Symbol:
STAT5B
Name:
signal transducer and activator of transcription 5B
RGD ID:
730906
HGNC Page
HGNC:11367
Description:
Enables DNA-binding transcription activator activity, RNA polymerase II-specific; nuclear glucocorticoid receptor binding activity; and protein homodimerization activity. Involved in cell surface receptor signaling pathway; positive regulation of erythrocyte differentiation; and response to estradiol. Located in cytoplasm and nucleus. Implicated in colon adenocarcinoma; colorectal adenocarcinoma; growth hormone insensitivity syndrome with immune dysregulation 1; and growth hormone insensitivity syndrome with immune dysregulation 2. Biomarker of colorectal adenocarcinoma; gastric adenocarcinoma; hepatocellular carcinoma; and lung non-small cell carcinoma.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
GHISID2; STAT5; transcription factor STAT5B
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Stat5b (signal transducer and activator of transcription 5B) HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Stat5b (signal transducer and activator of transcription 5B) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Stat5b (signal transducer and activator of transcription 5B) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
LOC100989105 (signal transducer and activator of transcription 5B) NCBI
Ortholog
Canis lupus familiaris (dog):
STAT5B (signal transducer and activator of transcription 5B) HGNC
Ensembl, HomoloGene, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
LOC101954516 (signal transducer and activator of transcription 5B) NCBI
Ortholog
Sus scrofa (pig):
STAT5B (signal transducer and activator of transcription 5B) HGNC
Ensembl, Inparanoid, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
LOC103243413 (signal transducer and activator of transcription 5B) NCBI
Ortholog
Other homologs 2
Mus musculus (house mouse):
Stat5a (signal transducer and activator of transcription 5A) HGNC
OrthoDB, OrthoMCL
Rattus norvegicus (Norway rat):
Stat5a (signal transducer and activator of transcription 5A) HGNC
OrthoDB
Sus scrofa (pig):
STAT5A (signal transducer and activator of transcription 5A) HGNC
OrthoDB
Rattus norvegicus (Norway rat):
P4ha2 (prolyl 4-hydroxylase subunit alpha 2) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Stat5b (signal transducer and activator of transcription 5B)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Stat5b (signal transducer and activator of transcription 5B)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
stat5b (signal transducer and activator of transcription 5b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
stat5a (signal transducer and activator of transcription 5a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
Stat92E
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
sta-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
sta-2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Xenopus laevis (African clawed frog):
stat5b.S
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
stat5b
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus laevis (African clawed frog):
stat5b.L
Alliance
DIOPT (Xenbase)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 42,199,177 - 42,288,370 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 42,199,176 - 42,288,633 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 40,351,195 - 40,428,409 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 37,604,721 - 37,681,950 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 37,604,721 - 37,681,950 NCBI Celera 17 37,005,458 - 37,083,308 (-) NCBI Celera Cytogenetic Map 17 q21.2 NCBI HuRef 17 36,116,230 - 36,193,344 (-) NCBI HuRef CHM1_1 17 40,586,923 - 40,664,134 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 43,055,661 - 43,144,521 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
STAT5B Human (+)-catechin increases expression EXP 6480464 Catechin results in increased expression of STAT5B mRNA CTD PMID:15465739 STAT5B Human (1->4)-beta-D-glucan multiple interactions ISO Stat5b (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of STAT5B mRNA CTD PMID:36331819 STAT5B Human (S)-nicotine increases expression EXP 6480464 Nicotine results in increased expression of STAT5B mRNA CTD PMID:18805435 STAT5B Human 1,2-dimethylhydrazine decreases expression ISO Stat5b (Rattus norvegicus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of STAT5B mRNA CTD PMID:32387197 STAT5B Human 1,2-dimethylhydrazine multiple interactions ISO Stat5b (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of STAT5B mRNA CTD PMID:22206623 STAT5B Human 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile increases expression ISO Stat5b (Rattus norvegicus) 6480464 Citalopram results in increased expression of STAT5B mRNA CTD PMID:28467792 STAT5B Human 1-benzofuran increases activity ISO Stat5b (Mus musculus) 6480464 benzofuran results in increased activity of STAT5B protein CTD PMID:30114225 STAT5B Human 1-chloro-2,4-dinitrobenzene increases expression EXP 6480464 Dinitrochlorobenzene results in increased expression of STAT5B mRNA CTD PMID:17374397 STAT5B Human 1-tert-Butoxy-2-propanol affects activity ISO Stat5b (Mus musculus) 6480464 propylene glycol mono-t-butyl ether affects the activity of STAT5B protein CTD PMID:30114225 STAT5B Human 17alpha-ethynylestradiol decreases activity ISO Stat5b (Mus musculus) 6480464 Ethinyl Estradiol results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human 17beta-estradiol decreases activity ISO Stat5b (Mus musculus) 6480464 Estradiol results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human 17beta-estradiol increases expression ISO Stat5b (Mus musculus) 6480464 Estradiol results in increased expression of STAT5B mRNA CTD PMID:39298647 STAT5B Human 17beta-estradiol 3-benzoate increases methylation ISO Stat5b (Rattus norvegicus) 6480464 estradiol 3-benzoate results in increased methylation of STAT5B promoter CTD PMID:27415467 STAT5B Human 17beta-hydroxy-5alpha-androstan-3-one increases activity ISO Stat5b (Mus musculus) 6480464 Dihydrotestosterone results in increased activity of STAT5B protein CTD PMID:30114225 STAT5B Human 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:31675489 STAT5B Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Stat5b (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of STAT5B mRNA CTD PMID:24058054 STAT5B Human 2,3,7,8-tetrachlorodibenzodioxine decreases activity ISO Stat5b (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Stat5b (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression of STAT5B mRNA CTD PMID:25975270 STAT5B Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Stat5b (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin affects the expression of STAT5B mRNA CTD PMID:22298810 STAT5B Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Stat5b (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of STAT5B mRNA CTD PMID:11752688 and PMID:21215274 STAT5B Human 2,3,7,8-tetrachlorodibenzodioxine decreases phosphorylation ISO Stat5b (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased phosphorylation of STAT5B protein CTD PMID:19490989 STAT5B Human 2,4,6-tribromophenol decreases expression EXP 6480464 2 more ... CTD PMID:31675489 STAT5B Human 2-amino-2-deoxy-D-galactopyranose decreases activity ISO Stat5b (Mus musculus) 6480464 Galactosamine results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human 2-nitrotoluene decreases activity ISO Stat5b (Mus musculus) 6480464 2-nitrotoluene results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human 3,3',5,5'-tetrabromobisphenol A decreases expression EXP 6480464 tetrabromobisphenol A results in decreased expression of STAT5B protein CTD PMID:31675489 STAT5B Human 3,3',5-triiodo-L-thyronine increases expression ISO Stat5b (Rattus norvegicus) 6480464 Triiodothyronine results in increased expression of STAT5B mRNA CTD PMID:15953391 STAT5B Human 