Symbol:
Csnk2a2
Name:
casein kinase 2 alpha 2
RGD ID:
1306882
Description:
Predicted to enable protein serine/threonine kinase activity. Involved in cerebral cortex development; liver regeneration; and spermatogenesis. Located in acrosomal vesicle and chromatin. Orthologous to human CSNK2A2 (casein kinase 2 alpha 2); PARTICIPATES IN E-cadherin signaling pathway; mitochondrial autophagy pathway; nuclear factor kappa B signaling pathway; INTERACTS WITH 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil; amitrole.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
casein kinase 2, alpha prime polypeptide; casein kinase II subunit alpha'; casein kinase II, alpha 2, polypeptide; LOC307641
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CSNK2A2 (casein kinase 2 alpha 2)
HGNC
EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Csnk2a2 (casein kinase 2, alpha prime polypeptide)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Csnk2a2 (casein kinase 2 alpha 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CSNK2A2 (casein kinase 2 alpha 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CSNK2A2 (casein kinase 2 alpha 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Csnk2a2 (casein kinase 2 alpha 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CSNK2A2 (casein kinase 2 alpha 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CSNK2A2 (casein kinase 2 alpha 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Csnk2a2 (casein kinase 2 alpha 2)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
CSNK2A1 (casein kinase 2 alpha 1)
HGNC
Inparanoid
Alliance orthologs 3
Homo sapiens (human):
CSNK2A2 (casein kinase 2 alpha 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Csnk2a2 (casein kinase 2, alpha prime polypeptide)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
csnk2a2a (casein kinase 2, alpha prime polypeptide a)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
csnk2a2b (casein kinase 2, alpha prime polypeptide b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
CKA1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CkIIalpha
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
kin-3
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
CKA2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
csnk2a2
Alliance
DIOPT (Ensembl Compara|OMA|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 9,562,340 - 9,602,136 (+) NCBI GRCr8 mRatBN7.2 19 9,556,443 - 9,596,080 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 9,556,260 - 9,596,080 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 9,521,860 - 9,561,150 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 10,288,686 - 10,327,976 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 9,575,016 - 9,614,306 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 9,972,537 - 10,012,043 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 9,972,537 - 10,012,043 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 9,956,494 - 9,996,397 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 10,015,369 - 10,054,662 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 10,020,174 - 10,054,722 (+) NCBI Celera 19 9,448,494 - 9,487,786 (+) NCBI Celera Cytogenetic Map 19 p13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Csnk2a2 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO CSNK2A2 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of CSNK2A2 mRNA CTD PMID:22079256 Csnk2a2 Rat 1,2-dimethylhydrazine multiple interactions ISO Csnk2a2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CSNK2A2 mRNA CTD PMID:22206623 Csnk2a2 Rat 17alpha-ethynylestradiol increases expression ISO Csnk2a2 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of CSNK2A2 mRNA CTD PMID:17942748 Csnk2a2 Rat 17alpha-ethynylestradiol multiple interactions ISO Csnk2a2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CSNK2A2 mRNA CTD PMID:17942748 Csnk2a2 Rat 17beta-estradiol affects expression ISO Csnk2a2 (Mus musculus) 6480464 Estradiol affects the expression of CSNK2A2 mRNA CTD PMID:15721199 Csnk2a2 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO CSNK2A2 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Csnk2a2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Csnk2a2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of CSNK2A2 mRNA CTD PMID:17942748 Csnk2a2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO CSNK2A2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CSNK2A2 mRNA CTD PMID:26238291 Csnk2a2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Csnk2a2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CSNK2A2 mRNA CTD PMID:21570461 Csnk2a2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Csnk2a2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of CSNK2A2 mRNA CTD PMID:17942748 Csnk2a2 Rat 2-hydroxypropanoic acid decreases expression ISO CSNK2A2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of CSNK2A2 mRNA CTD PMID:30851411 Csnk2a2 Rat 2-methylcholine affects expression ISO CSNK2A2 (Homo sapiens) 6480464 beta-methylcholine affects the expression of CSNK2A2 mRNA CTD PMID:21179406 Csnk2a2 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO CSNK2A2 (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of CSNK2A2 protein CTD PMID:31675489 Csnk2a2 Rat 4,4'-sulfonyldiphenol decreases expression ISO Csnk2a2 (Mus musculus) 6480464 bisphenol S results in decreased expression of CSNK2A2 mRNA CTD PMID:39298647 Csnk2a2 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of CSNK2A2 mRNA CTD PMID:36041667 Csnk2a2 Rat 5-aza-2'-deoxycytidine increases expression ISO Csnk2a2 (Mus musculus) 6480464 Decitabine results in increased expression of CSNK2A2 mRNA CTD PMID:27915011 Csnk2a2 Rat 5-aza-2'-deoxycytidine increases expression ISO CSNK2A2 (Homo sapiens) 6480464 Decitabine results in increased expression of CSNK2A2 mRNA and Decitabine results in increased expression of CSNK2A2 protein CTD PMID:19027835 Csnk2a2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of CSNK2A2 mRNA CTD PMID:30047161 Csnk2a2 Rat aflatoxin B1 increases expression ISO Csnk2a2 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of CSNK2A2 mRNA CTD PMID:19770486 Csnk2a2 Rat all-trans-retinoic acid decreases expression ISO CSNK2A2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of CSNK2A2 mRNA CTD PMID:33167477 Csnk2a2 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of CSNK2A2 mRNA CTD PMID:30047161 Csnk2a2 Rat aristolochic acid A decreases expression ISO CSNK2A2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of CSNK2A2 mRNA CTD PMID:33212167 Csnk2a2 Rat aristolochic acid A increases expression ISO CSNK2A2 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of CSNK2A2 protein CTD PMID:33212167 Csnk2a2 Rat atrazine increases expression ISO CSNK2A2 (Homo sapiens) 6480464 Atrazine results in increased expression of CSNK2A2 mRNA CTD PMID:22378314 Csnk2a2 Rat benzo[a]pyrene increases expression ISO Csnk2a2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of CSNK2A2 mRNA CTD PMID:22228805 Csnk2a2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Csnk2a2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of CSNK2A2 mRNA CTD PMID:33754040 Csnk2a2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CSNK2A2 mRNA CTD PMID:25181051 Csnk2a2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of CSNK2A2 mRNA CTD PMID:36041667 Csnk2a2 Rat bisphenol A decreases expression ISO CSNK2A2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of CSNK2A2 protein CTD PMID:31675489 and PMID:37567409 Csnk2a2 Rat bisphenol A affects expression ISO CSNK2A2 (Homo sapiens) 6480464 bisphenol A affects the expression of CSNK2A2 mRNA CTD PMID:30903817 Csnk2a2 Rat bisphenol F increases expression ISO CSNK2A2 (Homo sapiens) 6480464 bisphenol F results in increased expression of CSNK2A2 mRNA CTD PMID:38568856 Csnk2a2 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of CSNK2A2 mRNA CTD PMID:36041667 Csnk2a2 Rat buspirone increases expression EXP 6480464 Buspirone results in increased expression of CSNK2A2 mRNA CTD PMID:24136188 Csnk2a2 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of CSNK2A2 mRNA CTD PMID:19167457 Csnk2a2 Rat cadmium dichloride decreases expression ISO CSNK2A2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of CSNK2A2 mRNA CTD PMID:25851441 Csnk2a2 Rat caffeine decreases expression EXP 6480464 Caffeine results in decreased expression of CSNK2A2 mRNA CTD PMID:20864626 Csnk2a2 Rat carbamazepine affects expression ISO CSNK2A2 (Homo sapiens) 6480464 Carbamazepine affects the expression of CSNK2A2 mRNA CTD PMID:24752500 Csnk2a2 Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of CSNK2A2 mRNA CTD PMID:23125180 Csnk2a2 Rat cisplatin multiple interactions ISO CSNK2A2 (Homo sapiens) 6480464 [Piroxicam co-treated with Cisplatin] results in decreased expression of