Symbol:
Ednrb
Name:
endothelin receptor type B
RGD ID:
2536
Description:
Enables endothelin receptor activity and type 1 angiotensin receptor binding activity. Involved in several processes, including blood vessel diameter maintenance; cGMP-mediated signaling; and positive regulation of penile erection. Located in nuclear membrane. Used to study several diseases, including artery disease (multiple); lymphopenia; megacolon (multiple); portal hypertension; and type 2 diabetes mellitus. Biomarker of asthma; hepatopulmonary syndrome; and hypertension. Human ortholog(s) of this gene implicated in ABCD syndrome; Hirschsprung's disease; Waardenburg syndrome; Waardenburg syndrome type 4A; and asthma. Orthologous to human EDNRB (endothelin receptor type B); PARTICIPATES IN calcium/calmodulin dependent kinase signaling pathway; endothelin signaling pathway; inflammatory response pathway; INTERACTS WITH (R)-noradrenaline; (S)-colchicine; (S)-nicotine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Ednra; endothelin B receptor; endothelin receptor; endothelin receptor non-selective type; endothelin-B receptor; ET-B; ET-BR; Etb
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Allele / Splice:
Ednrbsl
Genetic Models:
F344.AR-Ednrbsl /Hkv ;
AR-Ednrbsl /Hkv ;
LEH/Hkv ;
LE.AR-Ednrbsl /Okkm ;
AR-Ednrbsl /Okkm
Is Marker For:
Strains:
DA
Sl
LE.AR-Ednrbsl /Okkm
AR-Ednrbsl /Okkm
SI-Tg(Ednrb)Ywa QTLs:
Scl1
BpQTLcluster12
Bp126
Gluco31
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 87,055,490 - 87,086,765 (-) NCBI GRCr8 mRatBN7.2 15 80,640,839 - 80,672,115 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 80,643,043 - 80,672,115 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 84,622,892 - 84,651,923 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 85,745,953 - 85,774,986 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 82,673,598 - 82,702,629 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 88,004,775 - 88,036,354 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 88,006,977 - 88,036,354 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 91,500,400 - 91,531,979 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 87,893,141 - 87,898,700 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 87,908,924 - 87,914,471 (-) NCBI Celera 15 79,772,740 - 79,801,760 (-) NCBI Celera RH 3.4 Map 15 496.21 RGD Cytogenetic Map 15 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Ednrb Rat ABCD syndrome ISO RGD:736090 8554872 ClinVar Annotator: match by term: ABCD syndrome ClinVar PMID:10528251|PMID:11891690|PMID:20127975|PMID:24033266|PMID:25741868|PMID:26100139|PMID:26467025|PMID:28492532|PMID:30394532|PMID:7778600|PMID:8001159 Ednrb Rat autosomal recessive nonsyndromic deafness ISO RGD:736090 8554872 ClinVar Annotator: match by term: Autosomal recessive nonsyndromic deafness ClinVar PMID:14633923|PMID:16944573|PMID:17554617|PMID:18162831|PMID:20127975|PMID:25741868|PMID:29106856|PMID:30303587|PMID:30936914|PMID:31240788|PMID:32747562|PMID:33095980|PMID:35790984 Ednrb Rat chromosome 13q14 deletion syndrome ISO RGD:736090 8554872 ClinVar Annotator: match by term: Chromosome 13q14 deletion syndrome ClinVar Ednrb Rat genetic disease ISO RGD:736090 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:14633923|PMID:16944573|PMID:17554617|PMID:18162831|PMID:20127975|PMID:24033266|PMID:25741868|PMID:28492532|PMID:29106856|PMID:30303587|PMID:30936914|PMID:31240788|PMID:32747562|PMID:33095980|PMID:35790984 Ednrb Rat Hearing Loss ISO RGD:736090 8554872 ClinVar Annotator: match by term: Hearing impairment | ClinVar Annotator: match by term: Nonsyndromic Hearing more ... ClinVar PMID:14633923|PMID:16944573|PMID:17554617|PMID:18162831|PMID:20127975|PMID:25741868|PMID:29106856|PMID:30303587|PMID:30311386|PMID:30936914|PMID:31240788|PMID:32747562|PMID:33095980|PMID:35790984 Ednrb Rat Hirschsprung's disease ISO RGD:736090 8554872 ClinVar Annotator: match by term: Hirschsprung Disease, Recessive | ClinVar Annotator: match by term: Hirschsprung more ... ClinVar PMID:10090908|PMID:10458491|PMID:10528251|PMID:10664228|PMID:10874640|PMID:12628594|PMID:14633923|PMID:16145050|PMID:16199547|PMID:16518596|PMID:16944573|PMID:16954478|PMID:17011274|PMID:17223014|PMID:17554617|PMID:17618893|PMID:18162831|PMID:18633623|PMID:18758497|PMID:19320733|PMID:20009762|PMID:20127975|PMID:21507037|PMID:22993632|PMID:22995991|PMID:24033266|PMID:24311220|PMID:25741868|PMID:26467025|PMID:27535533|PMID:27639823|PMID:28236341|PMID:28492532|PMID:29106856|PMID:29407415|PMID:30218169|PMID:30303587|PMID:30394532|PMID:30936914|PMID:31240788|PMID:32747562|PMID:33095980|PMID:34422713|PMID:35790984|PMID:8001158|PMID:8001159|PMID:8852658|PMID:8852659|PMID:8852660|PMID:9760196 Ednrb Rat mitochondrial DNA depletion syndrome 12a ISO RGD:736090 8554872 ClinVar Annotator: match by term: Mitochondrial DNA depletion syndrome 12A (cardiomyopathic type), autosomal dominant ClinVar PMID:10090908|PMID:10874640|PMID:16145050|PMID:16954478|PMID:19320733|PMID:20009762|PMID:21507037|PMID:22993632|PMID:22995991|PMID:24033266|PMID:25741868|PMID:26467025|PMID:27535533|PMID:28492532|PMID:29407415|PMID:8852659 Ednrb Rat neuronal ceroid lipofuscinosis ISO RGD:736090 8554872 ClinVar Annotator: match by term: Neuronal ceroid lipofuscinosis ClinVar PMID:10528251|PMID:20127975|PMID:20157158|PMID:22589734|PMID:28492532|PMID:30394532|PMID:31406620|PMID:32393339|PMID:8001159 Ednrb Rat Total Intestinal Aganglionosis ISO RGD:736090 8554872 ClinVar Annotator: match by term: Aganglionosis, total intestinal ClinVar PMID:14633923|PMID:16944573|PMID:17554617|PMID:18162831|PMID:20127975|PMID:25741868|PMID:29106856|PMID:30303587|PMID:30936914|PMID:31240788|PMID:32747562|PMID:33095980|PMID:35790984 Ednrb Rat Van der Hoeve Halbertsma Waardenburg Gualdi Syndrome ISO RGD:736090 8554872 ClinVar Annotator: match by term: Mende Syndrome ClinVar PMID:25741868|PMID:30311386 Ednrb Rat Waardenburg syndrome ISO RGD:736090 8554872 ClinVar Annotator: match by term: Waardenburg syndrome ClinVar PMID:24033266|PMID:25741868|PMID:28492532|PMID:30311386 Ednrb Rat Waardenburg syndrome type 2A ISO RGD:736090 8554872 ClinVar Annotator: match by term: Waardenburg syndrome type 2A ClinVar PMID:10090908|PMID:10874640|PMID:16145050|PMID:16954478|PMID:19320733|PMID:20009762|PMID:21507037|PMID:22993632|PMID:22995991|PMID:24033266|PMID:25741868|PMID:26467025|PMID:27535533|PMID:28492532|PMID:29407415|PMID:8852659 Ednrb Rat Waardenburg Syndrome Type 4 ISO RGD:736090 8554872 ClinVar Annotator: match by term: Hirschsprung disease with pigmentary anomaly ClinVar PMID:14633923|PMID:16944573|PMID:17554617|PMID:18162831|PMID:20127975|PMID:25741868|PMID:29106856|PMID:30303587|PMID:30311386|PMID:30936914|PMID:31240788|PMID:32747562|PMID:33095980|PMID:35790984 Ednrb Rat Waardenburg syndrome type 4A ISO RGD:736090 8554872 ClinVar Annotator: match by term: Waardenburg syndrome type 4A ClinVar PMID:10090908|PMID:10458491|PMID:10528251|PMID:10664228|PMID:10874640|PMID:11891690|PMID:14633923|PMID:16145050|PMID:16944573|PMID:16954478|PMID:17011274|PMID:17554617|PMID:18162831|PMID:19320733|PMID:20009762|PMID:20127975|PMID:21507037|PMID:22993632|PMID:22995991|PMID:24033266|PMID:24311220|PMID:25741868|PMID:26467025|PMID:27535533|PMID:28236341|PMID:28492532|PMID:29106856|PMID:29407415|PMID:30303587|PMID:30311386|PMID:30394532|PMID:30936914|PMID:31240788|PMID:32747562|PMID:33095980|PMID:35790984|PMID:7778600|PMID:8001158|PMID:8001159|PMID:8634719|PMID:8852659|PMID:8852660
Only show annotations with direct experimental evidence (0 objects hidden)
Ednrb Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:736090 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of EDNRB mRNA CTD PMID:22079256 Ednrb Rat (R)-noradrenaline multiple interactions EXP 6480464 [EDN1 protein binds to and results in increased activity of EDNRB protein] which results in more ... CTD PMID:16023617 Ednrb Rat (S)-colchicine increases expression EXP 6480464 Colchicine results in increased expression of EDNRB mRNA CTD PMID:20624997 Ednrb Rat (S)-nicotine increases activity EXP 6480464 Nicotine results in increased activity of EDNRB protein CTD PMID:21316381 Ednrb Rat 1,2-dimethylhydrazine decreases expression ISO RGD:10505 6480464 1,2-Dimethylhydrazine results in decreased expression of EDNRB mRNA CTD PMID:22206623 Ednrb Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:736090 6480464 [Ethinyl Estradiol co-treated with Cholic Acids] affects the expression of EDNRB mRNA CTD PMID:27344345 Ednrb Rat 17beta-estradiol multiple interactions ISO RGD:736090 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of EDNRB mRNA CTD PMID:20660070 Ednrb Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of EDNRB mRNA CTD PMID:32145629 Ednrb Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:736090 6480464 Tetrachlorodibenzodioxin results in decreased expression of EDNRB mRNA CTD PMID:20106945 Ednrb Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of EDNRB mRNA CTD PMID:34747641 Ednrb Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:736090 6480464 Tetrachlorodibenzodioxin results in increased expression of EDNRB mRNA CTD PMID:25445724 Ednrb Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:736090 6480464 AHR gene SNP affects the reaction [Tetrachlorodibenzodioxin results in increased expression of EDNRB mRNA] CTD PMID:25445724 Ednrb Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:736090 6480464 Tetrachlorodibenzodioxin affects the expression of EDNRB mRNA CTD PMID:22298810 Ednrb Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:10505 6480464 Tetrachlorodibenzodioxin results in increased expression of EDNRB mRNA CTD PMID:19465110 Ednrb Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:10505 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of EDNRB mRNA CTD PMID:38648751 Ednrb Rat 2-acetyl-1-alkyl-sn-glycero-3-phosphocholine multiple interactions EXP 6480464 EDNRB protein affects the reaction [Carbon Tetrachloride promotes the reaction [EDN1 protein results in increased more ... CTD PMID:18205269 Ednrb Rat 2-butoxyethanol increases expression ISO RGD:10505 6480464 n-butoxyethanol results in increased expression of EDNRB mRNA CTD PMID:19812364 Ednrb Rat 2-hydroxypropanoic acid decreases expression ISO RGD:736090 6480464 Lactic Acid results in decreased expression of EDNRB mRNA CTD PMID:30851411 Ednrb Rat 2-palmitoylglycerol increases expression ISO RGD:736090 6480464 2-palmitoylglycerol results in increased expression of EDNRB mRNA CTD PMID:37199045 Ednrb Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine multiple interactions EXP 6480464 Methylprednisolone inhibits the reaction [Puromycin Aminonucleoside results in increased expression of EDNRB mRNA] CTD