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Stat5b (Mus musculus) 6480464 (+)-JQ1 compound inhibits the reaction [[INS1 protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine] results in increased phosphorylation of STAT5B protein] and [INS1 protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine] results in increased phosphorylation of STAT5B protein CTD PMID:26972250 STAT5B Human 3-methylcholanthrene multiple interactions EXP 6480464 Methylcholanthrene promotes the reaction [AHR protein binds to STAT5B promoter] CTD PMID:20348232 STAT5B Human 4,4'-sulfonyldiphenol decreases expression ISO Stat5b (Mus musculus) 6480464 bisphenol S results in decreased expression of STAT5B mRNA CTD PMID:39298647 STAT5B Human 4,4'-sulfonyldiphenol decreases methylation EXP 6480464 bisphenol S results in decreased methylation of STAT5B gene CTD PMID:38338858 STAT5B Human 4-vinylcyclohexene dioxide affects expression ISO Stat5b (Mus musculus) 6480464 4-vinyl-1-cyclohexene dioxide affects the expression of STAT5B mRNA CTD PMID:20829426 STAT5B Human 6-propyl-2-thiouracil decreases expression ISO Stat5b (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of STAT5B mRNA CTD PMID:24780913 STAT5B Human acetamide decreases expression ISO Stat5b (Rattus norvegicus) 6480464 acetamide results in decreased expression of STAT5B mRNA CTD PMID:31881176 STAT5B Human acetylsalicylic acid decreases expression EXP 6480464 Aspirin results in decreased expression of STAT5B mRNA CTD PMID:15928584 STAT5B Human acrylamide increases expression ISO Stat5b (Rattus norvegicus) 6480464 Acrylamide results in increased expression of STAT5B mRNA CTD PMID:28959563 STAT5B Human aflatoxin B1 increases expression ISO Stat5b (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of STAT5B mRNA CTD PMID:19770486 STAT5B Human aflatoxin B1 decreases methylation EXP 6480464 Aflatoxin B1 results in decreased methylation of STAT5B gene CTD PMID:27153756 STAT5B Human all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of STAT5B mRNA CTD PMID:15498508 and PMID:33167477 STAT5B Human alpha-naphthoflavone multiple interactions EXP 6480464 [alpha-naphthoflavone binds to and results in decreased activity of AHR protein] inhibits the reaction [Hexachlorobenzene results in increased phosphorylation of and results in increased activity of STAT5B protein] CTD PMID:21205633 STAT5B Human ammonium chloride affects expression ISO Stat5b (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of STAT5B mRNA CTD PMID:16483693 STAT5B Human androst-4-ene-3,17-dione increases activity ISO Stat5b (Mus musculus) 6480464 Androstenedione results in increased activity of STAT5B protein CTD PMID:28973534 STAT5B Human AP20187 decreases activity ISO Stat5b (Mus musculus) 6480464 AP20187 results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human arsane multiple interactions EXP 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of STAT5B mRNA CTD PMID:39836092 STAT5B Human arsenic atom multiple interactions EXP 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of STAT5B mRNA CTD PMID:39836092 STAT5B Human arsenous acid multiple interactions EXP 6480464 Arsenic Trioxide results in decreased phosphorylation of and results in decreased activity of STAT5B protein CTD PMID:17121903 STAT5B Human arsenous acid decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of STAT5B protein CTD PMID:18349030 STAT5B Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of STAT5B promoter CTD PMID:27901495 STAT5B Human benzo[a]pyrene decreases activity ISO Stat5b (Mus musculus) 6480464 Benzo(a)pyrene results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human benzoates multiple interactions EXP 6480464 Benzoates analog binds to and results in decreased phosphorylation of STAT5B protein CTD PMID:29472718 STAT5B Human bezafibrate decreases activity ISO Stat5b (Mus musculus) 6480464 Bezafibrate results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human bis(2-ethylhexyl) phthalate decreases activity ISO Stat5b (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [Diethylhexyl Phthalate results in increased abundance of mono(2-ethyl-5-hydroxyhexyl) phthalate] which results in increased expression of STAT5B mRNA more ... CTD PMID:37093692 STAT5B Human bis(2-ethylhexyl) phthalate increases expression ISO Stat5b (Rattus norvegicus) 6480464 Diethylhexyl Phthalate results in increased expression of STAT5B mRNA CTD PMID:31732953 STAT5B Human bis(2-ethylhexyl) phthalate affects expression ISO Stat5b (Rattus norvegicus) 6480464 Diethylhexyl Phthalate affects the expression of STAT5B protein CTD PMID:31732953 STAT5B Human bis(2-ethylhexyl) phthalate decreases phosphorylation ISO Stat5b (Rattus norvegicus) 6480464 Diethylhexyl Phthalate results in decreased phosphorylation of STAT5B protein CTD PMID:31732953 STAT5B Human bis(2-ethylhexyl) phthalate multiple interactions ISO Stat5b (Rattus norvegicus) 6480464 [Dietary Fats co-treated with Diethylhexyl Phthalate] affects the expression of STAT5B protein more ... CTD PMID:31732953 STAT5B Human bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of STAT5B mRNA CTD PMID:22576693 STAT5B Human bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of STAT5B gene CTD PMID:38338858 STAT5B Human bisphenol A increases expression ISO Stat5b (Mus musculus) 6480464 bisphenol A results in increased expression of STAT5B mRNA CTD PMID:33221593 STAT5B Human bisphenol A increases expression ISO Stat5b (Rattus norvegicus) 6480464 bisphenol A results in increased expression of STAT5B mRNA CTD PMID:32145629 STAT5B Human bisphenol A decreases expression ISO Stat5b (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of STAT5B mRNA CTD PMID:30816183 STAT5B Human bisphenol A affects methylation ISO Stat5b (Mus musculus) 6480464 bisphenol A affects the methylation of STAT5B promoter CTD PMID:27334623 STAT5B Human bisphenol A increases methylation ISO Stat5b (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of STAT5B gene CTD PMID:28505145 STAT5B Human bisphenol A affects expression ISO Stat5b (Rattus norvegicus) 6480464 bisphenol A affects the expression of STAT5B mRNA CTD PMID:25181051 STAT5B Human bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of STAT5B gene CTD PMID:22576693 STAT5B Human bisphenol F decreases methylation EXP 6480464 bisphenol F results in decreased methylation of STAT5B gene CTD PMID:38338858 STAT5B Human butyric acid increases expression EXP 6480464 Butyric Acid results in increased expression of STAT5B mRNA CTD PMID:34581912 STAT5B Human cadmium acetate affects expression ISO Stat5b (Rattus norvegicus) 6480464 cadmium acetate affects the expression of STAT5B mRNA CTD PMID:16249259 STAT5B Human cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of STAT5B mRNA CTD PMID:38568856 STAT5B Human caffeine decreases phosphorylation EXP 6480464 Caffeine results in decreased phosphorylation of STAT5B protein CTD PMID:35688186 STAT5B Human carbamazepine affects expression EXP 6480464 Carbamazepine affects the expression of STAT5B mRNA CTD PMID:24752500 STAT5B Human carbon nanotube decreases expression ISO Stat5b (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 STAT5B Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to STAT5B gene] CTD PMID:28238834 STAT5B Human ciprofibrate decreases activity ISO Stat5b (Mus musculus) 6480464 ciprofibrate results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human citalopram increases expression ISO Stat5b (Rattus norvegicus) 6480464 Citalopram results in increased expression of STAT5B mRNA CTD PMID:28467792 STAT5B Human cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of STAT5B mRNA CTD PMID:19320972 STAT5B Human cocaine affects expression ISO Stat5b (Rattus norvegicus) 6480464 Cocaine affects the expression of STAT5B mRNA CTD PMID:20187946 STAT5B Human coumarin increases activity ISO Stat5b (Mus musculus) 6480464 coumarin results in increased activity