CSNK2A2 mRNA CTD PMID:21858171 Csnk2a2 Rat clofibrate decreases expression ISO Csnk2a2 (Mus musculus) 6480464 Clofibrate results in decreased expression of CSNK2A2 mRNA CTD PMID:17585979 Csnk2a2 Rat cobalt dichloride increases expression ISO CSNK2A2 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of CSNK2A2 mRNA CTD PMID:19320972 and PMID:19376846 Csnk2a2 Rat copper atom multiple interactions ISO CSNK2A2 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of CSNK2A2 mRNA CTD PMID:30911355 Csnk2a2 Rat copper(0) multiple interactions ISO CSNK2A2 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of CSNK2A2 mRNA CTD PMID:30911355 Csnk2a2 Rat coumestrol decreases expression ISO CSNK2A2 (Homo sapiens) 6480464 Coumestrol results in decreased expression of CSNK2A2 mRNA CTD PMID:19167446 Csnk2a2 Rat cyclosporin A increases expression ISO CSNK2A2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of CSNK2A2 mRNA CTD PMID:25562108 Csnk2a2 Rat daidzein affects expression ISO Csnk2a2 (Mus musculus) 6480464 daidzein affects the expression of CSNK2A2 mRNA CTD PMID:15721199 Csnk2a2 Rat diazinon increases methylation ISO CSNK2A2 (Homo sapiens) 6480464 Diazinon results in increased methylation of CSNK2A2 gene CTD PMID:22964155 Csnk2a2 Rat diclofenac affects expression ISO CSNK2A2 (Homo sapiens) 6480464 Diclofenac affects the expression of CSNK2A2 mRNA CTD PMID:24752500 Csnk2a2 Rat diethylstilbestrol affects expression ISO Csnk2a2 (Mus musculus) 6480464 Diethylstilbestrol affects the expression of CSNK2A2 mRNA CTD PMID:15721199 Csnk2a2 Rat dorsomorphin multiple interactions ISO CSNK2A2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CSNK2A2 mRNA CTD PMID:27188386 Csnk2a2 Rat doxorubicin decreases expression ISO Csnk2a2 (Mus musculus) 6480464 Doxorubicin results in decreased expression of CSNK2A2 mRNA CTD PMID:16243910 Csnk2a2 Rat doxorubicin decreases expression ISO CSNK2A2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of CSNK2A2 mRNA CTD PMID:29803840 Csnk2a2 Rat ethyl methanesulfonate increases expression ISO CSNK2A2 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of CSNK2A2 mRNA CTD PMID:23649840 Csnk2a2 Rat fenthion decreases expression ISO Csnk2a2 (Mus musculus) 6480464 Fenthion results in decreased expression of CSNK2A2 mRNA CTD PMID:34813904 Csnk2a2 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of CSNK2A2 mRNA CTD PMID:24136188 Csnk2a2 Rat folic acid multiple interactions ISO Csnk2a2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CSNK2A2 mRNA CTD PMID:22206623 Csnk2a2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CSNK2A2 mRNA CTD PMID:22061828 Csnk2a2 Rat ivermectin decreases expression ISO CSNK2A2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of CSNK2A2 protein CTD PMID:32959892 Csnk2a2 Rat lead diacetate increases expression ISO Csnk2a2 (Mus musculus) 6480464 lead acetate results in increased expression of CSNK2A2 mRNA CTD PMID:22609695 Csnk2a2 Rat lead(0) decreases expression ISO CSNK2A2 (Homo sapiens) 6480464 Lead results in decreased expression of CSNK2A2 mRNA CTD PMID:19921347 Csnk2a2 Rat methidathion decreases expression ISO Csnk2a2 (Mus musculus) 6480464 methidathion results in decreased expression of CSNK2A2 mRNA CTD PMID:34813904 Csnk2a2 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of CSNK2A2 mRNA CTD PMID:30047161 Csnk2a2 Rat methoxyacetic acid affects expression EXP 6480464 methoxyacetic acid affects the expression of CSNK2A2 mRNA CTD PMID:20864626 Csnk2a2 Rat methoxyacetic acid decreases expression EXP 6480464 methoxyacetic acid results in decreased expression of CSNK2A2 mRNA CTD PMID:20864626 Csnk2a2 Rat methyl methanesulfonate increases expression ISO CSNK2A2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of CSNK2A2 mRNA CTD PMID:23649840 Csnk2a2 Rat methylmercury chloride decreases expression EXP 6480464 methylmercuric chloride results in decreased expression of CSNK2A2 mRNA CTD PMID:20864626 Csnk2a2 Rat Monobutylphthalate decreases expression EXP 6480464 monobutyl phthalate results in decreased expression of CSNK2A2 mRNA CTD PMID:20864626 Csnk2a2 Rat N-methyl-4-phenylpyridinium multiple interactions ISO CSNK2A2 (Homo sapiens) 6480464 U 0126 affects the reaction [1-Methyl-4-phenylpyridinium affects the expression of CSNK2A2 mRNA] CTD PMID:12710931 Csnk2a2 Rat N-Vinyl-2-pyrrolidone multiple interactions EXP 6480464 [N-vinyl-2-pyrrolidinone binds to