,982,730 - 32,007,050 (-) Ensembl Rnor_6.0 Ensembl 12 37,401,186 - 37,425,596 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000087698 ⟹ ENSRNOP00000073487
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 31,946,465 - 32,007,069 (-) Ensembl Rnor_6.0 Ensembl 12 37,363,906 - 37,411,525 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106066 ⟹ ENSRNOP00000084529
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 31,823,454 - 31,993,069 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106704 ⟹ ENSRNOP00000097523
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 31,822,733 - 31,993,069 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000108577 ⟹ ENSRNOP00000095339
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 31,822,880 - 32,007,069 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000110165 ⟹ ENSRNOP00000093343
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 31,982,730 - 32,007,050 (-) Ensembl
RefSeq Acc Id:
NM_053775 ⟹ NP_446227
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 37,608,211 - 37,640,860 (-) NCBI mRatBN7.2 12 31,947,220 - 31,979,875 (-) NCBI Rnor_6.0 12 37,368,321 - 37,398,233 (-) NCBI Rnor_5.0 12 39,238,423 - 39,269,298 (-) NCBI RGSC_v3.4 12 33,061,611 - 33,092,421 (-) RGD Celera 12 33,639,711 - 33,670,024 (-) RGD
Sequence:
ATGGGCTCCCTCTTCCGTAGCGAGAGCATGTGCCTGGCGCAGCTCTTCCTGCAGTCGGGCACGGCCTACGAGTGTCTGAGCGCGCTTGGCGAGAAGGGCCTGGTGCAGTTCCGAGACCTCAACCAAAA
hide sequence
RefSeq Acc Id:
NP_446227 ⟸ NM_053775
- UniProtKB:
Q2I6B1 (UniProtKB/TrEMBL), F1LQ38 (UniProtKB/TrEMBL)
- Sequence:
MGSLFRSESMCLAQLFLQSGTAYECLSALGEKGLVQFRDLNQNVSSFQRKFVGEVKRCEELERILVYLVQEITRADIPLPEGEASPPAPPVKHVLEMQEQLQKLEVELREVTKNKEKLRKNLLELVEY
hide sequence
Ensembl Acc Id:
ENSRNOP00000072568 ⟸ ENSRNOT00000084553
Ensembl Acc Id:
ENSRNOP00000073487 ⟸ ENSRNOT00000087698
Ensembl Acc Id:
ENSRNOP00000068905 ⟸ ENSRNOT00000083401
Ensembl Acc Id:
ENSRNOP00000095339 ⟸ ENSRNOT00000108577
Ensembl Acc Id:
ENSRNOP00000093343 ⟸ ENSRNOT00000110165
Ensembl Acc Id:
ENSRNOP00000084529 ⟸ ENSRNOT00000106066
Ensembl Acc Id:
ENSRNOP00000097523 ⟸ ENSRNOT00000106704
RGD ID: 13698605 Promoter ID: EPDNEW_R9129 Type: multiple initiation site Name: Tctn2_1 Description: tectonic family member 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R9130 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 37,398,331 - 37,398,391 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-17
Atp6v0a2
ATPase H+ transporting V0 subunit a2
Atp6v0a2
ATPase, H+ transporting, lysosomal V0 subunit A2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-22
Atp6v0a2
ATPase, H+ transporting, lysosomal V0 subunit A2
Atp6v0a2
ATPase, H+ transporting, lysosomal V0 subunit a isoform 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-11-29
Atp6v0a2
ATPase, H+ transporting, lysosomal V0 subunit a isoform 2
Atp6v0a2_predicted
ATPase, H+ transporting, lysosomal V0 subunit a isoform 2 (predicted)
Data merged from RGD:1310125
737654 APPROVED
2005-07-08
Atp6v0a2
ATPase, H+ transporting, lysosomal V0 subunit a isoform 2
Tj6
T-cell expressing clone j6
Symbol and Name updated
1299863 APPROVED
2005-01-12
Atp6v0a2_predicted
ATPase, H+ transporting, lysosomal V0 subunit a isoform 2 (predicted)
Symbol and Name status set to approved
70820 APPROVED
2002-08-07
Tj6
T-cell expressing clone j6
Symbol and Name status set to provisional
70820 PROVISIONAL