of STAT5B protein CTD PMID:30114225 STAT5B Human curcumin increases cleavage EXP 6480464 Curcumin results in increased cleavage of STAT5B protein CTD PMID:16959222 STAT5B Human curcumin decreases expression EXP 6480464 Curcumin results in decreased expression of STAT5B protein CTD PMID:16959222 STAT5B Human cyclophosphamide decreases expression ISO Stat5b (Mus musculus) 6480464 Cyclophosphamide results in decreased expression of STAT5B mRNA CTD PMID:21041162 STAT5B Human cyproconazole decreases activity ISO Stat5b (Mus musculus) 6480464 cyproconazole results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human DDE increases activity EXP 6480464 Dichlorodiphenyl Dichloroethylene results in increased activity of STAT5B protein CTD PMID:27589886 STAT5B Human dexamethasone increases activity EXP 6480464 Dexamethasone results in increased activity of STAT5B protein CTD PMID:14632786 STAT5B Human dexamethasone multiple interactions ISO Stat5b (Mus musculus) 6480464 (+)-JQ1 compound inhibits the reaction [[INS1 protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine] results in increased phosphorylation of STAT5B protein] and [INS1 protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine] results in increased phosphorylation of STAT5B protein CTD PMID:26972250 STAT5B Human dexamethasone multiple interactions ISO Stat5b (Rattus norvegicus) 6480464 Dexamethasone promotes the reaction [STAT5B protein binds to SLC30A2 promoter] CTD PMID:20133611 STAT5B Human dexamethasone decreases expression ISO Stat5b (Mus musculus) 6480464 Dexamethasone results in decreased expression of STAT5B mRNA CTD PMID:21041162 STAT5B Human diarsenic trioxide multiple interactions EXP 6480464 Arsenic Trioxide results in decreased phosphorylation of and results in decreased activity of STAT5B protein CTD PMID:17121903 STAT5B Human diarsenic trioxide decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of STAT5B protein CTD PMID:18349030 STAT5B Human dichloromethane decreases expression ISO Stat5b (Mus musculus) 6480464 Methylene Chloride results in decreased expression of STAT5B mRNA CTD PMID:28392392 STAT5B Human dichloromethane increases activity ISO Stat5b (Mus musculus) 6480464 Methylene Chloride results in increased activity of STAT5B protein CTD PMID:30114225 STAT5B Human diclofenac affects expression EXP 6480464 Diclofenac affects the expression of STAT5B mRNA CTD PMID:24752500 STAT5B Human diethylstilbestrol decreases expression ISO Stat5b (Mus musculus) 6480464 Diethylstilbestrol results in decreased expression of STAT5B mRNA CTD PMID:21041162 STAT5B Human diuron decreases expression EXP 6480464 Diuron results in decreased expression of STAT5B mRNA CTD PMID:35967413 STAT5B Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 STAT5B Human entinostat decreases expression EXP 6480464 entinostat results in decreased expression of STAT5B mRNA CTD PMID:27188386 STAT5B Human enzyme inhibitor multiple interactions EXP 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of STAT5B protein CTD PMID:23301498 STAT5B Human epoxiconazole decreases activity ISO Stat5b (Mus musculus) 6480464 epoxiconazole results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human ethanol affects splicing ISO Stat5b (Mus musculus) 6480464 Ethanol affects the splicing of STAT5B mRNA CTD PMID:30319688 STAT5B Human eugenol increases expression EXP 6480464 Eugenol results in increased expression of STAT5B mRNA CTD PMID:17374397 STAT5B Human fenofibrate decreases activity ISO Stat5b (Mus musculus) 6480464 Fenofibrate results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human folic acid multiple interactions ISO Stat5b (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of STAT5B mRNA CTD PMID:22206623 STAT5B Human folic acid decreases expression ISO Stat5b (Mus musculus) 6480464 Folic Acid results in decreased expression of STAT5B mRNA CTD PMID:25629700 STAT5B Human furan increases methylation ISO Stat5b (Rattus norvegicus) 6480464 furan results in increased methylation of STAT5B gene CTD PMID:22079235 STAT5B Human furan decreases expression ISO Stat5b (Mus musculus) 6480464 furan results in decreased expression of STAT5B mRNA CTD PMID:24183702 STAT5B Human gentamycin decreases expression ISO Stat5b (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of STAT5B mRNA CTD PMID:33387578 STAT5B Human GW 501516 decreases activity ISO Stat5b (Mus musculus) 6480464 GW 501516 results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human hexachlorobenzene multiple interactions EXP 6480464 [AG 1879 results in decreased activity of SRC protein] inhibits the reaction [Hexachlorobenzene results in increased phosphorylation of STAT5B protein] more ... CTD PMID:21205633 STAT5B Human hexachlorobenzene multiple interactions ISO Stat5b (Rattus norvegicus) 6480464 Hexachlorobenzene affects the expression of and affects the phosphorylation of STAT5B protein CTD PMID:22245120 STAT5B Human hydrogen peroxide affects localization EXP 6480464 Hydrogen Peroxide affects the localization of STAT5B protein CTD PMID:10364193 STAT5B Human indometacin increases expression ISO Stat5b (Rattus norvegicus) 6480464 Indomethacin results in increased expression of STAT5B mRNA CTD PMID:18299717 STAT5B Human inulin multiple interactions ISO Stat5b (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of STAT5B mRNA CTD PMID:36331819 STAT5B Human ketoconazole decreases expression ISO Stat5b (Rattus norvegicus) 6480464 Ketoconazole results in decreased expression of STAT5B mRNA CTD PMID:37077353 STAT5B Human lead diacetate multiple interactions ISO Stat5b (Mus musculus) 6480464 [lead acetate results in increased abundance of Lead] which results in increased methylation of STAT5B intron CTD PMID:33445541 STAT5B Human lead(0) multiple interactions ISO Stat5b (Mus musculus) 6480464 [lead acetate results in increased abundance of Lead] which results in increased methylation of STAT5B intron CTD PMID:33445541 STAT5B Human lipopolysaccharide multiple interactions EXP 6480464 (+)-JQ1 compound inhibits the reaction [Lipopolysaccharides promotes the reaction [STAT5B protein binds to CSF2RA promoter]] more ... CTD PMID:25725100 STAT5B Human lipopolysaccharide decreases activity ISO Stat5b (Mus musculus) 6480464 Lipopolysaccharides results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human malathion decreases activity ISO Stat5b (Mus musculus) 6480464 Malathion results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human mono(2-ethyl-5-hydroxyhexyl) phthalate multiple interactions EXP 6480464 [Diethylhexyl Phthalate results in increased abundance of mono(2-ethyl-5-hydroxyhexyl) phthalate] which results in increased expression of STAT5B mRNA CTD PMID:37093692 STAT5B Human mono(2-ethyl-5-oxohexyl) phthalate multiple interactions EXP 6480464 [Diethylhexyl Phthalate results in increased abundance of mono(2-ethyl-5-oxohexyl)phthalate] which results in decreased methylation of STAT5B promoter and [Diethylhexyl Phthalate results in increased abundance of mono(2-ethyl-5-oxohexyl)phthalate] which results in increased expression of STAT5B mRNA CTD PMID:37093692 STAT5B Human N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine multiple interactions ISO Stat5b (Mus musculus) 6480464 N more ... CTD PMID:20201035 STAT5B Human N-(1-naphthyl)ethylenediamine decreases activity ISO Stat5b (Mus musculus) 6480464 N-(1-naphthyl)ethylenediamine results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human N-ethyl-N-nitrosourea increases activity ISO Stat5b (Mus musculus) 6480464 Ethylnitrosourea results in increased activity of STAT5B protein CTD PMID:30114225 STAT5B Human N-Methylolacrylamide decreases activity ISO Stat5b (Mus musculus) 6480464 N-methylolacrylamide results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human naphthalene decreases activity ISO Stat5b (Mus musculus) 6480464 naphthalene results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human