N-vinyl-2-pyrrolidinone] which results in increased expression of CSNK2A2 mRNA CTD PMID:22037397 Csnk2a2 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of CSNK2A2 mRNA CTD PMID:22546817 Csnk2a2 Rat ozone multiple interactions ISO Csnk2a2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of CSNK2A2 mRNA CTD PMID:34911549 Csnk2a2 Rat ozone multiple interactions ISO CSNK2A2 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of CSNK2A2 mRNA CTD PMID:35430440 Csnk2a2 Rat paracetamol affects expression ISO Csnk2a2 (Mus musculus) 6480464 Acetaminophen affects the expression of CSNK2A2 mRNA CTD PMID:17562736 Csnk2a2 Rat paraquat increases expression ISO CSNK2A2 (Homo sapiens) 6480464 Paraquat results in increased expression of CSNK2A2 protein CTD PMID:26649146 Csnk2a2 Rat phytoestrogen affects expression ISO Csnk2a2 (Mus musculus) 6480464 Phytoestrogens affects the expression of CSNK2A2 mRNA CTD PMID:15721199 Csnk2a2 Rat pirinixic acid multiple interactions ISO Csnk2a2 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of CSNK2A2 mRNA CTD PMID:19710929 Csnk2a2 Rat piroxicam multiple interactions ISO CSNK2A2 (Homo sapiens) 6480464 [Piroxicam co-treated with Cisplatin] results in decreased expression of CSNK2A2 mRNA CTD PMID:21858171 Csnk2a2 Rat potassium chromate multiple interactions ISO CSNK2A2 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of CSNK2A2 mRNA CTD PMID:22079256 Csnk2a2 Rat potassium chromate increases expression ISO CSNK2A2 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of CSNK2A2 mRNA CTD PMID:22079256 Csnk2a2 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of CSNK2A2 mRNA CTD PMID:30047161 Csnk2a2 Rat propiconazole decreases expression ISO Csnk2a2 (Mus musculus) 6480464 propiconazole results in decreased expression of CSNK2A2 mRNA CTD PMID:21278054 Csnk2a2 Rat quercetin increases expression ISO CSNK2A2 (Homo sapiens) 6480464 Quercetin results in increased expression of CSNK2A2 mRNA CTD PMID:21632981 Csnk2a2 Rat quercitrin affects expression ISO CSNK2A2 (Homo sapiens) 6480464 quercitrin affects the expression of CSNK2A2 mRNA CTD PMID:25193878 Csnk2a2 Rat rac-lactic acid decreases expression ISO CSNK2A2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of CSNK2A2 mRNA CTD PMID:30851411 Csnk2a2 Rat resveratrol increases expression ISO CSNK2A2 (Homo sapiens) 6480464 resveratrol results in increased expression of CSNK2A2 mRNA CTD PMID:19371625 Csnk2a2 Rat resveratrol decreases expression EXP 6480464 Resveratrol results in decreased expression of CSNK2A2 mRNA CTD PMID:33775663 Csnk2a2 Rat rotenone increases expression ISO CSNK2A2 (Homo sapiens) 6480464 Rotenone results in increased expression of CSNK2A2 mRNA CTD PMID:32368861 Csnk2a2 Rat SB 431542 multiple interactions ISO CSNK2A2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CSNK2A2 mRNA CTD PMID:27188386 Csnk2a2 Rat sodium arsenite increases expression ISO CSNK2A2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of CSNK2A2 mRNA and sodium arsenite results in increased expression of CSNK2A2 protein CTD PMID:18572023 and PMID:38568856 Csnk2a2 Rat sodium arsenite multiple interactions ISO CSNK2A2 (Homo sapiens) 6480464 sodium arsenite promotes the reaction [CSNK2A2 protein binds to CAPRIN1 protein] CTD PMID:33939924 Csnk2a2 Rat staurosporine affects expression ISO Csnk2a2 (Mus musculus) 6480464 Staurosporine affects the expression of CSNK2A2 mRNA CTD PMID:15721199 Csnk2a2 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of CSNK2A2 mRNA CTD PMID:30047161 Csnk2a2 Rat sulindac increases expression ISO CSNK2A2 (Homo sapiens) 6480464 Sulindac results in increased expression of CSNK2A2 mRNA CTD PMID:11906190 Csnk2a2 Rat sunitinib increases expression ISO CSNK2A2 (Homo sapiens) 6480464 Sunitinib results in increased expression of CSNK2A2 mRNA CTD PMID:31533062 Csnk2a2 Rat thapsigargin increases expression ISO CSNK2A2 (Homo sapiens) 6480464 Thapsigargin results in increased expression of CSNK2A2 mRNA CTD PMID:22378314 Csnk2a2 Rat thiram increases expression ISO CSNK2A2 (Homo sapiens) 6480464 Thiram results in increased expression of CSNK2A2 mRNA CTD PMID:38568856 Csnk2a2 Rat trichostatin A decreases expression ISO CSNK2A2 (Homo sapiens) 6480464 trichostatin A results in decreased expression of CSNK2A2 mRNA CTD PMID:26272509 Csnk2a2 Rat trichostatin A multiple interactions ISO CSNK2A2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of CSNK2A2 