PMID:7756592 Ednrb Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine increases expression EXP 6480464 Puromycin Aminonucleoside results in increased expression of EDNRB mRNA CTD PMID:7756592 Ednrb Rat 3,4-methylenedioxymethamphetamine decreases expression ISO RGD:10505 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of EDNRB mRNA CTD PMID:26251327 Ednrb Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of EDNRB mRNA CTD PMID:30071829 Ednrb Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions EXP 6480464 bisindolylmaleimide I inhibits the reaction [[EDN1 protein binds to and results in increased activity of more ... CTD PMID:15245872 Ednrb Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:736090 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Ednrb Rat 3H-1,2-dithiole-3-thione decreases expression EXP 6480464 1,2-dithiol-3-thione results in decreased expression of EDNRB mRNA CTD PMID:19162173 Ednrb Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:10505 6480464 bisphenol S results in increased expression of EDNRB mRNA CTD PMID:39298647 Ednrb Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:736090 6480464 bisphenol S affects the methylation of EDNRB gene CTD PMID:31601247 Ednrb Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:10505 6480464 Fenretinide results in increased expression of EDNRB mRNA CTD PMID:28973697 Ednrb Rat 5-fluorouracil decreases expression ISO RGD:736090 6480464 Fluorouracil results in decreased expression of EDNRB mRNA CTD PMID:24737281 Ednrb Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of EDNRB mRNA CTD PMID:24780913 Ednrb Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of EDNRB mRNA CTD PMID:30047161 Ednrb Rat 6alpha-methylprednisolone multiple interactions EXP 6480464 Methylprednisolone inhibits the reaction [Puromycin Aminonucleoside results in increased expression of EDNRB mRNA] CTD PMID:7756592 Ednrb Rat 7,12-dimethyltetraphene decreases expression EXP 6480464 9,10-Dimethyl-1,2-benzanthracene results in decreased expression of EDNRB mRNA CTD PMID:19480007 Ednrb Rat 7-nitroindazole multiple interactions EXP 6480464 7-nitroindazole inhibits the reaction [[EDN1 protein binds to and results in increased activity of EDNRB more ... CTD PMID:15245872 Ednrb Rat 8-bromo-3',5'-cyclic GMP multiple interactions EXP 6480464 8-bromocyclic GMP inhibits the reaction [[EDN1 protein binds to and results in increased activity of more ... CTD PMID:16023617 Ednrb Rat acadesine multiple interactions EXP 6480464 acadesine inhibits the reaction [Smoke results in increased expression of EDNRB protein] CTD PMID:36183783 Ednrb Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of EDNRB mRNA CTD PMID:31881176 Ednrb Rat acetylsalicylic acid multiple interactions ISO RGD:736090 6480464 Aspirin inhibits the reaction [IL1B results in increased activity of EDNRB] CTD PMID:12126971 Ednrb Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of EDNRB mRNA CTD PMID:28959563 Ednrb Rat acrylamide decreases expression ISO RGD:736090 6480464 Acrylamide results in decreased expression of EDNRB mRNA CTD PMID:32763439 Ednrb Rat actinomycin D multiple interactions EXP 6480464 Dactinomycin inhibits the reaction [Cyclosporine results in increased expression of EDNRB mRNA]; Dactinomycin inhibits the more ... CTD PMID:20561571|PMID:20716444|PMID:22207076|PMID:25772258 Ednrb Rat all-trans-retinoic acid decreases expression ISO RGD:736090 6480464 Tretinoin results in decreased expression of EDNRB mRNA CTD PMID:21934132 Ednrb Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of EDNRB mRNA CTD PMID:35163327 Ednrb Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of EDNRB mRNA CTD PMID:30047161 Ednrb Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of EDNRB mRNA CTD PMID:16483693 Ednrb Rat amphotericin B increases expression ISO RGD:736090 6480464 Amphotericin B results in increased expression of EDNRB mRNA CTD PMID:20849824 Ednrb Rat angiotensin II increases expression EXP 6480464 Angiotensin II results in increased expression of EDNRB protein CTD PMID:15007106 Ednrb Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions EXP 6480464 pyrazolanthrone inhibits the reaction [Dimethyl Sulfoxide results in increased expression of EDNRB mRNA]; pyrazolanthrone inhibits more ... CTD PMID:20561571|PMID:20716444|PMID:26496744 Ednrb Rat arsane decreases expression ISO RGD:10505 6480464 Arsenic results in decreased expression of EDNRB mRNA CTD PMID:19654921 Ednrb Rat arsenic atom decreases expression ISO RGD:10505 6480464 Arsenic results in decreased expression of EDNRB mRNA CTD PMID:19654921 Ednrb Rat arsenous acid decreases expression ISO RGD:736090 6480464 Arsenic Trioxide results in decreased expression of EDNRB mRNA CTD PMID:26705709 Ednrb Rat arsenous acid increases expression ISO RGD:736090 6480464 Arsenic Trioxide results in increased expression of EDNRB mRNA alternative form CTD PMID:19128835 Ednrb Rat atrasentan multiple interactions EXP 6480464 Atrasentan inhibits the reaction [[19-oxo-11-deoxycorticosterone acetate co-treated with Potassium Chloride co-treated with Sodium Chloride] results more ... CTD PMID:18823320|PMID:34102242 Ednrb Rat belinostat multiple interactions ISO RGD:736090 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Ednrb Rat belinostat increases expression ISO RGD:736090 6480464 belinostat results in increased expression of EDNRB mRNA CTD PMID:26272509 Ednrb Rat benzo[a]pyrene decreases expression ISO RGD:10505 6480464 Benzo(a)pyrene results in decreased expression of EDNRB mRNA CTD PMID:22228805|PMID:22610609 Ednrb Rat benzo[a]pyrene affects methylation ISO RGD:736090 6480464 Benzo(a)pyrene affects the methylation of EDNRB 5' UTR; Benzo(a)pyrene affects the methylation of EDNRB promoter CTD PMID:27901495 Ednrb Rat benzo[a]pyrene increases methylation ISO RGD:736090 6480464 Benzo(a)pyrene results in increased methylation of EDNRB exon CTD PMID:27901495 Ednrb Rat benzo[a]pyrene multiple interactions ISO RGD:10505 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of more ... CTD PMID:27858113 Ednrb Rat benzo[a]pyrene increases expression ISO RGD:10505 6480464 Benzo(a)pyrene results in increased expression of EDNRB mRNA CTD PMID:19770486|PMID:21964900|PMID:32417428 Ednrb Rat benzo[a]pyrene diol epoxide I affects expression ISO RGD:736090 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide affects the expression of EDNRB mRNA CTD PMID:20382639 Ednrb Rat benzo[b]fluoranthene decreases expression ISO RGD:10505 6480464 benzo(b)fluoranthene results in decreased expression of EDNRB mRNA CTD PMID:26377693 Ednrb Rat benzo[b]fluoranthene multiple interactions ISO RGD:10505 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of more ... CTD PMID:27858113 Ednrb Rat bexarotene increases expression EXP 6480464 bexarotene results in increased expression of EDNRB mRNA CTD PMID:16648578 Ednrb Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of EDNRB mRNA CTD PMID:20920545 Ednrb Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of EDNRB mRNA CTD PMID:25181051 Ednrb Rat bisphenol A increases expression ISO RGD:10505 6480464 bisphenol A results in increased expression of EDNRB mRNA CTD PMID:33221593 Ednrb Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of EDNRB mRNA CTD PMID:30816183|PMID:32145629|PMID:34947998|PMID:35378123|PMID:38750585 Ednrb Rat bisphenol A multiple interactions ISO RGD:736090 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of EDNRB gene; [INS protein co-treated more ... CTD PMID:28628672|PMID:31601247 Ednrb Rat bisphenol A increases methylation ISO RGD:736090 6480464 bisphenol A results in increased methylation of EDNRB gene; bisphenol A results in increased methylation more ... CTD PMID:27271280|PMID:31601247 Ednrb Rat bisphenol F decreases expression ISO RGD:10505 6480464 bisphenol F results in decreased expression of EDNRB mRNA CTD PMID:30951980 Ednrb Rat bosentan multiple interactions ISO RGD:736090 6480464 bosentan binds to and results in decreased activity of EDNRB protein CTD PMID:16219361 Ednrb Rat cadmium atom multiple interactions ISO RGD:736090 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of EDNRB more ... CTD PMID:35301059 Ednrb Rat cadmium dichloride multiple interactions ISO RGD:736090 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of EDNRB more ... CTD PMID:35301059 Ednrb Rat calcitriol increases expression ISO RGD:10505 6480464 Calcitriol results in increased expression of EDNRB mRNA CTD PMID:12230499 Ednrb Rat carbon nanotube affects expression ISO RGD:10505 6480464 Nanotubes, Carbon affects the expression of EDNRB mRNA CTD PMID:23845593 Ednrb Rat carbon nanotube decreases expression ISO RGD:10505 6480464 Nanotubes, Carbon analog results in decreased expression of EDNRB mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681|PMID:25620056 Ednrb Rat celecoxib multiple interactions EXP 6480464 Celecoxib inhibits the reaction [BQ 788 results in decreased expression of EDNRB protein]; Celecoxib inhibits more ... CTD PMID:24462674|PMID:25656942 Ednrb Rat CGP 52608 multiple interactions ISO RGD:736090 6480464 CGP 52608 promotes the reaction [RORA protein binds to EDNRB gene] CTD PMID:28238834 Ednrb Rat CGS-21680 multiple interactions ISO RGD:10505 6480464 [Phosphorus, Dietary co-treated with Cisplatin co-treated with 2-(4-(2-carboxyethyl)phenethylamino)-5'-N-ethylcarboxamidoadenosine] results in increased expression of EDNRB protein CTD PMID:39332792 Ednrb Rat chlorambucil increases mutagenesis ISO RGD:10505 6480464 Chlorambucil results in increased mutagenesis of EDNRB gene CTD PMID:10517996 Ednrb Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of EDNRB mRNA CTD PMID:23125180 Ednrb Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of EDNRB mRNA CTD PMID:20691718 Ednrb Rat choline multiple interactions ISO RGD:10505 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Ednrb Rat chromium atom multiple interactions ISO RGD:10505 6480464 LEPR gene mutant form promotes the reaction [[Niacin binds to Chromium] which results in increased more ... CTD PMID:16940432 Ednrb Rat chrysene multiple interactions ISO RGD:10505 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of more ... CTD PMID:27858113 Ednrb Rat cisplatin increases expression ISO RGD:736090 6480464 Cisplatin results in increased expression of EDNRB mRNA CTD PMID:20849824 Ednrb Rat cisplatin multiple interactions ISO RGD:10505 6480464 [Phosphorus, Dietary co-treated with Cisplatin co-treated with 2-(4-(2-carboxyethyl)phenethylamino)-5'-N-ethylcarboxamidoadenosine] results in increased expression of EDNRB protein CTD PMID:39332792 Ednrb Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of EDNRB mRNA CTD PMID:20187946 Ednrb Rat copper atom increases expression