naphthalene-1,5-diamine decreases activity ISO Stat5b (Mus musculus) 6480464 1 and 5-naphthalenediamine results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human nickel atom multiple interactions ISO Stat5b (Rattus norvegicus) 6480464 [nickel sulfate results in increased abundance of Nickel] which results in decreased expression of STAT5B mRNA CTD PMID:31734292 STAT5B Human nickel sulfate increases expression EXP 6480464 nickel sulfate results in increased expression of STAT5B mRNA CTD PMID:17374397 STAT5B Human nickel sulfate multiple interactions ISO Stat5b (Rattus norvegicus) 6480464 [nickel sulfate results in increased abundance of Nickel] which results in decreased expression of STAT5B mRNA CTD PMID:31734292 STAT5B Human nicotine increases expression EXP 6480464 Nicotine results in increased expression of STAT5B mRNA CTD PMID:18805435 STAT5B Human nitric oxide multiple interactions ISO Stat5b (Mus musculus) 6480464 STAT5B protein affects the reaction [Nitric Oxide results in decreased expression of ACO1 mRNA] CTD PMID:16886906 STAT5B Human nitric oxide decreases expression ISO Stat5b (Mus musculus) 6480464 Nitric Oxide results in decreased expression of STAT5B protein CTD PMID:16886906 STAT5B Human NORCANTHARIDIN decreases phosphorylation EXP 6480464 norcantharidin results in decreased phosphorylation of STAT5B protein CTD PMID:21266192 STAT5B Human oxazepam decreases activity ISO Stat5b (Mus musculus) 6480464 Oxazepam results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human ozone multiple interactions ISO Stat5b (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of STAT5B mRNA CTD PMID:34911549 STAT5B Human paracetamol decreases activity ISO Stat5b (Mus musculus) 6480464 Acetaminophen results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human paracetamol decreases expression ISO Stat5b (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of STAT5B mRNA CTD PMID:33387578 STAT5B Human parathion decreases expression ISO Stat5b (Mus musculus) 6480464 Parathion results in decreased expression of STAT5B mRNA CTD PMID:34813904 STAT5B Human perfluorobutanesulfonic acid decreases activity ISO Stat5b (Mus musculus) 6480464 perfluorobutanesulfonic acid results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human perfluorononanoic acid decreases activity ISO Stat5b (Mus musculus) 6480464 perfluoro-n-nonanoic acid results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human perfluorooctane-1-sulfonic acid decreases activity ISO Stat5b (Mus musculus) 6480464 perfluorooctane sulfonic acid results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human perfluorooctane-1-sulfonic acid multiple interactions ISO Stat5b (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of STAT5B mRNA more ... CTD PMID:36331819 STAT5B Human perfluorooctanoic acid decreases activity ISO Stat5b (Mus musculus) 6480464 perfluorooctanoic acid results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human phenanthrolines multiple interactions EXP 6480464 [Phenanthrolines binds to and results in decreased activity of AHR protein] inhibits the reaction [Hexachlorobenzene results in increased phosphorylation of and results in increased activity of STAT5B protein] CTD PMID:21205633 STAT5B Human phenformin decreases activity ISO Stat5b (Mus musculus) 6480464 Phenformin results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human phenobarbital decreases activity ISO Stat5b (Mus musculus) 6480464 Phenobarbital results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human phenylmercury acetate decreases expression EXP 6480464 Phenylmercuric Acetate results in decreased expression of STAT5B mRNA CTD PMID:26272509 STAT5B Human phenylmercury acetate multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of STAT5B mRNA CTD PMID:27188386 STAT5B Human picoxystrobin decreases expression EXP 6480464 picoxystrobin results in decreased expression of STAT5B mRNA CTD PMID:33512557 STAT5B Human piperine multiple interactions ISO Stat5b (Mus musculus) 6480464 piperine inhibits the reaction [IL2 protein results in increased phosphorylation of STAT5B protein] CTD PMID:25655587 STAT5B Human pirinixic acid decreases activity ISO Stat5b (Mus musculus) 6480464 pirinixic acid results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human ponatinib multiple interactions EXP 6480464 ponatinib promotes the reaction [(+)-JQ1 compound results in decreased phosphorylation of STAT5B protein] CTD PMID:25053825 STAT5B Human pregnenolone 16alpha-carbonitrile decreases activity ISO Stat5b (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human progesterone affects localization EXP 6480464 Progesterone affects the localization of STAT5B protein CTD PMID:16175315 STAT5B Human progesterone multiple interactions EXP 6480464 Progesterone promotes the reaction [IL2 protein results in increased phosphorylation of STAT5B protein] CTD PMID:21768398 STAT5B Human progesterone increases expression EXP 6480464 Progesterone results in increased expression of STAT5B protein CTD PMID:16175315 STAT5B Human progesterone affects abundance ISO Stat5b (Mus musculus) 6480464 STAT5B protein affects the abundance of Progesterone CTD PMID:15471942 STAT5B Human propiconazole decreases expression ISO Stat5b (Mus musculus) 6480464 propiconazole results in decreased expression of STAT5B mRNA CTD PMID:19363144 and PMID:21278054 STAT5B Human propiconazole decreases activity ISO Stat5b (Mus musculus) 6480464 propiconazole results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human quercetin decreases activity ISO Stat5b (Mus musculus) 6480464 Quercetin results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human quizartinib multiple interactions EXP 6480464 (+)-JQ1 compound promotes the reaction [quizartinib results in decreased phosphorylation of STAT5B protein] and quizartinib promotes the reaction [(+)-JQ1 compound results in decreased phosphorylation of STAT5B protein] CTD PMID:25053825 STAT5B Human quizartinib decreases phosphorylation EXP 6480464 quizartinib results in decreased phosphorylation of STAT5B protein CTD PMID:25053825 STAT5B Human resveratrol affects localization EXP 6480464 resveratrol affects the localization of STAT5B protein CTD PMID:26911335 STAT5B Human resveratrol increases activity ISO Stat5b (Mus musculus) 6480464 Resveratrol results in increased activity of STAT5B protein CTD PMID:30114225 STAT5B Human resveratrol multiple interactions EXP 6480464 resveratrol promotes the reaction [sorafenib results in decreased phosphorylation of STAT5B protein] and resveratrol results in decreased activity of and results in decreased phosphorylation of STAT5B protein CTD PMID:26911335 STAT5B Human ruxolitinib decreases phosphorylation ISO Stat5b (Mus musculus) 6480464 ruxolitinib results in decreased phosphorylation of STAT5B protein CTD PMID:29200404 STAT5B Human ruxolitinib decreases phosphorylation EXP 6480464 ruxolitinib results in decreased phosphorylation of STAT5B protein and ruxolitinib results in decreased phosphorylation of STAT5B protein mutant form CTD PMID:29200404 STAT5B Human SB 431542 multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 STAT5B Human sebacic acid decreases activity ISO Stat5b (Mus musculus) 6480464 sebacic acid results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human sodium arsenite decreases phosphorylation ISO Stat5b (Mus musculus) 6480464 sodium arsenite results in decreased phosphorylation of STAT5B protein CTD PMID:26921788 STAT5B Human sodium arsenite multiple interactions EXP 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of STAT5B mRNA CTD PMID:39836092 STAT5B Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of STAT5B mRNA CTD PMID:38568856 STAT5B Human sodium dichromate decreases expression ISO Stat5b (Mus musculus) 6480464 sodium bichromate results in decreased expression of STAT5B mRNA CTD PMID:31558096 STAT5B Human sorafenib