mRNA CTD PMID:27188386 Csnk2a2 Rat triphenyl phosphate affects expression ISO CSNK2A2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CSNK2A2 mRNA CTD PMID:37042841 Csnk2a2 Rat troglitazone decreases expression ISO Csnk2a2 (Mus musculus) 6480464 troglitazone results in decreased expression of CSNK2A2 mRNA CTD PMID:28973697 Csnk2a2 Rat tunicamycin increases expression ISO CSNK2A2 (Homo sapiens) 6480464 Tunicamycin results in increased expression of CSNK2A2 mRNA CTD PMID:22378314 Csnk2a2 Rat urethane increases expression ISO CSNK2A2 (Homo sapiens) 6480464 Urethane results in increased expression of CSNK2A2 mRNA CTD PMID:28818685 Csnk2a2 Rat valproic acid affects expression ISO CSNK2A2 (Homo sapiens) 6480464 Valproic Acid affects the expression of CSNK2A2 mRNA CTD PMID:25979313 Csnk2a2 Rat valproic acid increases expression ISO CSNK2A2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of CSNK2A2 mRNA CTD PMID:29154799 Csnk2a2 Rat vanadium atom decreases expression ISO CSNK2A2 (Homo sapiens) 6480464 Vanadium results in decreased expression of CSNK2A2 mRNA CTD PMID:19000753 Csnk2a2 Rat vanadium(0) decreases expression ISO CSNK2A2 (Homo sapiens) 6480464 Vanadium results in decreased expression of CSNK2A2 mRNA CTD PMID:19000753 Csnk2a2 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of CSNK2A2 mRNA CTD PMID:19015723
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) aristolochic acid A (ISO) atrazine (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) buspirone (EXP) C60 fullerene (EXP) cadmium dichloride (ISO) caffeine (EXP) carbamazepine (ISO) chloroprene (EXP) cisplatin (ISO) clofibrate (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) coumestrol (ISO) cyclosporin A (ISO) daidzein (ISO) diazinon (ISO) diclofenac (ISO) diethylstilbestrol (ISO) dorsomorphin (ISO) doxorubicin (ISO) ethyl methanesulfonate (ISO) fenthion (ISO) flutamide (EXP) folic acid (ISO) gentamycin (EXP) ivermectin (ISO) lead diacetate (ISO) lead(0) (ISO) methidathion (ISO) methimazole (EXP) methoxyacetic acid (EXP) methyl methanesulfonate (ISO) methylmercury chloride (EXP) Monobutylphthalate (EXP) N-methyl-4-phenylpyridinium (ISO) N-Vinyl-2-pyrrolidone (EXP) nickel dichloride (EXP) ozone (ISO) paracetamol (ISO) paraquat (ISO) phytoestrogen (ISO) pirinixic acid (ISO) piroxicam (ISO) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) propiconazole (ISO) quercetin (ISO) quercitrin (ISO) rac-lactic acid (ISO) resveratrol (EXP,ISO) rotenone (ISO) SB 431542 (ISO) sodium arsenite (ISO) staurosporine (ISO) sulfadimethoxine (EXP) sulindac (ISO) sunitinib (ISO) thapsigargin (ISO) thiram (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) troglitazone (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (ISO) vanadium atom (ISO) vanadium(0) (ISO) vinclozolin (EXP)
1.
Differential localization of alpha' and beta subunits of protein kinase CK2 during rat spermatogenesis.
Alvarado-Diaz CP, etal., Cell Tissue Res. 2009 Oct;338(1):139-49. doi: 10.1007/s00441-009-0847-1. Epub 2009 Aug 27.
2.
Regulation of protein kinase CK2 isoform expression during rat brain development.
Diaz-Nido J, etal., Cell Mol Biol Res. 1994;40(5-6):581-5.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Expression of protein kinase CK2 in astroglial cells of normal and neovascularized retina.
Kramerov AA, etal., Am J Pathol. 2006 May;168(5):1722-36.
6.
Role of autophosphorylation in regulation of protein kinase CK2 from rat neuronal chromatin.
Kulikova OG and Reikhardt BA, Biochemistry (Mosc). 1998 Dec;63(12):1400-6.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
Changes in the activity of nuclear protein kinase CK2 during rat liver regeneration.
Pancetti F, etal., Biochem Biophys Res Commun. 1996 Jan 5;218(1):35-9.
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
11.
GOA pipeline
RGD automated data pipeline
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Comprehensive gene review and curation
RGD comprehensive gene curation
14.
The tight association of protein kinase CK2 with plasma membranes is mediated by a specific domain of its regulatory beta-subunit.
Sarrouilhe D, etal., Biochim Biophys Acta. 1998 Jun 22;1403(2):199-210.
15.
Selective removal of mitochondria via mitophagy: distinct pathways for different mitochondrial stresses.
Wei H, etal., Biochim Biophys Acta. 2015 Oct;1853(10 Pt B):2784-90. doi: 10.1016/j.bbamcr.2015.03.013. Epub 2015 Apr 1.