EXP 6480464 Copper results in increased expression of EDNRB mRNA CTD PMID:30556269 Ednrb Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of EDNRB mRNA CTD PMID:30556269 Ednrb Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of EDNRB mRNA CTD PMID:26577399|PMID:27523638 Ednrb Rat cycloheximide multiple interactions EXP 6480464 Cycloheximide inhibits the reaction [Dimethyl Sulfoxide results in increased expression of EDNRB mRNA]; Cycloheximide inhibits more ... CTD PMID:20561571|PMID:20716444 Ednrb Rat cyclophosphamide increases expression ISO RGD:736090 6480464 Cyclophosphamide results in increased expression of EDNRB mRNA CTD PMID:20849824 Ednrb Rat cyclosporin A multiple interactions EXP 6480464 3-(4-methylphenylsulfonyl)-2-propenenitrile inhibits the reaction [Cyclosporine results in increased expression of EDNRB mRNA]; 3-(4-methylphenylsulfonyl)-2-propenenitrile inhibits the more ... CTD PMID:24462674|PMID:25656942|PMID:25772258 Ednrb Rat cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of EDNRB protein CTD PMID:24462674|PMID:25656942 Ednrb Rat cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of EDNRB mRNA; Cyclosporine results in increased expression of EDNRB more ... CTD PMID:25772258 Ednrb Rat daunorubicin increases expression EXP 6480464 Daunorubicin results in increased expression of EDNRB protein CTD PMID:20888384 Ednrb Rat daunorubicin multiple interactions EXP 6480464 telmisartan promotes the reaction [Daunorubicin results in increased expression of EDNRB protein] CTD PMID:20888384 Ednrb Rat Deoxycorticosterone acetate multiple interactions EXP 6480464 [Desoxycorticosterone Acetate co-treated with Sodium Chloride] results in decreased expression of EDNRB mRNA; [Ozone co-treated more ... CTD PMID:26550192 Ednrb Rat dexamethasone multiple interactions EXP 6480464 Dexamethasone promotes the reaction [nitrofen results in increased expression of EDNRB mRNA] CTD PMID:10693666 Ednrb Rat dexamethasone multiple interactions ISO RGD:736090 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Ednrb Rat diarsenic trioxide decreases expression ISO RGD:736090 6480464 Arsenic Trioxide results in decreased expression of EDNRB mRNA CTD PMID:26705709 Ednrb Rat diarsenic trioxide increases expression ISO RGD:736090 6480464 Arsenic Trioxide results in increased expression of EDNRB mRNA alternative form CTD PMID:19128835 Ednrb Rat dibenz[a,h]anthracene decreases expression ISO RGD:10505 6480464 1,2,5,6-dibenzanthracene results in decreased expression of EDNRB mRNA CTD PMID:26377693 Ednrb Rat dibutyl phthalate increases expression ISO RGD:10505 6480464 Dibutyl Phthalate results in increased expression of EDNRB mRNA CTD PMID:17361019|PMID:21266533 Ednrb Rat dimethyl sulfoxide increases expression EXP 6480464 Dimethyl Sulfoxide results in increased expression of EDNRB mRNA; Dimethyl Sulfoxide results in increased expression more ... CTD PMID:20561571 Ednrb Rat dimethyl sulfoxide multiple interactions EXP 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [Dimethyl Sulfoxide results in increased expression of EDNRB mRNA]; 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits more ... CTD PMID:20561571 Ednrb Rat dioxygen increases expression ISO RGD:10505 6480464 Oxygen deficiency results in increased expression of EDNRB mRNA; Oxygen deficiency results in increased expression more ... CTD PMID:21926265|PMID:25203536 Ednrb Rat dioxygen decreases methylation EXP 6480464 Oxygen deficiency results in decreased methylation of EDNRB promoter CTD PMID:34478853 Ednrb Rat dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of EDNRB mRNA; Oxygen deficiency results in increased expression more ... CTD PMID:34478853 Ednrb Rat dioxygen decreases expression EXP 6480464 Oxygen deficiency results in decreased expression of EDNRB protein CTD PMID:28985491 Ednrb Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression more ... CTD PMID:26550192|PMID:28985491|PMID:33729688 Ednrb Rat dioxygen increases expression ISO RGD:736090 6480464 Oxygen deficiency results in increased expression of EDNRB mRNA CTD PMID:24236059 Ednrb Rat dioxygen multiple interactions ISO RGD:10505 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of EDNRB mRNA; Rosiglitazone more ... CTD PMID:21926265|PMID:30529165 Ednrb Rat dorsomorphin multiple interactions ISO RGD:736090 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Ednrb Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of EDNRB mRNA CTD PMID:29391264 Ednrb Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of EDNRB mRNA CTD PMID:31464424 Ednrb Rat enrasentan multiple interactions ISO RGD:736090 6480464 enrasentan binds to and results in decreased activity of EDNRB protein CTD PMID:16219361 Ednrb Rat entinostat multiple interactions ISO RGD:736090 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Ednrb Rat entinostat increases expression ISO RGD:736090 6480464 entinostat results in increased expression of EDNRB mRNA CTD PMID:26272509 Ednrb Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of EDNRB protein CTD PMID:16651399 Ednrb Rat ethanol increases expression ISO RGD:736090 6480464 Ethanol results in increased expression of EDNRB mRNA CTD PMID:31059573 Ednrb Rat ethanol increases expression ISO RGD:10505 6480464 Ethanol results in increased expression of EDNRB mRNA CTD PMID:30319688 Ednrb Rat etoposide decreases expression ISO RGD:10505 6480464 Etoposide results in decreased expression of EDNRB mRNA CTD PMID:25270620 Ednrb Rat fenoterol increases expression ISO RGD:736090 6480464 Fenoterol results in increased expression of EDNRB mRNA CTD PMID:16340002 Ednrb Rat fentanyl decreases expression EXP 6480464 Fentanyl results in decreased expression of EDNRB mRNA CTD PMID:36032789 Ednrb Rat folic acid multiple interactions ISO RGD:10505 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Ednrb Rat folic acid decreases expression ISO RGD:10505 6480464 Folic Acid results in decreased expression of EDNRB mRNA CTD PMID:25629700 Ednrb Rat fulvestrant multiple interactions ISO RGD:736090 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of EDNRB gene CTD PMID:31601247 Ednrb Rat gefitinib multiple interactions ISO RGD:10505 6480464 gefitinib inhibits the reaction [TGFA protein results in decreased expression of EDNRB mRNA] CTD PMID:18424623 Ednrb Rat genistein decreases expression ISO RGD:10505 6480464 Genistein results in decreased expression of EDNRB mRNA CTD PMID:32186404 Ednrb Rat gentamycin multiple interactions EXP 6480464 [Gentamicins results in increased expression of EDNRB protein] which results in increased abundance of Nitrites CTD PMID:15200423 Ednrb Rat gentamycin increases expression ISO RGD:736090 6480464 Gentamicins results in increased expression of EDNRB mRNA CTD PMID:20849824 Ednrb Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of EDNRB protein CTD PMID:15200423 Ednrb Rat hydrogen cyanide increases expression ISO RGD:10505 6480464 Hydrogen Cyanide results in increased expression of EDNRB mRNA CTD PMID:33914522 Ednrb Rat Ile(5)-angiotensin II increases expression EXP 6480464 Angiotensin II results in increased expression of EDNRB protein CTD PMID:15007106 Ednrb Rat indometacin multiple interactions ISO RGD:736090 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:12126971|PMID:28628672 Ednrb Rat inulin multiple interactions ISO RGD:10505 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of EDNRB mRNA CTD PMID:36331819 Ednrb Rat isoprenaline multiple interactions EXP 6480464 CPU0213 inhibits the reaction [Isoproterenol results in increased expression of EDNRB mRNA]; natakalim inhibits the more ... CTD PMID:18594475|PMID:27174236 Ednrb Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of EDNRB mRNA; Isoproterenol results in increased expression of EDNRB more ... CTD PMID:18594475|PMID:27174236 Ednrb Rat isoquinoline-1,5-diol decreases expression EXP 6480464 1,5-dihydroxyisoquinoline results in decreased expression of EDNRB mRNA CTD PMID:12824290 Ednrb Rat ketoconazole increases expression EXP 6480464 Ketoconazole results in increased expression of EDNRB mRNA CTD PMID:36653537 Ednrb Rat L-ascorbic acid increases expression ISO RGD:10505 6480464 Ascorbic Acid results in increased expression of EDNRB mRNA CTD PMID:15305145 Ednrb Rat L-methionine multiple interactions ISO RGD:10505 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Ednrb Rat lead diacetate increases expression ISO RGD:736090 6480464 lead acetate results in increased expression of EDNRB mRNA CTD PMID:22839698 Ednrb Rat malathion decreases expression ISO RGD:736090 6480464 Malathion results in decreased expression of EDNRB mRNA CTD PMID:37047231 Ednrb Rat mercury dibromide increases expression ISO RGD:736090 6480464 mercuric bromide results in increased expression of EDNRB mRNA CTD PMID:26272509 Ednrb Rat methotrexate affects expression ISO RGD:10505 6480464 Methotrexate affects the expression of EDNRB mRNA CTD PMID:18502557 Ednrb Rat methylmercury chloride increases expression ISO RGD:736090 6480464 methylmercuric chloride results in increased expression of EDNRB mRNA CTD PMID:34089799 Ednrb Rat methylseleninic acid increases expression ISO RGD:736090 6480464 methylselenic acid results in increased expression of EDNRB mRNA CTD PMID:18548127 Ednrb Rat mifepristone increases expression ISO RGD:736090 6480464 Mifepristone results in increased expression of EDNRB mRNA CTD PMID:17584828 Ednrb Rat MK-2206 multiple interactions ISO RGD:736090 6480464 MK 2206 inhibits the reaction [RARRES2 protein results in decreased expression of EDNRB protein modified more ... CTD PMID:34398343 Ednrb Rat MK-2206 increases expression ISO RGD:736090 6480464 MK 2206 results in increased expression of EDNRB protein CTD PMID:34398343 Ednrb Rat N(gamma)-nitro-L-arginine methyl ester decreases expression EXP 6480464 NG-Nitroarginine Methyl Ester results in decreased expression of EDNRB mRNA CTD PMID:34102242 Ednrb Rat N(gamma)-nitro-L-arginine methyl ester multiple interactions EXP 6480464 Atrasentan inhibits the reaction [NG-Nitroarginine Methyl Ester results in decreased expression of EDNRB mRNA] CTD PMID:34102242 Ednrb Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide multiple interactions EXP 6480464 N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide inhibits the reaction [[EDN1 protein binds to and results in increased activity of EDNRB more ... CTD PMID:15245872 Ednrb Rat N-[3,5-bis(trifluoromethyl)phenyl]-5-chloro-2-hydroxybenzamide multiple interactions EXP 6480464 N-(3,5-bis(trifluoromethyl)phenyl)-5-chloro-2-hydroxybenzamide inhibits the reaction [Smoke results in increased expression of EDNRB protein]; N-(3,5-bis(trifluoromethyl)phenyl)-5-chloro-2-hydroxybenzamide inhibits the more ... CTD