multiple interactions EXP 6480464 resveratrol promotes the reaction [sorafenib results in decreased phosphorylation of STAT5B protein] CTD PMID:26911335 STAT5B Human T-2 toxin decreases expression EXP 6480464 T-2 Toxin results in decreased expression of STAT5B mRNA CTD PMID:34581912 STAT5B Human tamibarotene decreases expression EXP 6480464 tamibarotene results in decreased expression of STAT5B mRNA CTD PMID:15498508 STAT5B Human testosterone increases activity ISO Stat5b (Mus musculus) 6480464 Testosterone results in increased activity of STAT5B protein CTD PMID:30114225 STAT5B Human tetrachloromethane increases activity ISO Stat5b (Mus musculus) 6480464 Carbon Tetrachloride results in increased activity of STAT5B protein CTD PMID:30114225 STAT5B Human tofacitinib multiple interactions ISO Stat5b (Mus musculus) 6480464 tofacitinib inhibits the reaction [IL2 protein results in increased phosphorylation of STAT5B protein] CTD PMID:21155605 STAT5B Human tofacitinib decreases phosphorylation ISO Stat5b (Mus musculus) 6480464 tofacitinib results in decreased phosphorylation of STAT5B protein CTD PMID:29200404 STAT5B Human tofacitinib multiple interactions ISO Stat5b (Rattus norvegicus) 6480464 tofacitinib inhibits the reaction [PRL protein results in increased phosphorylation of STAT5B protein] CTD PMID:27708194 STAT5B Human tofacitinib multiple interactions EXP 6480464 tofacitinib inhibits the reaction [IL15 protein results in increased phosphorylation of STAT5B protein] CTD PMID:21155605 STAT5B Human tofacitinib decreases phosphorylation EXP 6480464 tofacitinib results in decreased phosphorylation of STAT5B protein and tofacitinib results in decreased phosphorylation of STAT5B protein mutant form CTD PMID:22705984 more ... STAT5B Human toluene 2,4-diisocyanate multiple interactions ISO Stat5b (Mus musculus) 6480464 Toluene 2 more ... CTD PMID:28329851 STAT5B Human triadimefon decreases expression ISO Stat5b (Mus musculus) 6480464 triadimefon results in decreased expression of STAT5B mRNA CTD PMID:19363144 STAT5B Human triadimefon decreases activity ISO Stat5b (Mus musculus) 6480464 triadimefon results in decreased activity of STAT5B protein CTD PMID:30114225 STAT5B Human Tributyltin oxide increases expression ISO Stat5b (Rattus norvegicus) 6480464 bis(tri-n-butyltin)oxide results in increased expression of STAT5B mRNA CTD PMID:17553608 STAT5B Human trichloroethene decreases expression ISO Stat5b (Rattus norvegicus) 6480464 Trichloroethylene results in decreased expression of STAT5B mRNA CTD PMID:19448997 STAT5B Human trichostatin A decreases expression EXP 6480464 trichostatin A results in decreased expression of STAT5B mRNA CTD PMID:24935251 and PMID:26272509 STAT5B Human trichostatin A multiple interactions EXP 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of STAT5B mRNA CTD PMID:27188386 STAT5B Human trimellitic anhydride increases expression ISO Stat5b (Mus musculus) 6480464 trimellitic anhydride results in increased expression of STAT5B mRNA CTD PMID:19042947 STAT5B Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of STAT5B mRNA CTD PMID:37042841 STAT5B Human troglitazone decreases expression ISO Stat5b (Mus musculus) 6480464 troglitazone results in decreased expression of STAT5B mRNA CTD PMID:28973697 STAT5B Human tungsten decreases expression ISO Stat5b (Mus musculus) 6480464 Tungsten results in decreased expression of STAT5B mRNA CTD PMID:30912803 STAT5B Human tunicamycin increases activity ISO Stat5b (Mus musculus) 6480464 Tunicamycin results in increased activity of STAT5B protein CTD PMID:30114225 STAT5B Human tyrphostin AG 1478 multiple interactions EXP 6480464 [RTKI cpd results in decreased activity of EGFR protein] inhibits the reaction [Hexachlorobenzene results in increased phosphorylation of and results in increased activity of STAT5B protein] CTD PMID:21205633 STAT5B Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of STAT5B mRNA CTD PMID:25979313 STAT5B Human valproic acid multiple interactions EXP 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of STAT5B mRNA CTD PMID:27188386 STAT5B Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of STAT5B mRNA and Valproic Acid results in decreased expression of STAT5B protein CTD PMID:23179753 more ... STAT5B Human vinclozolin increases expression ISO Stat5b (Rattus norvegicus) 6480464 vinclozolin results in increased expression of STAT5B mRNA CTD PMID:22570695 STAT5B Human vinclozolin increases methylation ISO Stat5b (Rattus norvegicus) 6480464 vinclozolin results in increased methylation of STAT5B gene CTD PMID:31079544 STAT5B Human vitamin E increases expression EXP 6480464 Vitamin E results in increased expression of STAT5B mRNA CTD PMID:19244175 STAT5B Human vorinostat multiple interactions EXP 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of STAT5B mRNA CTD PMID:27188386 STAT5B Human vorinostat decreases expression EXP 6480464 vorinostat results in decreased expression of STAT5B mRNA CTD PMID:26272509
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-catechin (EXP) (1->4)-beta-D-glucan (ISO) (S)-nicotine (EXP) 1,2-dimethylhydrazine (ISO) 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (ISO) 1-benzofuran (ISO) 1-chloro-2,4-dinitrobenzene (EXP) 1-tert-Butoxy-2-propanol (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 17beta-estradiol 3-benzoate (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-tribromophenol (EXP) 2-amino-2-deoxy-D-galactopyranose (ISO) 2-nitrotoluene (ISO) 3,3',5,5'-tetrabromobisphenol A (EXP) 3,3',5-triiodo-L-thyronine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-vinylcyclohexene dioxide (ISO) 6-propyl-2-thiouracil (ISO) acetamide (ISO) acetylsalicylic acid (EXP) acrylamide (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (EXP) alpha-naphthoflavone (EXP) ammonium chloride (ISO) androst-4-ene-3,17-dione (ISO) AP20187 (ISO) arsane (EXP) arsenic atom (EXP) arsenous acid (EXP) benzo[a]pyrene (EXP,ISO) benzoates (EXP) bezafibrate (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) butyric acid (EXP) cadmium acetate (ISO) cadmium dichloride (EXP) caffeine (EXP) carbamazepine (EXP) carbon nanotube (ISO) CGP 52608 (EXP) ciprofibrate (ISO) citalopram (ISO) cobalt dichloride (EXP) cocaine (ISO) coumarin (ISO) curcumin (EXP) cyclophosphamide (ISO) cyproconazole (ISO) DDE (EXP) dexamethasone (EXP,ISO) diarsenic trioxide (EXP) dichloromethane (ISO) diclofenac (EXP) diethylstilbestrol (ISO) diuron (EXP) dorsomorphin (EXP) entinostat (EXP) enzyme inhibitor (EXP) epoxiconazole (ISO) ethanol (ISO) eugenol (EXP) fenofibrate (ISO) folic acid (ISO) furan (ISO) gentamycin (ISO) GW 501516 (ISO) hexachlorobenzene (EXP,ISO) hydrogen peroxide (EXP) indometacin (ISO) inulin (ISO) ketoconazole (ISO) lead diacetate (ISO) lead(0) (ISO) lipopolysaccharide (EXP,ISO) malathion (ISO) mono(2-ethyl-5-hydroxyhexyl) phthalate (EXP) mono(2-ethyl-5-oxohexyl) phthalate (EXP) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) N-(1-naphthyl)ethylenediamine (ISO) N-ethyl-N-nitrosourea (ISO) N-Methylolacrylamide (ISO) naphthalene (ISO) naphthalene-1,5-diamine (ISO) nickel atom (ISO) nickel sulfate (EXP,ISO) nicotine (EXP) nitric oxide (ISO) NORCANTHARIDIN (EXP) oxazepam (ISO) ozone (ISO) paracetamol (ISO) parathion (ISO) perfluorobutanesulfonic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenanthrolines (EXP) phenformin (ISO) phenobarbital (ISO) phenylmercury acetate (EXP) picoxystrobin (EXP) piperine (ISO) pirinixic acid (ISO) ponatinib (EXP) pregnenolone 16alpha-carbonitrile (ISO) progesterone (EXP,ISO) propiconazole (ISO) quercetin (ISO) quizartinib (EXP) resveratrol (EXP,ISO) ruxolitinib (EXP,ISO) SB 431542 (EXP) sebacic acid (ISO) sodium arsenite (EXP,ISO) sodium dichromate (ISO) sorafenib (EXP) T-2 toxin (EXP) tamibarotene (EXP) testosterone (ISO) tetrachloromethane (ISO) tofacitinib (EXP,ISO) toluene 2,4-diisocyanate (ISO) triadimefon (ISO) Tributyltin oxide (ISO) trichloroethene (ISO) trichostatin A (EXP) trimellitic anhydride (ISO) triphenyl phosphate (EXP) troglitazone (ISO) tungsten (ISO) tunicamycin (ISO) tyrphostin AG 1478 (EXP) valproic acid (EXP) vinclozolin (ISO) vitamin E (EXP) vorinostat (EXP)