Csnk2a2 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 9,562,340 - 9,602,136 (+) NCBI GRCr8 mRatBN7.2 19 9,556,443 - 9,596,080 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 9,556,260 - 9,596,080 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 9,521,860 - 9,561,150 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 10,288,686 - 10,327,976 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 9,575,016 - 9,614,306 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 9,972,537 - 10,012,043 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 9,972,537 - 10,012,043 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 9,956,494 - 9,996,397 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 10,015,369 - 10,054,662 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 10,020,174 - 10,054,722 (+) NCBI Celera 19 9,448,494 - 9,487,786 (+) NCBI Celera Cytogenetic Map 19 p13 NCBI
CSNK2A2 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 58,157,907 - 58,198,106 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 58,157,907 - 58,198,106 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 58,191,811 - 58,232,010 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 56,749,312 - 56,789,283 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 56,749,314 - 56,789,283 NCBI Celera 16 42,691,263 - 42,731,230 (-) NCBI Celera Cytogenetic Map 16 q21 NCBI HuRef 16 44,059,729 - 44,099,930 (-) NCBI HuRef CHM1_1 16 59,598,846 - 59,638,724 (-) NCBI CHM1_1 T2T-CHM13v2.0 16 63,953,540 - 63,993,732 (-) NCBI T2T-CHM13v2.0
Csnk2a2 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 96,172,724 - 96,215,505 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 96,172,724 - 96,216,667 (-) Ensembl GRCm39 Ensembl GRCm38 8 95,446,096 - 95,488,868 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 95,446,096 - 95,490,039 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 97,969,996 - 98,012,720 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 98,337,101 - 98,377,919 (-) NCBI MGSCv36 mm8 Celera 8 99,760,768 - 99,802,427 (-) NCBI Celera Cytogenetic Map 8 C5- D1 NCBI cM Map 8 47.12 NCBI
Csnk2a2 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955433 15,674,116 - 15,718,894 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955433 15,677,788 - 15,718,894 (-) NCBI ChiLan1.0 ChiLan1.0
CSNK2A2 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 67,620,768 - 67,660,961 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 73,541,651 - 73,581,859 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 38,426,399 - 38,466,575 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 57,557,262 - 57,596,218 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 57,557,270 - 57,596,218 (-) Ensembl panpan1.1 panPan2
CSNK2A2 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 58,361,328 - 58,441,701 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 58,360,838 - 58,432,371 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 54,991,254 - 55,071,046 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 58,899,781 - 58,979,588 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 58,899,298 - 58,971,571 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 55,731,413 - 55,811,164 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 56,739,015 - 56,818,751 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 57,631,725 - 57,711,511 (+) NCBI UU_Cfam_GSD_1.0
Csnk2a2 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 49,513,855 - 49,558,667 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936475 10,033,717 - 10,075,511 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936475 10,030,408 - 10,073,576 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CSNK2A2 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 19,976,930 - 20,016,923 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 19,975,030 - 20,016,768 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 17,998,939 - 18,074,082 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CSNK2A2 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 44,093,320 - 44,133,352 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 44,093,215 - 44,133,335 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 32,045,388 - 32,085,772 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Csnk2a2 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 312 Count of miRNA genes: 188 Interacting mature miRNAs: 228 Transcripts: ENSRNOT00000016386 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549847 Bss8 Bone structure and strength QTL 8 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 19 1 31963836 Rat 8552935 Pigfal10 Plasma insulin-like growth factor 1 level QTL 10 5.