PMID:18718921|PMID:22207076 Ednrb Rat N-ethyl-N-nitrosourea increases mutagenesis ISO RGD:10505 6480464 Ethylnitrosourea results in increased mutagenesis of EDNRB gene CTD PMID:17174358|PMID:9475716 Ednrb Rat N-methyl-N-nitrosourea increases mutagenesis ISO RGD:10505 6480464 Methylnitrosourea results in increased mutagenesis of EDNRB gene CTD PMID:17174358 Ednrb Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of EDNRB mRNA CTD PMID:19638242 Ednrb Rat nicotine increases activity EXP 6480464 Nicotine results in increased activity of EDNRB protein CTD PMID:21316381 Ednrb Rat nicotinic acid multiple interactions ISO RGD:10505 6480464 LEPR gene mutant form promotes the reaction [[Niacin binds to Chromium] which results in increased more ... CTD PMID:16940432 Ednrb Rat nimesulide multiple interactions ISO RGD:736090 6480464 nimesulide inhibits the reaction [IL1B results in increased activity of EDNRB] CTD PMID:12126971 Ednrb Rat nitric oxide multiple interactions EXP 6480464 [EDN1 protein results in increased activity of EDNRB protein] which results in increased abundance of more ... CTD PMID:16380457 Ednrb Rat nitrites multiple interactions EXP 6480464 [Gentamicins results in increased expression of EDNRB protein] which results in increased abundance of Nitrites CTD PMID:15200423 Ednrb Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of EDNRB mRNA; nitrofen results in increased expression of EDNRB more ... CTD PMID:10693666|PMID:19851775 Ednrb Rat nitrofen multiple interactions EXP 6480464 Dexamethasone promotes the reaction [nitrofen results in increased expression of EDNRB mRNA] CTD PMID:10693666 Ednrb Rat nitroprusside multiple interactions EXP 6480464 Nitroprusside inhibits the reaction [[EDN1 protein binds to and results in increased activity of EDNRB more ... CTD PMID:16023617 Ednrb Rat Nonylphenol increases expression EXP 6480464 nonylphenol results in increased expression of EDNRB mRNA CTD PMID:15620428 Ednrb Rat okadaic acid decreases expression ISO RGD:736090 6480464 Okadaic Acid results in decreased expression of EDNRB mRNA CTD PMID:38832940 Ednrb Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Oxygen] inhibits the reaction [[Desoxycorticosterone Acetate co-treated with Sodium Chloride] results in more ... CTD PMID:20980218|PMID:26550192 Ednrb Rat ozone multiple interactions ISO RGD:10505 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ... CTD PMID:27106289|PMID:34911549 Ednrb Rat ozone increases expression ISO RGD:10505 6480464 Ozone results in increased expression of EDNRB mRNA CTD PMID:31626304 Ednrb Rat ozone increases expression EXP 6480464 Ozone results in increased expression of EDNRB mRNA CTD PMID:16081523|PMID:20980218 Ednrb Rat panobinostat multiple interactions ISO RGD:736090 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Ednrb Rat panobinostat increases expression ISO RGD:736090 6480464 panobinostat results in increased expression of EDNRB mRNA CTD PMID:26272509 Ednrb Rat paracetamol affects expression ISO RGD:10505 6480464 Acetaminophen affects the expression of EDNRB mRNA CTD PMID:17562736 Ednrb Rat paracetamol decreases expression ISO RGD:736090 6480464 Acetaminophen results in decreased expression of EDNRB mRNA CTD PMID:29067470 Ednrb Rat paracetamol increases expression ISO RGD:736090 6480464 Acetaminophen results in increased expression of EDNRB mRNA CTD PMID:21420995 Ednrb Rat paricalcitol multiple interactions ISO RGD:736090 6480464 [Phosphorus co-treated with paricalcitol] affects the expression of EDNRB mRNA CTD PMID:17715259 Ednrb Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:10505 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of EDNRB mRNA CTD PMID:36331819 Ednrb Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of EDNRB mRNA CTD PMID:35163327 Ednrb Rat permethrin decreases expression ISO RGD:736090 6480464 Permethrin results in decreased expression of EDNRB mRNA CTD PMID:37047231 Ednrb Rat phenobarbital affects expression ISO RGD:10505 6480464 Phenobarbital affects the expression of EDNRB mRNA CTD PMID:23091169 Ednrb Rat phenylephrine increases expression EXP 6480464 Phenylephrine results in increased expression of EDNRB protein CTD PMID:15007106 Ednrb Rat phenylmercury acetate increases expression ISO RGD:736090 6480464 Phenylmercuric Acetate results in increased expression of EDNRB mRNA CTD PMID:26272509 Ednrb Rat phenylmercury acetate multiple interactions ISO RGD:736090 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Ednrb Rat phosphoramidon increases expression EXP 6480464 phosphoramidon results in increased expression of EDNRB protein CTD PMID:15007106 Ednrb Rat phosphorus atom multiple interactions ISO RGD:736090 6480464 [Phosphorus co-treated with paricalcitol] affects the expression of EDNRB mRNA CTD PMID:17715259 Ednrb Rat phosphorus(.) multiple interactions ISO RGD:736090 6480464 [Phosphorus co-treated with paricalcitol] affects the expression of EDNRB mRNA CTD PMID:17715259 Ednrb Rat picrotoxin decreases expression EXP 6480464 Picrotoxin results in decreased expression of EDNRB mRNA CTD PMID:15170462 Ednrb Rat pifithrin-alpha hydrobromide decreases expression ISO RGD:736090 6480464 pifithrin results in decreased expression of EDNRB mRNA CTD PMID:19098008 Ednrb Rat potassium chloride multiple interactions EXP 6480464 [19-oxo-11-deoxycorticosterone acetate co-treated with Potassium Chloride co-treated with Sodium Chloride] results in decreased expression of more ... CTD PMID:18823320 Ednrb Rat potassium chromate multiple interactions ISO RGD:736090 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of EDNRB mRNA CTD PMID:22079256 Ednrb Rat potassium chromate decreases expression ISO RGD:736090 6480464 potassium chromate(VI) results in decreased expression of EDNRB mRNA CTD PMID:22079256 Ednrb Rat potassium cyanide increases expression ISO RGD:10505 6480464 Potassium Cyanide results in increased expression of EDNRB mRNA CTD PMID:33914522 Ednrb Rat progesterone multiple interactions ISO RGD:736090 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of EDNRB mRNA CTD PMID:20660070 Ednrb Rat progesterone increases expression ISO RGD:736090 6480464 Progesterone results in increased expression of EDNRB mRNA CTD PMID:21540246 Ednrb Rat quercetin increases expression ISO RGD:736090 6480464 Quercetin results in increased expression of EDNRB mRNA CTD PMID:15309432 Ednrb Rat quercetin affects expression EXP 6480464 Quercetin affects the expression of EDNRB mRNA CTD PMID:18178720 Ednrb Rat rac-lactic acid decreases expression ISO RGD:736090 6480464 Lactic Acid results in decreased expression of EDNRB mRNA CTD PMID:30851411 Ednrb Rat resveratrol multiple interactions EXP 6480464 Resveratrol inhibits the reaction [Smoke results in increased expression of EDNRB protein]; Resveratrol inhibits the more ... CTD PMID:36183783 Ednrb Rat rofecoxib multiple interactions ISO RGD:736090 6480464 rofecoxib inhibits the reaction [IL1B results in increased activity of EDNRB] CTD PMID:12126971 Ednrb Rat SB 203580 multiple interactions EXP 6480464 SB 203580 inhibits the reaction [Cyclosporine results in increased expression of EDNRB mRNA]; SB 203580 more ... CTD PMID:18718921|PMID:20561571|PMID:25772258|PMID:26496744|PMID:36183783 Ednrb Rat SB 431542 multiple interactions ISO RGD:736090 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Ednrb Rat SB-239063 multiple interactions EXP 6480464 SB 239063 inhibits the reaction [Smoke results in increased expression of EDNRB mRNA]; SB 239063 more ... CTD PMID:18718921 Ednrb Rat serpentine asbestos increases methylation ISO RGD:736090 6480464 Asbestos, Serpentine results in increased methylation of EDNRB 5' UTR CTD PMID:29523930 Ednrb Rat sodium arsenite increases expression ISO RGD:10505 6480464 sodium arsenite results in increased expression of EDNRB mRNA CTD PMID:32068019 Ednrb Rat sodium arsenite increases expression ISO RGD:736090 6480464 sodium arsenite results in increased expression of EDNRB mRNA CTD PMID:20371982 Ednrb Rat sodium arsenite multiple interactions ISO RGD:736090 6480464 sodium arsenite inhibits the reaction [EDN1 protein results in increased expression of EDNRB] CTD PMID:28470405 Ednrb Rat sodium chloride multiple interactions EXP 6480464 [19-oxo-11-deoxycorticosterone acetate co-treated with Potassium Chloride co-treated with Sodium Chloride] results in decreased expression of more ... CTD PMID:18823320|PMID:26550192 Ednrb Rat sorafenib increases expression EXP 6480464 Sorafenib results in increased expression of EDNRB mRNA; Sorafenib results in increased expression of EDNRB more ... CTD PMID:33503445 Ednrb Rat staurosporine multiple interactions EXP 6480464 Staurosporine inhibits the reaction [Particulate Matter results in increased expression of EDNRB mRNA]; Staurosporine inhibits more ... CTD PMID:20561571 Ednrb Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of EDNRB mRNA CTD PMID:30047161 Ednrb Rat Tanshinone I multiple interactions EXP 6480464 tanshinone inhibits the reaction [Oxygen deficiency results in decreased expression of EDNRB protein] CTD PMID:28985491 Ednrb Rat telmisartan multiple interactions EXP 6480464 telmisartan promotes the reaction [Daunorubicin results in increased expression of EDNRB protein] CTD PMID:20888384 Ednrb Rat testosterone affects expression EXP 6480464 Testosterone affects the expression of EDNRB mRNA CTD PMID:12122504|PMID:14616470 Ednrb Rat testosterone enanthate affects expression ISO RGD:736090 6480464 testosterone enanthate affects the expression of EDNRB mRNA CTD PMID:17440010 Ednrb Rat tetrachloromethane decreases expression ISO RGD:10505 6480464 Carbon Tetrachloride results in decreased expression of EDNRB mRNA CTD PMID:17484886 Ednrb Rat tetrachloromethane increases expression ISO RGD:10505 6480464 Carbon Tetrachloride results in increased expression of EDNRB mRNA CTD PMID:29987408 Ednrb Rat tetrachloromethane multiple interactions EXP 6480464 EDNRB protein affects the reaction [Carbon Tetrachloride promotes the reaction [EDN1 protein results in increased more ... CTD PMID:18205269 Ednrb Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of EDNRB mRNA; Carbon Tetrachloride results in increased expression more ... CTD PMID:12708965|PMID:12873816|PMID:16239168|PMID:31150632 Ednrb Rat tetrachloromethane increases activity EXP 6480464 Carbon Tetrachloride results in increased activity of EDNRB protein CTD PMID:12873816 Ednrb Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of EDNRB mRNA CTD PMID:16644059 Ednrb Rat tetraphene multiple interactions ISO RGD:10505 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of more ... CTD PMID:27858113 Ednrb Rat thimerosal decreases expression ISO RGD:736090 6480464 Thimerosal results in decreased expression of EDNRB