Biological Process
activated T cell proliferation (IEA) acute-phase response (ISO) B cell differentiation (IEA) cell population proliferation (IEA) cell surface receptor signaling pathway via JAK-STAT (IBA,IEA,ISO,NAS,TAS) cellular response to epidermal growth factor stimulus (ISS) cellular response to growth factor stimulus (IEA,ISS) cellular response to hormone stimulus (IDA) cytokine-mediated signaling pathway (IBA,IEA) defense response (IBA) development of secondary female sexual characteristics (IEA) development of secondary male sexual characteristics (IEA) erythrocyte differentiation (IEA) erythropoietin-mediated signaling pathway (IDA) female pregnancy (IEA) gamma-delta T cell differentiation (IEA) growth hormone receptor signaling pathway via JAK-STAT (IBA,IDA,IEA) lactation (IEA) lipid storage (IEA) liver development (ISO) luteinization (IEA,ISO) lymphocyte differentiation (IEA) mast cell migration (IEA) mitotic cell cycle (IEA) myeloid cell apoptotic process (IEA) natural killer cell differentiation (IEA,ISO) natural killer cell mediated cytotoxicity (IEA) natural killer cell proliferation (IEA) negative regulation of erythrocyte differentiation (IEA) negative regulation of myeloid cell apoptotic process (IEA) Peyer's patch development (IEA) positive regulation of activated T cell proliferation (IEA) positive regulation of B cell differentiation (IEA) positive regulation of cell population proliferation (IEA) positive regulation of erythrocyte differentiation (IDA) positive regulation of fibroblast growth factor production (ISO) positive regulation of gamma-delta T cell differentiation (IEA) positive regulation of gene expression (ISO) positive regulation of inflammatory response (IEA) positive regulation of interleukin-2 production (IEA) positive regulation of lymphocyte differentiation (IEA) positive regulation of mitotic cell cycle (IEA) positive regulation of multicellular organism growth (IEA) positive regulation of natural killer cell differentiation (IEA) positive regulation of natural killer cell mediated cytotoxicity (IEA) positive regulation of natural killer cell proliferation (IEA) positive regulation of smooth muscle cell migration (ISO) positive regulation of smooth muscle cell proliferation (ISO) positive regulation of transcription by RNA polymerase II (IEA,ISS,NAS) progesterone metabolic process (IEA) regulation of cell adhesion (IEA) regulation of cell population proliferation (IBA) regulation of DNA-templated transcription (IEA,ISO) regulation of epithelial cell differentiation (IEA) regulation of multicellular organism growth (IEA,ISS) regulation of steroid metabolic process (IEA) regulation of transcription by RNA polymerase II (IBA,IEA,TAS) response to estradiol (IDA) response to ethanol (ISO) response to hypoxia (ISO) response to interleukin-15 (IEA) response to interleukin-2 (IEA) response to interleukin-4 (IEA) response to lipopolysaccharide (ISO) response to peptide hormone (IBA,ISO) sex differentiation (IEA) signal transduction (IEA) T cell differentiation in thymus (IEA) T cell homeostasis (IEA) taurine metabolic process (IEA,ISS) transcription by RNA polymerase II (IEA,ISO)
Molecular Function
chromatin binding (ISS) DNA binding (IEA,ISO) DNA-binding transcription activator activity, RNA polymerase II-specific (IDA,IEA) DNA-binding transcription factor activity (IEA,ISO,TAS) DNA-binding transcription factor activity, RNA polymerase II-specific (IBA,ISA) DNA-binding transcription factor binding (ISO) double-stranded DNA binding (ISO) identical protein binding (IPI) nuclear glucocorticoid receptor binding (IPI) protein binding (IPI,ISO) protein dimerization activity (IEA,ISS) protein homodimerization activity (IDA) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IBA,IEA) sequence-specific DNA binding (ISO)
1.
ENDOTOXIN ATTENUATES GROWTH HORMONE INDUCED HEPATIC INSULIN-LIKE GROWTH FACTOR-1 EXPRESSION BY INHIBITING JAK2/STAT5 SIGNAL TRANSDUCTION AND STAT5b DNA BINDING.
Chen Y, etal., Am J Physiol Endocrinol Metab. 2007 Feb 27;.
2.
STAT5 isoforms regulate colorectal cancer cell apoptosis via reduction of mitochondrial membrane potential and generation of reactive oxygen species.
Du W, etal., J Cell Physiol. 2012 Jun;227(6):2421-9. doi: 10.1002/jcp.22977.
3.
Activation of the Jak/Stat signal transduction pathway in GH-treated rat osteoblast-like cells in culture.
Gerland K, etal., Mol Cell Endocrinol. 2000 Oct 25;168(1-2):1-9.
4.
GOAs Human GO annotations
GOA_HUMAN data from the GO Consortium
5.
Identification of immune checkpoint inhibitors and biomarkers among STAT family in stomach adenocarcinoma.
Guo L, etal., Am J Transl Res. 2020 Sep 15;12(9):4977-4997. eCollection 2020.
6.
Unphosphorylated STAT5A stabilizes heterochromatin and suppresses tumor growth.
Hu X, etal., Proc Natl Acad Sci U S A. 2013 Jun 18;110(25):10213-8. doi: 10.1073/pnas.1221243110. Epub 2013 Jun 3.
7.
STAT5 activity in pancreatic beta-cells influences the severity of diabetes in animal models of type 1 and 2 diabetes.
Jackerott M, etal., Diabetes. 2006 Oct;55(10):2705-12.
8.
Activation of signal transducer and activator of transcription 5 is required for progression of autochthonous prostate cancer: evidence from the transgenic adenocarcinoma of the mouse prostate system.
Kazansky AV, etal., Cancer Res. 2003 Dec 15;63(24):8757-62.
9.
Signal transducers and activators of transcription 5b activation enhances hepatocellular carcinoma aggressiveness through induction of epithelial-mesenchymal transition.
Lee TK, etal., Cancer Res. 2006 Oct 15;66(20):9948-56. doi: 10.1158/0008-5472.CAN-06-1092.
10.
Nuclear localization and binding affinity of STAT5b for the alpha(2)-macroglobulin gene promoter during rat liver development and the acute-phase response.
Mihailovic M, etal., Acta Biochim Pol. 2007;54(2):331-40. Epub 2007 Jun 12.
11.
The JAK-STAT signaling pathway: input and output integration.
Murray PJ J Immunol. 2007 Mar 1;178(5):2623-9.
12.
Genetic background determines if Stat5b suppresses or enhances murine hepatocarcinogenesis.
Oberley CC, etal., Mol Carcinog. 2015 Oct;54(10):959-70. doi: 10.1002/mc.22165. Epub 2014 May 17.
13.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
14.
Expression of STAT5, COX-2 and PIAS3 in correlation with NSCLC histhopathological features.
Pastuszak-Lewandoska D, etal., PLoS One. 2014 Aug 19;9(8):e104265. doi: 10.1371/journal.pone.0104265. eCollection 2014.
15.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
16.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
17.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
18.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
19.
RGD HPO Phenotype Annotation Pipeline
RGD automated import pipeline for human HPO-to-gene-to-disease annotations
20.
JAK/STAT/SOCS-signaling pathway and colon and rectal cancer.
Slattery ML, etal., Mol Carcinog. 2013 Feb;52(2):155-66. doi: 10.1002/mc.21841. Epub 2011 Nov 28.
21.
Modulation of signal transducers and activators of transcription (STAT) factor pathways during focal cerebral ischaemia: a gene expression array study in rat hippocampus after middle cerebral artery occlusion.
Sun SL, etal., Clin Exp Pharmacol Physiol. 2007 Nov;34(11):1097-101.
22.
Chronic intermittent hypoxia alters hypothalamic transcription of genes involved in metabolic regulation.
Volgin DV and Kubin L, Auton Neurosci. 2006 Jun 30;126-127:93-9. Epub 2006 May 26.
23.
Analysis of clinical significance and prospective molecular mechanism of main elements of the JAK/STAT pathway in hepatocellular carcinoma.
Wang X, etal., Int J Oncol. 2019 Oct;55(4):805-822. doi: 10.3892/ijo.2019.4862. Epub 2019 Aug 27.
24.
Regulation of insulin receptor function.