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 19 1 36824771 Rat 61447 Tcas1 Tongue tumor susceptibility QTL 1 6.08 tongue integrity trait (VT:0010553) squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875) 19 2316121 47316121 Rat 631681 Cm12 Cardiac mass QTL 12 3.33 0.00053 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 19 1 28982497 Rat 9590298 Uminl5 Urine mineral level QTL 5 3.59 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 19 1 36824771 Rat 10054132 Srcrt9 Stress Responsive Cort QTL 9 2.87 0.0017 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 27355345 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 724518 Uae19 Urinary albumin excretion QTL 19 5.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 7457249 42983518 Rat 8694186 Bw152 Body weight QTL 152 3.34 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 569374 45569374 Rat 7411590 Foco7 Food consumption QTL 7 6.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 19 1 24688055 Rat 631678 Cm9 Cardiac mass QTL 9 4.27 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 19 1 28982497 Rat 9590250 Scort11 Serum corticosterone level QTL 11 23.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 36824771 Rat 9590090 Insglur8 Insulin/glucose ratio QTL 8 10.81 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 19 1 36824771 Rat 2317848 Alcrsp21 Alcohol response QTL 21 1.899999976158142 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 19 3204777 48204777 Rat 9589102 Slep13 Serum leptin concentration QTL 13 4.63 0.001 blood leptin amount (VT:0005667) plasma leptin level (CMO:0000781) 19 569374 45569374 Rat 7247442 Uae39 Urinary albumin excretion QTL 39 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 2187927 46708701 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat
RH132275
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 9,594,284 - 9,594,478 (+) MAPPER mRatBN7.2 Rnor_6.0 19 10,010,248 - 10,010,441 NCBI Rnor6.0 Rnor_5.0 19 9,994,602 - 9,994,795 UniSTS Rnor5.0 RGSC_v3.4 19 10,052,867 - 10,053,060 UniSTS RGSC3.4 Celera 19 9,485,991 - 9,486,184 UniSTS RH 3.4 Map 19 93.0 UniSTS Cytogenetic Map 19 p13 UniSTS
RH134385
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 19 9,576,342 - 9,576,537 (+) MAPPER mRatBN7.2 Rnor_6.0 19 9,992,306 - 9,992,500 NCBI Rnor6.0 Rnor_5.0 19 9,976,660 - 9,976,854 UniSTS Rnor5.0 RGSC_v3.4 19 10,034,925 - 10,035,119 UniSTS RGSC3.4 Celera 19 9,468,048 - 9,468,242 UniSTS RH 3.4 Map 19 93.39 UniSTS Cytogenetic Map 19 p13 UniSTS
BE107780
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 19 9,584,378 - 9,584,536 (+) Marker Load Pipeline mRatBN7.2 19 9,578,322 - 9,578,480 (+) MAPPER mRatBN7.2 Rnor_6.0 19 9,994,286 - 9,994,443 NCBI Rnor6.0 Rnor_5.0 19 9,978,640 - 9,978,797 UniSTS Rnor5.0 RGSC_v3.4 19 10,036,905 - 10,037,062 UniSTS RGSC3.4 Celera 19 9,470,028 - 9,470,185 UniSTS RH 3.4 Map 19 90.3 UniSTS Cytogenetic Map 19 p13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016386 ⟹ ENSRNOP00000016386
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 9,556,260 - 9,596,080 (+) Ensembl Rnor_6.0 Ensembl 19 9,972,537 - 10,012,043 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107442 ⟹ ENSRNOP00000097267
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 9,556,260 - 9,596,080 (+) Ensembl
RefSeq Acc Id:
NM_001107409 ⟹ NP_001100879
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,562,716 - 9,602,136 (+) NCBI mRatBN7.2 19 9,556,655 - 9,596,080 (+) NCBI Rnor_6.0 19 9,972,537 - 10,012,043 (+) NCBI Rnor_5.0 19 9,956,494 - 9,996,397 (+) NCBI RGSC_v3.4 19 10,015,369 - 10,054,662 (+) RGD Celera 19 9,448,494 - 9,487,786 (+) RGD
Sequence:
ATGCCCGGCCCGGCCGCGGGCAGTCGGGCCCGGGTCTACTCCGAGGTGAACAGCCTGAGGAGCCGCGAGTACTGGGACTACGAAGCCCACGTCCCGAGCTGGGGTAATCAAGATGATTACCAACTGGT TCGAAAACTTGGTCGGGGCAAGTATAGTGAAGTATTTGAGGCCATTAACATCACCAACAATGAGAGGGTGGTTGTAAAAATTCTCAAGCCAGTGAAGAAAAAGAAGATAAAACGAGAGGTTAAGATTC TGGAGAACCTTCGTGGTGGAACAAATATCATTAAGCTGATTGACACTGTAAAGGACCCTGTGTCAAAGACACCAGCTTTGGTATTTGAATATATCAATAATACAGATTTTAAGCAACTCTACCAGATC CTGACTGACTTTGATATCCGGTTTTATATGTATGAACTACTTAAAGCTCTGGATTACTGCCACAGCAAGGGAATCATGCACAGGGATGTGAAACCTCACAATGTCATGATAGATCACCAACAAAAAAA GCTCCGGCTGATTGACTGGGGTTTGGCAGAATTCTACCATCCTGCTCAGGAGTACAATGTCCGAGTGGCCTCGAGGTACTTCAAGGGACCAGAGCTCCTTGTGGACTATCAGATGTATGATTACAGCT TGGATATGTGGAGCTTGGGCTGTATGTTAGCAAGCATGATATTCCGAAAGGAGCCATTCTTCCATGGGCAGGACAACTATGACCAGCTTGTTCGAATTGCCAAGGTTCTGGGGACAGATGACCTGTAT GGGTATCTGAAGAAGTACCACATAGACCTAGACCCACACTTCAATGATATCCTGGGACAGCATTCACGGAAGCGCTGGGAAAACTTTATCCATAGTGAGAACAGACACCTTGTCAGCCCCGAGGCCCT TGATCTTCTTGACAAGCTCCTGCGGTACGACCATCAACAGAGATTGACCGCCAAAGAGGCCATGGAGCACCCGTACTTCTACCCGGTGGTGAAGGAGCAGTCCCAGCCTTGTGCTGAGAACACCGTGC TTTCCAGTGGTCTCACCGCAGCACGATGAAGCCTGGGGAATCGACGGTCTGTTGCGGTTCCTCCCACTTTTCCATAAGCAGAACAAGAACCAAATCAAAACGTCTTAACGCGTGTAGCGAGATCACGT CCCGAGAGCAGACACAAAATGGTGGCAGGCTTGGCGAACAGGAACTAGACCACCCGAAGGGCAGCCCACCACCGTAAATCAGACCTCACTTCCGAATGTAAAAGGTTCACATGCCTTTGGCTTCCTGT TGACTTCCTCCTGACCCAGAAAGCATGGGAAATGTGAAGGGTATGCAAAAATGGTTGTTGGTTACTGTTGCTCTCCGTGCCCTCGACCCATCCCGTGGCTGCCTGTTGCTCCAGCAAACCCCAAGGAC TAGCTGACCACAGACCACAAATGGGATGGGGGCAGTGTATGGCATGGTGGGCAGTTACATATTATTTTAAAAGTATATATATTATTGAATAAAACGTTTTAAAAGAAGTG
hide sequence
RefSeq Acc Id:
XM_039097690 ⟹ XP_038953618
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,562,340 - 9,602,133 (+) NCBI mRatBN7.2 19 9,556,443 - 9,596,077 (+) NCBI
RefSeq Acc Id:
XM_039097691 ⟹ XP_038953619
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,562,591 - 9,602,133 (+) NCBI mRatBN7.2 19 9,556,443 - 9,596,077 (+) NCBI
RefSeq Acc Id:
XM_039097692 ⟹ XP_038953620
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,562,340 - 9,602,133 (+) NCBI mRatBN7.2 19 9,556,443 - 9,596,077 (+) NCBI
RefSeq Acc Id:
XM_039097693 ⟹ XP_038953621
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,562,592 - 9,602,133 (+) NCBI mRatBN7.2 19 9,556,443 - 9,596,077 (+) NCBI
RefSeq Acc Id:
XM_039097694 ⟹ XP_038953622
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,562,340 - 9,602,133 (+) NCBI mRatBN7.2 19 9,556,443 - 9,596,077 (+) NCBI
RefSeq Acc Id:
XM_039097695 ⟹ XP_038953623
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,562,861 - 9,602,133 (+) NCBI mRatBN7.2 19 9,556,887 - 9,596,077 (+) NCBI
RefSeq Acc Id:
XM_063277979 ⟹ XP_063134049
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,562,342 - 9,602,133 (+) NCBI
RefSeq Acc Id:
XM_063277980 ⟹ XP_063134050
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,562,341 - 9,602,133 (+) NCBI
RefSeq Acc Id:
XM_063277981 ⟹ XP_063134051
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 9,562,827 - 9,600,452 (+) NCBI
RefSeq Acc Id:
NP_001100879 ⟸ NM_001107409
- UniProtKB:
A6JY05 (UniProtKB/TrEMBL), B4F7A9 (UniProtKB/TrEMBL)
- Sequence:
MPGPAAGSRARVYSEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQI LTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGQDNYDQLVRIAKVLGTDDLY GYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCAENTVLSSGLTAAR
hide sequence
Ensembl Acc Id:
ENSRNOP00000016386 ⟸ ENSRNOT00000016386
RefSeq Acc Id:
XP_038953619 ⟸ XM_039097691
- Peptide Label:
isoform X2
- UniProtKB:
B4F7A9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953618 ⟸ XM_039097690
- Peptide Label:
isoform X1
- UniProtKB:
B4F7A9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953620 ⟸ XM_039097692
- Peptide Label:
isoform X3
- UniProtKB:
B4F7A9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953621 ⟸ XM_039097693
- Peptide Label:
isoform X4
- UniProtKB:
B4F7A9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953622 ⟸ XM_039097694
- Peptide Label:
isoform X6
RefSeq Acc Id:
XP_038953623 ⟸ XM_039097695
- Peptide Label:
isoform X5
Ensembl Acc Id:
ENSRNOP00000097267 ⟸ ENSRNOT00000107442
RefSeq Acc Id:
XP_063134050 ⟸ XM_063277980
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063134049 ⟸ XM_063277979
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063134051 ⟸ XM_063277981
- Peptide Label:
isoform X5
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-01-27
Csnk2a2
casein kinase 2 alpha 2
Csnk2a2
casein kinase 2, alpha prime polypeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-03-03
Csnk2a2
casein kinase 2, alpha prime polypeptide
Csnk2a2_predicted
casein kinase II, alpha 2, polypeptide (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2005-01-12
Csnk2a2_predicted
casein kinase II, alpha 2, polypeptide (predicted)
Symbol and Name status set to approved
70820
APPROVED