mRNA CTD PMID:27188386 Ednrb Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of EDNRB mRNA CTD PMID:34492290 Ednrb Rat titanium dioxide decreases expression ISO RGD:10505 6480464 titanium dioxide results in decreased expression of EDNRB mRNA CTD PMID:23557971 Ednrb Rat titanium dioxide increases expression ISO RGD:10505 6480464 titanium dioxide results in increased expression of EDNRB mRNA CTD PMID:29264374 Ednrb Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of EDNRB mRNA CTD PMID:33387578 Ednrb Rat trichostatin A increases expression ISO RGD:736090 6480464 trichostatin A results in increased expression of EDNRB mRNA CTD PMID:24935251|PMID:26272509 Ednrb Rat trichostatin A multiple interactions ISO RGD:736090 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Ednrb Rat troglitazone decreases expression ISO RGD:10505 6480464 troglitazone results in decreased expression of EDNRB mRNA CTD PMID:28973697 Ednrb Rat U-73122 multiple interactions EXP 6480464 1-(6-((3-methoxyestra-1,3,5(10)-trien-17-yl)amino)hexyl)-1H-pyrrole-2,5-dione inhibits the reaction [[EDN1 protein binds to and results in increased activity of EDNRB more ... CTD PMID:15245872 Ednrb Rat udenafil decreases expression EXP 6480464 udenafil results in decreased expression of EDNRB CTD PMID:21366883 Ednrb Rat urethane multiple interactions ISO RGD:10505 6480464 Freund's Adjuvant inhibits the reaction [Urethane results in decreased expression of EDNRB mRNA]; IFNG protein more ... CTD PMID:12810352 Ednrb Rat urethane decreases expression ISO RGD:10505 6480464 Urethane results in decreased expression of EDNRB mRNA CTD PMID:12810352 Ednrb Rat valproic acid affects expression ISO RGD:736090 6480464 Valproic Acid affects the expression of EDNRB mRNA CTD PMID:25979313 Ednrb Rat valproic acid multiple interactions ISO RGD:736090 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Ednrb Rat valproic acid increases expression ISO RGD:736090 6480464 Valproic Acid results in increased expression of EDNRB mRNA CTD PMID:19101580|PMID:23179753|PMID:24383497|PMID:24935251|PMID:26272509|PMID:27188386|PMID:28001369 Ednrb Rat venlafaxine hydrochloride increases expression EXP 6480464 Venlafaxine Hydrochloride results in increased expression of EDNRB mRNA CTD PMID:25423262 Ednrb Rat vincaleukoblastine increases expression EXP 6480464 Vinblastine results in increased expression of EDNRB mRNA CTD PMID:20624997 Ednrb Rat vincristine increases expression EXP 6480464 Vincristine results in increased expression of EDNRB mRNA CTD PMID:20624997 Ednrb Rat vorinostat multiple interactions ISO RGD:736090 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Ednrb Rat vorinostat increases expression ISO RGD:736090 6480464 vorinostat results in increased expression of EDNRB mRNA CTD PMID:26272509 Ednrb Rat wedelolactone multiple interactions EXP 6480464 wedelolactone inhibits the reaction [Dimethyl Sulfoxide results in increased expression of EDNRB mRNA]; wedelolactone inhibits more ... CTD PMID:18718921|PMID:20561571|PMID:22207076 Ednrb Rat zinc atom decreases expression EXP 6480464 Zinc results in decreased expression of EDNRB mRNA CTD PMID:17074742 Ednrb Rat zinc sulfate decreases expression EXP 6480464 Zinc Sulfate results in decreased expression of EDNRB mRNA CTD PMID:17074742 Ednrb Rat zinc(0) decreases expression EXP 6480464 Zinc results in decreased expression of EDNRB mRNA CTD PMID:17074742
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
ABCD syndrome (ISO) asthma (IEP,ISO) autosomal recessive nonsyndromic deafness (ISO) Breast Neoplasms (ISO) chromosome 13q14 deletion syndrome (ISO) congestive heart failure (ISO) Diaphragmatic Hernia (ISO) genetic disease (ISO) Hearing Loss (ISO) hepatopulmonary syndrome (IEP) Hirschsprung's disease (IAGP,IMP,ISO,ISS) hypertension (IEP,IMP) Hypopigmentation (IAGP) lymphopenia (IAGP) megacolon (IAGP) mitochondrial DNA depletion syndrome 12a (ISO) myocardial infarction (IDA) Myocardial Ischemia (ISO) Myocardial Reperfusion Injury (IMP) Neoplasm Invasiveness (ISO) nephrosis (ISO) neuronal ceroid lipofuscinosis (ISO) Optic Nerve Injuries (IEP) Perinatal Death (IAGP) portal hypertension (IMP) pulmonary hypertension (IDA,IMP,ISO) Reperfusion Injury (IEP) sensorineural hearing loss (IAGP) Subarachnoid Hemorrhage (ISO) Total Intestinal Aganglionosis (IAGP,ISO) type 2 diabetes mellitus (IDA,ISO) Van der Hoeve Halbertsma Waardenburg Gualdi Syndrome (ISO) Waardenburg syndrome (ISO) Waardenburg syndrome type 2A (ISO) Waardenburg Syndrome Type 4 (IAGP,ISO) Waardenburg syndrome type 4A (ISO,ISS)
(-)-epigallocatechin 3-gallate (ISO) (R)-noradrenaline (EXP) (S)-colchicine (EXP) (S)-nicotine (EXP) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-acetyl-1-alkyl-sn-glycero-3-phosphocholine (EXP) 2-butoxyethanol (ISO) 2-hydroxypropanoic acid (ISO) 2-palmitoylglycerol (ISO) 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP) 3,4-methylenedioxymethamphetamine (EXP,ISO) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3H-1,2-dithiole-3-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) 6alpha-methylprednisolone (EXP) 7,12-dimethyltetraphene (EXP) 7-nitroindazole (EXP) 8-bromo-3',5'-cyclic GMP (EXP) acadesine (EXP) acetamide (EXP) acetylsalicylic acid (ISO) acrylamide (EXP,ISO) actinomycin D (EXP) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) amitrole (EXP) ammonium chloride (EXP) amphotericin B (ISO) angiotensin II (EXP) anthra[1,9-cd]pyrazol-6(2H)-one (EXP) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atrasentan (EXP) belinostat (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (ISO) bexarotene (EXP) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) bosentan (ISO) cadmium atom (ISO) cadmium dichloride (ISO) calcitriol (ISO) carbon nanotube (ISO) celecoxib (EXP) CGP 52608 (ISO) CGS-21680 (ISO) chlorambucil (ISO) chloroprene (EXP) chlorpyrifos (EXP) choline (ISO) chromium atom (ISO) chrysene (ISO) cisplatin (ISO) cocaine (EXP) copper atom (EXP) copper(0) (EXP) Cuprizon (EXP) cycloheximide (EXP) cyclophosphamide (ISO) cyclosporin A (EXP) daunorubicin (EXP) Deoxycorticosterone acetate (EXP) dexamethasone (EXP,ISO) diarsenic trioxide (ISO) dibenz[a,h]anthracene (ISO) dibutyl phthalate (ISO) dimethyl sulfoxide (EXP) dioxygen (EXP,ISO) dorsomorphin (ISO) endosulfan (EXP) enrasentan (ISO) entinostat (ISO) ethanol (EXP,ISO) etoposide (ISO) fenoterol (ISO) fentanyl (EXP) folic acid (ISO) fulvestrant (ISO) gefitinib (ISO) genistein (ISO) gentamycin (EXP,ISO) hydrogen cyanide (ISO) Ile(5)-angiotensin II (EXP) indometacin (ISO) inulin (ISO) isoprenaline (EXP) isoquinoline-1,5-diol (EXP) ketoconazole (EXP) L-ascorbic acid (ISO) L-methionine (ISO) lead diacetate (ISO) malathion (ISO) mercury dibromide (ISO) methotrexate (ISO) methylmercury chloride (ISO) methylseleninic acid (ISO) mifepristone (ISO) MK-2206 (ISO) N(gamma)-nitro-L-arginine methyl ester (EXP) N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (EXP) N-[3,5-bis(trifluoromethyl)phenyl]-5-chloro-2-hydroxybenzamide (EXP) N-ethyl-N-nitrosourea (ISO) N-methyl-N-nitrosourea (ISO) N-nitrosodiethylamine (EXP) nicotine (EXP) nicotinic acid (ISO) nimesulide (ISO) nitric oxide (EXP) nitrites (EXP) nitrofen (EXP) nitroprusside (EXP) Nonylphenol (EXP) okadaic acid (ISO) ozone (EXP,ISO) panobinostat (ISO) paracetamol (ISO) paricalcitol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) permethrin (ISO) phenobarbital (ISO) phenylephrine (EXP) phenylmercury acetate (ISO) phosphoramidon (EXP) phosphorus atom (ISO) phosphorus(.) (ISO) picrotoxin (EXP) pifithrin-alpha hydrobromide (ISO) potassium chloride (EXP) potassium chromate (ISO) potassium cyanide (ISO) progesterone (ISO) quercetin (EXP,ISO) rac-lactic acid (ISO) resveratrol (EXP) rofecoxib (ISO) SB 203580 (EXP) SB 431542 (ISO) SB-239063 (EXP) serpentine asbestos (ISO) sodium arsenite (ISO) sodium chloride (EXP) sorafenib (EXP) staurosporine (EXP) sulfadimethoxine (EXP) Tanshinone I (EXP) telmisartan (EXP) testosterone (EXP) testosterone enanthate (ISO) tetrachloromethane (EXP,ISO) tetraphene (ISO) thimerosal (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) troglitazone (ISO) U-73122 (EXP) udenafil (EXP) urethane (ISO) valproic acid (ISO) venlafaxine hydrochloride (EXP) vincaleukoblastine (EXP) vincristine (EXP) vorinostat (ISO) wedelolactone (EXP) zinc atom (EXP) zinc sulfate (EXP) zinc(0) (EXP)
Biological Process
aldosterone metabolic process (IEA,ISO) blood circulation (IEA) calcium ion transmembrane transport (IEA,ISO) calcium-mediated signaling (IEA,ISO,ISS) canonical Wnt signaling pathway (IEA,ISO) cellular response to lipopolysaccharide (IEP) cGMP-mediated signaling (IMP) chordate pharynx development (IEA,ISO) developmental pigmentation (IBA,IEA,ISO) endothelin receptor signaling pathway (IBA,IEA,ISO) enteric nervous system development (IEA,ISO) enteric smooth muscle cell differentiation (IEA,ISO) epithelial fluid transport (IMP) establishment of endothelial barrier (IEA,ISO) G protein-coupled receptor signaling pathway (IEA,ISO) gene expression (IEA,ISO) heparin proteoglycan metabolic process (IEA,ISO) macrophage chemotaxis (IEA,ISO) melanocyte differentiation (IDA,IEA,ISO) negative regulation of apoptotic process (IMP) negative regulation of neuron maturation (IEA,ISO) negative regulation of protein metabolic process (IEA,ISO) negative regulation of transcription by RNA polymerase II (IEA,ISO) neural crest cell migration (IEA,ISO) neuroblast migration (IEA,ISO) peripheral nervous system development (IEA,ISO) phospholipase C-activating G protein-coupled receptor signaling pathway (IMP) pigmentation (IEA,IMP,ISO) podocyte differentiation (IEA,ISO) positive regulation of canonical NF-kappaB signal transduction (IEA,ISO) positive regulation of cell population proliferation (IMP) positive regulation of cytosolic calcium ion concentration (IDA) positive regulation of penile erection (IMP) positive regulation of protein phosphorylation (IDA) positive regulation of urine volume (IMP) posterior midgut development (IEA,ISO) protein transmembrane transport (IEA,ISO) regulation of biological quality (IEA) regulation of blood pressure (IEA,IMP,ISO) regulation of epithelial cell proliferation (IMP) regulation of fever generation (IMP) regulation of heart rate (IEA,ISO) regulation of pH (IEA,ISO) renal albumin absorption (IEA,ISO) renal sodium excretion (IEA,ISO) renal sodium ion absorption (IEA,ISO) renin secretion into blood stream (IEA,ISO) response to endothelin (IMP) response to lipopolysaccharide (IMP) response to pain (IMP) response to sodium phosphate (IEA,ISO) signal transduction (IEA) sodium ion homeostasis (IEA,ISO) vasoconstriction (IBA,IEA,IMP,ISO) vasodilation (IMP) vein smooth muscle contraction (IEA,ISO)
1.