Youngren JF Cell Mol Life Sci. 2007 Apr;64(7-8):873-91.
STAT5B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 42,199,177 - 42,288,370 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 42,199,176 - 42,288,633 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 40,351,195 - 40,428,409 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 37,604,721 - 37,681,950 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 37,604,721 - 37,681,950 NCBI Celera 17 37,005,458 - 37,083,308 (-) NCBI Celera Cytogenetic Map 17 q21.2 NCBI HuRef 17 36,116,230 - 36,193,344 (-) NCBI HuRef CHM1_1 17 40,586,923 - 40,664,134 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 43,055,661 - 43,144,521 (-) NCBI T2T-CHM13v2.0
Stat5b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 100,671,557 - 100,741,407 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 100,671,557 - 100,741,550 (-) Ensembl GRCm39 Ensembl GRCm38 11 100,780,731 - 100,859,004 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 100,780,731 - 100,850,724 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 100,642,045 - 100,711,899 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 100,596,821 - 100,638,618 (-) NCBI MGSCv36 mm8 MGSCv36 11 101,557,264 - 101,599,060 (-) NCBI MGSCv36 mm8 Cytogenetic Map 11 D NCBI cM Map 11 63.63 NCBI
Stat5b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 86,205,148 - 86,276,178 (-) NCBI GRCr8 mRatBN7.2 10 85,704,841 - 85,775,856 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 85,705,670 - 85,775,668 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 90,743,399 - 90,812,008 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 90,222,166 - 90,290,624 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 85,615,217 - 85,683,927 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 88,686,207 - 88,712,313 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 88,686,207 - 88,754,829 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 88,480,377 - 88,506,888 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 89,716,624 - 89,743,134 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 89,730,993 - 89,757,504 (-) NCBI Celera 10 84,424,576 - 84,451,052 (-) NCBI Celera RH 3.4 Map 10 837.39 RGD Cytogenetic Map 10 q31 NCBI
Stat5b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955451 16,255,398 - 16,272,214 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955451 16,253,645 - 16,295,337 (-) NCBI ChiLan1.0 ChiLan1.0
LOC100989105 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 22,696,139 - 22,784,759 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 24,586,321 - 24,674,917 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 15,040,303 - 15,116,682 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 15,306,412 - 15,338,973 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 15,306,418 - 15,336,463 (+) Ensembl panpan1.1 panPan2
STAT5B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 20,647,712 - 20,718,453 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 20,691,483 - 20,716,485 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 20,109,403 - 20,179,537 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 21,367,403 - 21,437,279 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 21,367,403 - 21,437,269 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 20,152,431 - 20,222,600 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 20,419,706 - 20,489,689 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 20,522,505 - 20,592,735 (+) NCBI UU_Cfam_GSD_1.0
LOC101954516 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 20,031,387 - 20,054,040 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936490 17,021,051 - 17,043,941 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936490 17,022,268 - 17,043,751 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
STAT5B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 20,508,404 - 20,574,266 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 20,498,103 - 20,574,365 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 20,634,155 - 20,864,515 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LOC103243413 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 63,997,486 - 64,070,392 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 63,997,441 - 64,070,445 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 34,795,632 - 34,884,310 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Confirmed Target Of
MIR23B hsa-miR-23b-3p Tarbase external_info Sequencing POSITIVE
Predicted Target Of
Count of predictions: 2261 Count of miRNA genes: 1088 Interacting mature miRNAs: 1356 Transcripts: ENST00000293328, ENST00000415845, ENST00000468312, ENST00000468496, ENST00000481253, ENST00000481517, ENST00000498674 Prediction methods: Miranda, Pita, Rnahybrid, Targetscan Result types: miRGate_prediction
407110724 GWAS759700_H waist-hip ratio QTL GWAS759700 (human) 4e-14 waist-hip ratio waist to hip ratio (WHR) (CMO:0000020) 17 42262061 42262062 Human 597594970 GWAS1651830_H eosinophil count QTL GWAS1651830 (human) 1e-12 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 17 42285248 42285249 Human 597024914 GWAS1120988_H allergic disease QTL GWAS1120988 (human) 1e-09 allergic disease 17 42262844 42262845 Human 407113615 GWAS762591_H eosinophil count QTL GWAS762591 (human) 4e-08 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 17 42236412 42236413 Human 597325270 GWAS1421344_H Crohn's disease QTL GWAS1421344 (human) 0.000006 intestine integrity trait (VT:0010554) 17 42242072 42242073 Human 597083610 GWAS1179684_H lymphocyte count QTL GWAS1179684 (human) 6e-09 lymphocyte count blood lymphocyte count (CMO:0000031) 17 42274281 42274282 Human 597306388 GWAS1402462_H pulse pressure measurement QTL GWAS1402462 (human) 2e-15 pulse pressure measurement pulse pressure (CMO:0000292) 17 42236412 42236413 Human 597208023 GWAS1304097_H childhood onset asthma QTL GWAS1304097 (human) 5e-09 childhood onset asthma 17 42238611 42238612 Human 597596753 GWAS1653613_H eosinophil count QTL GWAS1653613 (human) 4e-13 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 17 42285248 42285249 Human 597099907 GWAS1195981_H neutrophil percentage of leukocytes QTL GWAS1195981 (human) 5e-11 neutrophil quantity (VT:0000222) blood neutrophil count to total leukocyte count ratio (CMO:0000370) 17 42274281 42274282 Human 597226317 GWAS1322391_H heel bone mineral density QTL GWAS1322391 (human) 4e-11 heel bone mineral density bone mineral density (CMO:0001226) 17 42243173 42243174 Human 597341775 GWAS1437849_H asthma QTL GWAS1437849 (human) 6e-14 asthma 17 42274471 42274472 Human 597588360 GWAS1645220_H eosinophil count QTL GWAS1645220 (human) 3e-12 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 17 42285248 42285249 Human 407073172 GWAS722148_H BMI-adjusted waist-hip ratio QTL GWAS722148 (human) 4e-16 body size trait (VT:0100005) 17 42262061 42262062 Human 597155919 GWAS1251993_H triglycerides:total lipids ratio, high density lipoprotein cholesterol measurement QTL GWAS1251993 (human) 1e-08 triglycerides:total lipids ratio, high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 17 42242349 42242350 Human 597585287 GWAS1642147_H eosinophil count QTL GWAS1642147 (human) 3e-11 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 17 42285248 42285249 Human 597599684 GWAS1656544_H mean corpuscular