Developmental changes in the functional, biochemical and molecular properties of rat bladder endothelin receptors.
Afiatpour P, etal., Naunyn Schmiedebergs Arch Pharmacol. 2003 May;367(5):462-72. Epub 2003 Apr 17.
2.
Mutation of the endothelin-receptor B gene in Waardenburg-Hirschsprung disease.
Attie T, etal., Hum Mol Genet. 1995 Dec;4(12):2407-9.
3.
ETA receptor-mediated Ca2+ signaling in thin descending limbs of Henle's loop: impairment in genetic hypertension.
Bailey MA, etal., Kidney Int. 2003 Apr;63(4):1276-84.
4.
Endothelin-1 receptor subtypes expression and binding in a perfused rat model of myocardial infarction.
Bikhazi AB, etal., Comp Biochem Physiol C Toxicol Pharmacol. 2003 Jan;134(1):35-43.
5.
Functional endothelin receptors are present on nuclei in cardiac ventricular myocytes.
Boivin B, etal., J Biol Chem. 2003 Aug 1;278(31):29153-63. Epub 2003 May 19.
6.
Murine and rat cavernosal responses to endothelin-1 and urotensin-II Vasoactive Peptide Symposium.
Carneiro FS, etal., J Am Soc Hypertens. 2008 Nov;2(6):439-447.
7.
ETA receptor-mediated Ca2+ mobilisation in H9c2 cardiac cells.
Ceccarelli F, etal., Biochem Pharmacol 2003 Mar 1;65(5):783-93.
8.
Interstitial deletion of the endothelin-B receptor gene in the spotting lethal (sl) rat.
Ceccherini I, etal., Hum Mol Genet 1995 Nov;4(11):2089-96.
9.
Effects of chronic cold exposure on the endothelin system.
Chen GF and Sun Z, J Appl Physiol. 2006 May;100(5):1719-26. Epub 2005 Dec 29.
10.
Endothelins as pronociceptive mediators of the rat trigeminal system: role of ETA and ETB receptors.
Chichorro JG, etal., Brain Res. 2010 Jul 23;1345:73-83. Epub 2010 May 5.
11.
Endothelin-1 impairs alveolar epithelial function via endothelial ETB receptor.
Comellas AP, etal., Am J Respir Crit Care Med. 2009 Jan 15;179(2):113-22. Epub 2008 Oct 23.
12.
Increased ET-1 and reduced ET(B) receptor expression in uremic hypertensive rats.
D'Amours M, etal., Clin Exp Hypertens. 2010 Jan;32(1):61-9.
13.
Lymphopenia in Ednrb-deficient rat was strongly modified by genetic background.
Dang R, etal., Biomed Res. 2012;33(4):249-53.
14.
QTL analysis identifies a modifier locus of aganglionosis in the rat model of Hirschsprung disease carrying Ednrb(sl) mutations.
Dang R, etal., PLoS One. 2011;6(11):e27902. Epub 2011 Nov 22.
15.
Genetic background strongly modifies the severity of symptoms of Hirschsprung disease, but not hearing loss in rats carrying Ednrb(sl) mutations.
Dang R, etal., PLoS One. 2011;6(9):e24086. Epub 2011 Sep 7.
16.
Genetic mapping of two new blood pressure quantitative trait loci in the rat by genotyping endothelin system genes.
Deng AY, etal., J Clin Invest 1994 Jun;93(6):2701-9
17.
Upregulation of endothelin receptors A and B in the nitrofen induced hypoplastic lung occurs early in gestation.
Dingemann J, etal., Pediatr Surg Int. 2010 Jan;26(1):65-9.
18.
Endotoxin causes pulmonary hypertension by upregulating smooth muscle endothelin type-B receptors: role of aldose reductase.
Dschietzig T, etal., Shock. 2008 Aug;30(2):189-96.
19.
Central endothelin ET(B) receptors mediate IL-1-dependent fever induced by preformed pyrogenic factor and corticotropin-releasing factor in the rat.
Fabricio AS, etal., Am J Physiol Regul Integr Comp Physiol. 2006 Jan;290(1):R164-71. Epub 2005 Aug 25.
20.
NAADP-induced Ca(2+ signaling in response to endothelin is via the receptor subtype B and requires the integrity of lipid rafts/caveolae.
Gambara G, etal., J Cell Physiol. 2008 Aug;216(2):396-404.
21.
Transgenic expression of the endothelin-B receptor prevents congenital intestinal aganglionosis in a rat model of Hirschsprung disease.
Gariepy CE, etal., J Clin Invest 1998 Sep 15;102(6):1092-101.
22.
Salt-sensitive hypertension in endothelin-B receptor-deficient rats.
Gariepy CE, etal., J Clin Invest 2000 Apr;105(7):925-33.
23.
Null mutation of endothelin receptor type B gene in spotting lethal rats causes aganglionic megacolon and white coat color.
Gariepy CE, etal., Proc Natl Acad Sci U S A 1996 Jan 23;93(2):867-72.
24.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
25.
LPS from Porphyromonas gingivalis increases the sensitivity of contractile response mediated by endothelin-B (ET(B)) receptors in cultured endothelium-intact rat coronary arteries.
Ghorbani B, etal., Vascul Pharmacol. 2010 Nov-Dec;53(5-6):250-7. Epub 2010 Oct 1.
26.
Involvement of endothelin-1 and its receptors in PGF2alpha-induced luteolysis in the rat.
Girsh E and Dekel N, Mol Reprod Dev 2002 Sep;63(1):71-8.
27.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
28.
Polymorphisms in genes of the endothelin system and cerebral small-vessel disease.
Gormley K, etal., Stroke. 2005 Aug;36(8):1656-60. Epub 2005 Jul 7.
29.
Up-regulation of endothelin receptor function and mRNA expression in airway smooth muscle cells following Sephadex-induced airway inflammation.
Granstrom BW, etal., Basic Clin Pharmacol Toxicol. 2004 Jul;95(1):43-8.
30.
Endothelin A and B receptors are down-regulated in the hearts of hypertensive rats.
Hayzer DJ, etal., Am J Med Sci 1994 Mar;307(3):222-7.
31.
ETA receptor blockade induces tubular cell proliferation and cyst growth in rats with polycystic kidney disease.
Hocher B, etal., J Am Soc Nephrol. 2003 Feb;14(2):367-76.
32.
QTL analysis of modifiers for pigmentary disorder in rats carrying Ednrb(sl) mutations.
Huang J, etal., Sci Rep. 2016 Jan 22;6:19697. doi: 10.1038/srep19697.
33.
Role of angiotensin II and endothelin-1 receptors in aging-related functional changes in rat cardiovascular system.
Ishihata A and Katano Y, Ann N Y Acad Sci. 2006 May;1067:173-81.
34.
Increased immunoreactivity of endothelin-1 and endothelin B receptor in human atherosclerotic lesions. A possible role in atherogenesis.
Iwasa S, etal., Atherosclerosis. 1999 Sep;146(1):93-100.
35.
Endothelin 1 and 3 enhance neuronal nitric oxide synthase activity through ETB receptors involving multiple signaling pathways in the rat anterior hypothalamus.
Jaureguiberry MS, etal., Peptides. 2004 Jul;25(7):1133-8.
36.
Dual constrictor and dilator actions of ET(B) receptors in the rat renal microcirculation: interactions with ET(A) receptors.
Just A, etal., Am J Physiol Renal Physiol. 2004 Apr;286(4):F660-8. Epub 2003 Dec 16.
37.
The role of ET(A) and ET(B) receptor antagonists in acute and allergic inflammation in mice.
Kassuya CA, etal., Peptides. 2008 Aug;29(8):1329-37. Epub 2008 Mar 16.
38.
Endothelin-B receptor activation triggers an endogenous analgesic cascade at sites of peripheral injury.
Khodorova A, etal., Nat Med. 2003 Aug;9(8):1055-61. Epub 2003 Jun 29.
39.
Differential effects of endothelin on activation of renal mechanosensory nerves: stimulatory in high-sodium diet and inhibitory in low-sodium diet.
Kopp UC, etal., Am J Physiol Regul Integr Comp Physiol. 2006 Nov;291(5):R1545-56. Epub 2006 Jun 8.
40.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
41.
Activation of ETB receptors increases superoxide levels in sympathetic ganglia in vivo.
Lau YE, etal., Am J Physiol Regul Integr Comp Physiol. 2006 Jan;290(1):R90-5. Epub 2005 Sep 22.
42.
Effect of pyrrolidine dithiocarbamate on hepatic vascular stress gene expression during ischemia and reperfusion.
Lee CH, etal., Eur J Pharmacol. 2008 Oct 24;595(1-3):100-7. Epub 2008 Aug 9.
43.
Multiple signaling pathways involved in the effect of endothelin type B receptor in rat median eminence.
Mathison Y, etal., Acta Biol Hung. 2007 Jun;58(2):139-50.
44.
Involvement of NO and MEK/ERK pathway in enhancement of endothelin-1-induced mesenteric artery contraction in later-stage type 2 diabetic Goto-Kakizaki rat.
Matsumoto T, etal., Am J Physiol Heart Circ Physiol. 2009 May;296(5):H1388-97. Epub 2009 Mar 13.
45.
Calcitonin gene-related peptide selectively relaxes contractile responses to endothelin-1 in rat mesenteric resistance arteries.
Meens MJ, etal., J Pharmacol Exp Ther. 2009 Oct;331(1):87-95. Epub 2009 Jul 23.
46.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
47.
Inhibitory effects of PPAR-gamma on endothelin-1-induced inflammatory pathways in vascular smooth muscle cells from normotensive and hypertensive rats.
Montezano AC, etal., J Am Soc Hypertens. 2007 Mar-Apr;1(2):150-60.
48.
Renal medullary ETB receptors produce diuresis and natriuresis via NOS1.
Nakano D, etal., Am J Physiol Renal Physiol. 2008 May;294(5):F1205-11. Epub 2008 Feb 27.
49.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
50.
Polymorphisms of the endothelin-A and -B receptor genes in relation to blood pressure and myocardial infarction: the Etude Cas-Temoins sur l'Infarctus du Myocarde (ECTIM) Study.
Nicaud V, etal., Am J Hypertens. 1999 Mar;12(3):304-10.
51.
Role of endothelin B receptor in the pathogenesis of ischemic acute renal failure.
Nishida M, etal., J Cardiovasc Pharmacol 2002 Oct;40(4):586-93.
52.
Roles of endothelin ETA and ETB receptors in the pathogenesis of monocrotaline-induced pulmonary hypertension.
Nishida M, etal., J Cardiovasc Pharmacol. 2004 Aug;44(2):187-91.
53.
Extrarenal ETB plays a significant role in controlling cardiovascular responses to high dietary sodium in rats.
Ohkita M, etal., Hypertension. 2005 May;45(5):940-6. Epub 2005 Apr 4.
54.
Endothelin-1 (ET-1) is increased in rat retina after crushing optic nerve.
Oku H, etal., Curr Eye Res. 2008 Jul;33(7):611-20.
55.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
56.
ET(B) receptor-deficient rats exhibit reduced contraction to ET-1 despite an increase in ET(A) receptors.
Perry MG, etal., Am J Physiol Heart Circ Physiol 2001 Dec;281(6):H2680-6.
57.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
58.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
59.
ETA and ETB receptor function in pancreatitis-associated microcirculatory failure, inflammation, and parenchymal injury.
Plusczyk T, etal., Am J Physiol Gastrointest Liver Physiol. 2003 Jul;285(1):G145-53.
60.
A missense mutation of the endothelin-B receptor gene in multigenic Hirschsprung's disease.
Puffenberger EG, etal., Cell. 1994 Dec 30;79(7):1257-66.
61.
GOA pipeline
RGD automated data pipeline
62.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
63.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
64.
Endothelin B receptor deficient transgenic rescue rats: a rescue phenomenon in the brain.
Riechers CC, etal., Neuroscience. 2004;124(4):719-23.
65.
Cloning of a cDNA encoding a non-isopeptide-selective subtype of the endothelin receptor.
Sakurai T, etal., Nature 1990 Dec 20-27;348(6303):732-5.
66.
Gene-based anchoring of the rat genetic linkage and cytogenetic maps: new regional localizations, orientation of the linkage groups, and insights into mammalian chromosome evolution.
Szpirer C, etal., Mamm Genome 1998 Sep;9(9):721-34
67.
ETB receptor polymorphism is associated with airway obstruction.
Taille C, etal., BMC Pulm Med. 2007 Apr 30;7:5.
68.
BMPR2 mutation alters the lung macrophage endothelin-1 cascade in a mouse model and patients with heritable pulmonary artery hypertension.
Talati M, etal., Am J Physiol Lung Cell Mol Physiol. 2010 Sep;299(3):L363-73. Epub 2010 Jun 18.
69.
Effects of exogenous big endothelin-1 on postischemic cardiac dysfunction and norepinephrine overflow in rat hearts.
Tawa M, etal., Hypertens Res. 2011 Feb;34(2):218-24. Epub 2010 Nov 4.
70.
Unique endothelin receptor binding in kidneys of ETB receptor deficient rats.
Taylor TA, etal., Am J Physiol Regul Integr Comp Physiol 2003 Mar;284(3):R674-81.
71.
ABCD syndrome is caused by a homozygous mutation in the EDNRB gene.
Verheij JB, etal., Am J Med Genet. 2002 Mar 15;108(3):223-5.
72.
Deficiency in endothelin receptor B reduces proliferation of neuronal progenitors and increases apoptosis in postnatal rat cerebellum.
Vidovic M, etal., Cell Mol Neurobiol. 2008 Dec;28(8):1129-38. Epub 2008 Aug 6.
73.
Ischemic heart disease induces upregulation of endothelin receptor mRNA in human coronary arteries.
Wackenfors A, etal., Eur J Pharmacol. 2004 Jan 19;484(1):103-9.
74.
Null mutation of the endothelin receptor type B gene causes embryonic death in the GK rat.
Wang J, etal., PLoS One. 2019 Jun 6;14(6):e0217132. doi: 10.1371/journal.pone.0217132. eCollection 2019.
75.
Peroxisome proliferator-activated receptor-alpha activation reduces salt-dependent hypertension during chronic endothelin B receptor blockade.
Williams JM, etal., Hypertension. 2005 Aug;46(2):366-71. Epub 2005 Jun 20.
76.
Aberrant ETB receptor regulation of AT receptors in immortalized renal proximal tubule cells of spontaneously hypertensive rats.
Zeng C, etal., Kidney Int. 2005 Aug;68(2):623-31.
77.
Pentoxifylline attenuation of experimental hepatopulmonary syndrome.
Zhang J, etal., J Appl Physiol. 2007 Mar;102(3):949-55. Epub 2006 Nov 16.
78.
[Effect and mechanism of salvianolic acid B in attenuating elevated portal pressure in a rat model of portal hypertension induced by endothelin-1].
Zhou Y, etal., Zhong Xi Yi Jie He Xue Bao. 2007 Jan;5(1):61-4.
Ednrb Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 87,055,490 - 87,086,765 (-) NCBI GRCr8 mRatBN7.2 15 80,640,839 - 80,672,115 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 80,643,043 - 80,672,115 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 84,622,892 - 84,651,923 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 85,745,953 - 85,774,986 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 82,673,598 - 82,702,629 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 88,004,775 - 88,036,354 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 88,006,977 - 88,036,354 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 91,500,400 - 91,531,979 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 87,893,141 - 87,898,700 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 87,908,924 - 87,914,471 (-) NCBI Celera 15 79,772,740 - 79,801,760 (-) NCBI Celera RH 3.4 Map 15 496.21 RGD Cytogenetic Map 15 q22 NCBI
EDNRB Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 13 77,895,487 - 77,975,527 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 13 77,895,481 - 77,975,529 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 13 78,469,622 - 78,549,662 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 13 77,367,617 - 77,447,665 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 13 77,368,543 - 77,390,935 NCBI Celera 13 59,367,540 - 59,390,895 (-) NCBI Celera Cytogenetic Map 13 q22.3 NCBI HuRef 13 59,168,348 - 59,248,390 (-) NCBI HuRef CHM1_1 13 78,436,966 - 78,516,998 (-) NCBI CHM1_1 T2T-CHM13v2.0 13 77,120,409 - 77,200,427 (-) NCBI T2T-CHM13v2.0
Ednrb Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 104,052,055 - 104,081,764 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 104,052,061 - 104,081,838 (-) Ensembl GRCm39 Ensembl GRCm38 14 103,814,615 - 103,844,508 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 103,814,625 - 103,844,402 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 104,213,842 - 104,243,390 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 102,700,305 - 102,729,375 (-) NCBI MGSCv36 mm8 Celera 14 102,434,540 - 102,464,042 (-) NCBI Celera Cytogenetic Map 14 E2.3 NCBI cM Map 14 53.05 NCBI
Ednrb Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955404 29,394,164 - 29,425,358 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955404 29,394,253 - 29,425,358 (+) NCBI ChiLan1.0 ChiLan1.0
EDNRB Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 14 79,464,042 - 79,488,264 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 13 78,060,299 - 78,084,570 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 13 59,112,349 - 59,136,615 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 13 78,153,026 - 78,177,281 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 13 78,153,020 - 78,177,286 (-) Ensembl panpan1.1 panPan2
EDNRB Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 22 31,415,324 - 31,438,772 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 22 31,417,308 - 31,437,587 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 22 31,277,699 - 31,297,545 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 22 31,733,123 - 31,756,544 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 22 31,733,292 - 31,756,408 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 22 31,396,562 - 31,416,398 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 22 31,434,803 - 31,454,631 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 22 31,507,052 - 31,526,893 (-) NCBI UU_Cfam_GSD_1.0
Ednrb Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 128,029,566 - 128,061,207 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936511 3,446,839 - 3,478,434 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936511 3,446,864 - 3,478,434 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
EDNRB Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 11 50,072,554 - 50,102,884 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 11 50,073,300 - 50,102,879 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 11 54,689,465 - 54,718,898 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
EDNRB Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 3 56,969,493 - 56,993,719 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 3 56,969,101 - 56,992,731 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666046 13,190,167 - 13,214,545 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ednrb
.
Predicted Target Of
Count of predictions: 222 Count of miRNA genes: 153 Interacting mature miRNAs: 170 Transcripts: ENSRNOT00000014747 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
731177 Uae26 Urinary albumin excretion QTL 26 2.4 0.025 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 15 67588667 101769107 Rat 1300144 Rf23 Renal function QTL 23 3.61 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 15 40631268 98288169 Rat 1576315 Schws6 Schwannoma susceptibility QTL 6 0.0069 nervous system integrity trait (VT:0010566) post-insult time of death (CMO:0002005) 15 53806152 98806152 Rat 1549844 Bss7 Bone structure and strength QTL 7 6.4 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 15 75788062 101769107 Rat 61477 Aia4 Adjuvant induced arthritis QTL 4 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 15 55596089 91365858 Rat 2300326 Plaw1 Placental weight QTL 1 15 0.005 placenta mass (VT:0004257) placenta wet weight (CMO:0002088) 15 68327165 100062518 Rat 70182 BpQTLcluster12 Blood pressure QTL cluster 12 3.53 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 15 73690657 95018120 Rat 152025253 Hrtrt24 Heart rate QTL 24 3.82 heart pumping trait (VT:2000009) 15 27885774 86257085 Rat 70155 Gcs1 Gastric cancer susceptibility QTL1 3.8 stomach morphology trait (VT:0000470) stomach tumor susceptibility score (CMO:0002043) 15 76306099 101769107 Rat 1582227 Gluco30 Glucose level QTL 30 3.6 0.0003 blood glucose amount (VT:0000188) absolute change in blood glucose level area under curve (CMO:0002034) 15 28030665 82262678 Rat 1581555 Eae19 Experimental allergic encephalomyelitis QTL 19 4.7 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 15 76306099 90088744 Rat 1582228 Epfw3 Epididymal fat weight QTL 3 4.1 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 1578646 Bmd18 Bone mineral density QTL 18 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 15 22806240 98288169 Rat 631655 Bp126 Blood pressure QTL 126 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 58156477 101769107 Rat 1578647 Bmd17 Bone mineral density QTL 17 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 15 22806240 98288169 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 631516 Gluco31 Glucose level QTL 31 7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 55596089 95018120 Rat 1331724 Bp223 Blood pressure QTL 223 3.53715 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 15 73690518 95018228 Rat 1641889 Colcr6 Colorectal carcinoma resistance QTL 6 2.9 0.0126 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 15 73690518 99794247 Rat 1582242 Gluco28 Glucose level QTL 28 3.3 0.0008 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 15 28030665 82262678 Rat 1578660 Bss19 Bone structure and strength QTL 19 4.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 15 22806240 98288169 Rat 1582244 Bw79 Body weight QTL 79 4 0.0002 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 15 28030665 82262678 Rat 2317055 Aia10 Adjuvant induced arthritis QTL 10 3.41 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 15 75788062 101769107 Rat 1582214 Stl21 Serum triglyceride level QTL 21 3.1 0.022 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 15 28030665 82262678 Rat
D15Mco2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 80,640,428 - 80,640,727 (+) MAPPER mRatBN7.2 mRatBN7.2 15 80,640,501 - 80,640,727 (+) MAPPER mRatBN7.2 Rnor_6.0 15 88,004,438 - 88,004,663 NCBI Rnor6.0 Rnor_6.0 15 88,004,206 - 88,004,663 NCBI Rnor6.0 Rnor_5.0 15 91,500,063 - 91,500,288 UniSTS Rnor5.0 Rnor_5.0 15 91,499,831 - 91,500,288 UniSTS Rnor5.0 RGSC_v3.4 15 87,890,620 - 87,890,845 UniSTS RGSC3.4 RGSC_v3.4 15 87,890,619 - 87,890,845 RGD RGSC3.4 RGSC_v3.1 15 87,906,399 - 87,906,625 RGD Celera 15 79,770,219 - 79,770,444 UniSTS Cytogenetic Map 15 q21-q22 UniSTS
D15Mco3
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 80,645,554 - 80,645,729 (+) MAPPER mRatBN7.2 Rnor_6.0 15 88,009,405 - 88,009,579 NCBI Rnor6.0 Rnor_5.0 15 91,505,030 - 91,505,204 UniSTS Rnor5.0 RGSC_v3.4 15 87,895,670 - 87,895,844 UniSTS RGSC3.4 Celera 15 79,775,226 - 79,775,400 UniSTS Cytogenetic Map 15 q21-q22 UniSTS
D15Wox13
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 80,648,147 - 80,648,395 (+) MAPPER mRatBN7.2 Rnor_6.0 15 88,012,000 - 88,012,247 NCBI Rnor6.0 Rnor_5.0 15 91,507,625 - 91,507,872 UniSTS Rnor5.0 RGSC_v3.4 15 87,898,265 - 87,898,512 UniSTS RGSC3.4 Celera 15 79,777,821 - 79,778,067 UniSTS Cytogenetic Map 15 q21-q22 UniSTS
D15Ulb3
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 15 87,061,214 - 87,061,500 (+) Marker Load Pipeline mRatBN7.2 15 80,646,566 - 80,646,850 (+) MAPPER mRatBN7.2 Rnor_6.0 15 88,010,417 - 88,010,700 NCBI Rnor6.0 Rnor_5.0 15 91,506,042 - 91,506,325 UniSTS Rnor5.0 RGSC_v3.4 15 87,896,682 - 87,896,965 UniSTS RGSC3.4 Celera 15 79,776,238 - 79,776,521 UniSTS Cytogenetic Map 15 q21-q22 UniSTS
PMC24270P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 80,643,379 - 80,643,591 (+) MAPPER mRatBN7.2 Rnor_6.0 15 88,007,314 - 88,007,525 NCBI Rnor6.0 Rnor_5.0 15 91,502,939 - 91,503,150 UniSTS Rnor5.0 RGSC_v3.4 15 87,893,496 - 87,893,707 UniSTS RGSC3.4 Celera 15 79,773,095 - 79,773,306 UniSTS Cytogenetic Map 15 q21-q22 UniSTS
AA818970
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 80,670,939 - 80,671,119 (+) MAPPER mRatBN7.2 Rnor_6.0 15 88,035,179 - 88,035,358 NCBI Rnor6.0 Rnor_5.0 15 91,530,804 - 91,530,983 UniSTS Rnor5.0 Celera 15 79,800,585 - 79,800,764 UniSTS RH 3.4 Map 15 498.61 UniSTS Cytogenetic Map 15 q21-q22 UniSTS
EDNRB-2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 80,648,543 - 80,649,972 (+) MAPPER mRatBN7.2 Rnor_6.0 15 88,012,396 - 88,013,824 NCBI Rnor6.0 Rnor_5.0 15 91,508,021 - 91,509,449 UniSTS Rnor5.0 Celera 15 79,778,216 - 79,779,644 UniSTS Cytogenetic Map 15 q21-q22 UniSTS
This gene Ednrb is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000014747 ⟹ ENSRNOP00000014747
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 80,643,043 - 80,672,115 (-) Ensembl Rnor_6.0 Ensembl 15 88,006,977 - 88,036,354 (-) Ensembl
RefSeq Acc Id:
NM_017333 ⟹ NP_059029
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 87,057,673 - 87,086,765 (-) NCBI mRatBN7.2 15 80,643,025 - 80,672,115 (-) NCBI Rnor_6.0 15 88,006,959 - 88,036,354 (-) NCBI Rnor_5.0 15 91,500,400 - 91,531,979 (-) NCBI RGSC_v3.4 15 87,893,141 - 87,898,700 (-) RGD Celera 15 79,772,740 - 79,801,760 (-) RGD
Sequence:
CCCCGAGCGAACTGCTGAGGATCCGCTGTCTGGCATTCTCTCAGCCTTTTGTCCGAGCCAGAGCTGCATTCAGAGGAGAGAGGCCCGCTAAGGAGCAGCTGGACTCCTGCTGCGAGCCGAAAGCCCCC
hide sequence
RefSeq Acc Id:
XM_006252431 ⟹ XP_006252493
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 87,055,490 - 87,086,257 (-) NCBI mRatBN7.2 15 80,640,839 - 80,671,537 (-) NCBI Rnor_6.0 15 88,004,775 - 88,036,106 (-) NCBI Rnor_5.0 15 91,500,400 - 91,531,979 (-) NCBI
Sequence:
CCTTGCTCTGGGGCTTCCGCTTTGCTTAGTACTTTGGGGATTTTTTTAATTAGTAAAACTTGCACACAACCGCGATTTAAACCGAGATTGGGTTGCAAAGCGAATGTTTTGAAGTCACTGGGAAAGCA
hide sequence
RefSeq Acc Id:
NP_059029 ⟸ NM_017333
- Peptide Label:
precursor
- UniProtKB:
P21451 (UniProtKB/Swiss-Prot), A6HUA5 (UniProtKB/TrEMBL)
- Sequence:
MQSSASRCGRALVALLLACGLLGVWGEKRGFPPAQATPSLLGTKEVMTPPTKTSWTRGSNSSLMRSSAPAEVTKGGRVAGVPPRSFPPPCQRKIEINKTFKYINTIVSCLVFVLGIIGNSTLLRIIYK
hide sequence
RefSeq Acc Id:
XP_006252493 ⟸ XM_006252431
- Peptide Label:
isoform X1
- UniProtKB:
P21451 (UniProtKB/Swiss-Prot), A6HUA5 (UniProtKB/TrEMBL)
- Sequence:
MQSSASRCGRALVALLLACGLLGVWGEKRGFPPAQATPSLLGTKEVMTPPTKTSWTRGSNSSLM
hide sequence
Ensembl Acc Id:
ENSRNOP00000014747 ⟸ ENSRNOT00000014747
RGD ID: 13699864 Promoter ID: EPDNEW_R10387 Type: single initiation site Name: Ednrb_1 Description: endothelin receptor type B SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 88,036,356 - 88,036,416 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2003-04-09
Ednrb
endothelin receptor type B
Symbol and Name updated
629477 APPROVED
2003-03-19
Ednrb
endothelin receptor type B
Etb
endothelin receptor
Data merged from RGD:621128
628472 PROVISIONAL
2002-08-07
Etb
endothelin receptor
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-06-10
Ednrb
endothelin receptor type B
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_disease
mutation of this gene in humans a leads to congental aganglionic megacolon or Hirschsprung disease, participates in deoxycorticosterone acetate (DOCA)-salt-induced hypertension, cardiovascular hypertrophy and renal damage
628459
gene_disease
mutation of this gene in humans a leads to congental aganglionic megacolon or Hirschsprung disease, participates in deoxycorticosterone acetate (DOCA)-salt-induced hypertension, cardiovascular hypertrophy and renal damage
628515
gene_disease
mutation of this gene in humans a leads to congental aganglionic megacolon or Hirschsprung disease, participates in deoxycorticosterone acetate (DOCA)-salt-induced hypertension, cardiovascular hypertrophy and renal damage
628516
gene_expression
expressed in vascular and nonvascular tissues of the lung, brain and gut, mRNA first detected in the neural crest cells and in the wall of the forgut diverticulum.
628459
gene_expression
expressed in vascular and nonvascular tissues of the lung, brain and gut, mRNA first detected in the neural crest cells and in the wall of the forgut diverticulum.
628515
gene_expression
expressed in vascular and nonvascular tissues of the lung, brain and gut, mRNA first detected in the neural crest cells and in the wall of the forgut diverticulum.
628516
gene_expression
not expressed in spontaneously hypertensive rat hearts but was expressed in salt-hypertensive sensitive and resistant rats fed a high-salt diet
1358986
gene_function
induces inositol phosphate accumulation and calcium flux
61059
gene_mutations_overexpression
deletion in this gene stops the receptor expression hence elevates endothelin 1
628459
gene_mutations_overexpression
deletion in this gene stops the receptor expression hence elevates endothelin 1
628515
gene_mutations_overexpression
deletion in this gene stops the receptor expression hence elevates endothelin 1
628516
gene_process
involved in the development of two neural crest derived cells, epidermal melanocytes and entric neurons
628459
gene_process
involved in the development of two neural crest derived cells, epidermal melanocytes and entric neurons
628515
gene_process
involved in the development of two neural crest derived cells, epidermal melanocytes and entric neurons
628516
gene_process
may be involved in congenital aganglionic megacolon and pigmentation abnormalities
628459
gene_process
may be involved in congenital aganglionic megacolon and pigmentation abnormalities
628515
gene_process
may be involved in congenital aganglionic megacolon and pigmentation abnormalities
628516