hemoglobin concentration QTL GWAS1656544 (human) 2e-16 mean corpuscular hemoglobin concentration mean corpuscular hemoglobin concentration (CMO:0000291) 17 42267350 42267351 Human 597435974 GWAS1532048_H asthma QTL GWAS1532048 (human) 6e-11 asthma 17 42276943 42276944 Human 597169475 GWAS1265549_H BMI-adjusted waist-hip ratio QTL GWAS1265549 (human) 3e-13 body size trait (VT:0100005) 17 42243193 42243194 Human 407252955 GWAS901931_H asthma QTL GWAS901931 (human) 3e-11 asthma 17 42266553 42266554 Human 597324612 GWAS1420686_H high density lipoprotein cholesterol measurement QTL GWAS1420686 (human) 3e-10 high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 17 42207465 42207466 Human 407079708 GWAS728684_H waist-hip ratio QTL GWAS728684 (human) 5e-08 waist-hip ratio waist to hip ratio (WHR) (CMO:0000020) 17 42262061 42262062 Human 597247544 GWAS1343618_H asthma QTL GWAS1343618 (human) 3e-09 asthma 17 42260917 42260918 Human 597598205 GWAS1655065_H mean corpuscular hemoglobin concentration QTL GWAS1655065 (human) 3e-18 mean corpuscular hemoglobin concentration mean corpuscular hemoglobin concentration (CMO:0000291) 17 42267350 42267351 Human 597331708 GWAS1427782_H able to hear with hearing aids QTL GWAS1427782 (human) 0.0000003 able to hear with hearing aids 17 42226155 42226156 Human 597435194 GWAS1531268_H lipid measurement QTL GWAS1531268 (human) 0.000009 lipid measurement blood lipid measurement (CMO:0000050) 17 42272167 42272168 Human 597322173 GWAS1418247_H high density lipoprotein cholesterol measurement QTL GWAS1418247 (human) 2e-11 high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 17 42207465 42207466 Human 597085180 GWAS1181254_H lymphocyte percentage of leukocytes QTL GWAS1181254 (human) 4e-10 lymphocyte quantity (VT:0000717) blood lymphocyte count to total leukocyte count ratio (CMO:0000371) 17 42274281 42274282 Human 597325873 GWAS1421947_H Crohn's disease QTL GWAS1421947 (human) 2e-08 intestine integrity trait (VT:0010554) 17 42242072 42242073 Human 597595056 GWAS1651916_H eosinophil count QTL GWAS1651916 (human) 5e-15 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 17 42285248 42285249 Human 597393396 GWAS1489470_H asthma QTL GWAS1489470 (human) 2e-08 asthma 17 42275129 42275130 Human 597297454 GWAS1393528_H low density lipoprotein cholesterol measurement QTL GWAS1393528 (human) 4e-08 low density lipoprotein cholesterol measurement blood low density lipoprotein cholesterol level (CMO:0000053) 17 42243915 42243916 Human 597325871 GWAS1421945_H sex interaction measurement, Crohn's disease QTL GWAS1421945 (human) 7e-08 intestine integrity trait (VT:0010554) 17 42242072 42242073 Human 597267375 GWAS1363449_H pulse pressure measurement QTL GWAS1363449 (human) 1e-13 pulse pressure measurement pulse pressure (CMO:0000292) 17 42236412 42236413 Human 597059951 GWAS1156025_H BMI-adjusted waist-hip ratio QTL GWAS1156025 (human) 3e-15 body size trait (VT:0100005) 17 42256723 42256724 Human 597242918 GWAS1338992_H BMI-adjusted waist-hip ratio QTL GWAS1338992 (human) 8e-13 body size trait (VT:0100005) 17 42243193 42243194 Human
D17S1802
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 40,353,486 - 40,353,713 UniSTS GRCh37 Build 36 17 37,607,012 - 37,607,239 RGD NCBI36 Celera 17 37,007,749 - 37,007,976 RGD Cytogenetic Map 17 q11.2 UniSTS Cytogenetic Map 17 q25.3 UniSTS HuRef 17 36,118,521 - 36,118,748 UniSTS Marshfield Genetic Map 17 64.16 UniSTS Marshfield Genetic Map 17 64.16 RGD Genethon Genetic Map 17 64.9 UniSTS deCODE Assembly Map 17 70.79 UniSTS
D17S1793
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 40,359,404 - 40,359,602 UniSTS GRCh37 Build 36 17 37,612,930 - 37,613,128 RGD NCBI36 Celera 17 37,013,667 - 37,013,865 RGD Cytogenetic Map 17 q11.2 UniSTS HuRef 17 36,124,440 - 36,124,636 UniSTS Marshfield Genetic Map 17 63.09 RGD Marshfield Genetic Map 17 63.09 UniSTS Genethon Genetic Map 17 63.7 UniSTS deCODE Assembly Map 17 70.79 UniSTS Whitehead-YAC Contig Map 17 UniSTS
D17S1801
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 40,415,784 - 40,416,022 UniSTS GRCh37 Build 36 17 37,669,310 - 37,669,548 RGD NCBI36 Celera 17 37,070,668 - 37,070,906 RGD Cytogenetic Map 17 q11.2 UniSTS HuRef 17 36,180,822 - 36,181,056 UniSTS Marshfield Genetic Map 17 63.09 UniSTS Marshfield Genetic Map 17 63.09 RGD Genethon Genetic Map 17 63.7 UniSTS deCODE Assembly Map 17 71.07 UniSTS
RH16203
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 40,413,776 - 40,413,927 UniSTS GRCh37 Build 36 17 37,667,302 - 37,667,453 RGD NCBI36 Celera 17 37,068,660 - 37,068,811 RGD Cytogenetic Map 17 q11.2 UniSTS HuRef 17 36,178,820 - 36,178,971 UniSTS GeneMap99-GB4 RH Map 17 307.37 UniSTS
D17S1192
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 40,421,284 - 40,421,472 UniSTS GRCh37 Build 36 17 37,674,810 - 37,674,998 RGD NCBI36 Celera 2 42,854,346 - 42,855,778 UniSTS Celera 17 37,076,168 - 37,076,356 RGD Cytogenetic Map 2 p21 UniSTS Cytogenetic Map 17 q11.2 UniSTS HuRef 17 36,186,318 - 36,186,506 UniSTS HuRef 2 42,749,655 - 42,751,087 UniSTS
RH91495
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 40,352,576 - 40,352,746 UniSTS GRCh37 Build 36 17 37,606,102 - 37,606,272 RGD NCBI36 Celera 17 37,006,839 - 37,007,009 RGD Cytogenetic Map 17 q11.2 UniSTS HuRef 17 36,117,611 - 36,117,781 UniSTS GeneMap99-GB4 RH Map 17 306.94 UniSTS
D17S1139
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 40,359,426 - 40,359,578 UniSTS GRCh37 Build 36 17 37,612,952 - 37,613,104 RGD NCBI36 Celera 17 37,013,689 - 37,013,841 RGD Cytogenetic Map 17 q11.2 UniSTS HuRef 17 36,124,462 - 36,124,612 UniSTS
D17S1143
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 40,353,522 - 40,353,618 UniSTS GRCh37 Build 36 17 37,607,048 - 37,607,144 RGD NCBI36 Celera 17 37,007,785 - 37,007,881 RGD Cytogenetic Map 17 q11.2 UniSTS HuRef 17 36,118,557 - 36,118,653 UniSTS
D17S1240
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 40,407,446 - 40,407,651 UniSTS GRCh37 Build 36 17 37,660,972 - 37,661,177 RGD NCBI36 Celera 17 37,062,330 - 37,062,535 RGD Cytogenetic Map 17 q11.2 UniSTS HuRef 17 36,172,490 - 36,172,695 UniSTS
WI-11886
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 40,351,201 - 40,351,350 UniSTS GRCh37 Build 36 17 37,604,727 - 37,604,876 RGD NCBI36 Celera 17 37,005,464 - 37,005,613 RGD Cytogenetic Map 17 q11.2 UniSTS HuRef 17 36,116,236 - 36,116,385 UniSTS GeneMap99-GB4 RH Map 17 303.67 UniSTS Whitehead-RH Map 17 350.1 UniSTS NCBI RH Map 17 352.4 UniSTS
STS-U48730
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 40,353,524 - 40,353,751 UniSTS GRCh37 Build 36 17 37,607,050 - 37,607,277 RGD NCBI36 Celera 17 37,007,787 - 37,008,014 RGD Cytogenetic Map 17 q11.2 UniSTS HuRef 17 36,118,559 - 36,118,786 UniSTS GeneMap99-GB4 RH Map 17 303.56 UniSTS NCBI RH Map 17 352.4 UniSTS
STS-T90203
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 40,353,676 - 40,353,874 UniSTS GRCh37 Build 36 17 37,607,202 - 37,607,400 RGD NCBI36 Celera 17 37,007,939 - 37,008,137 RGD Cytogenetic Map 17 q11.2 UniSTS HuRef 17 36,118,711 - 36,118,910 UniSTS GeneMap99-GB4 RH Map 17 306.52 UniSTS NCBI RH Map 17 436.9 UniSTS
SHGC-64296
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 40,353,732 - 40,353,846 UniSTS GRCh37 Build 36 17 37,607,258 - 37,607,372 RGD NCBI36 Celera 17 37,007,995 - 37,008,109 RGD Cytogenetic Map 17 q11.2 UniSTS HuRef 17 36,118,767 - 36,118,882 UniSTS TNG Radiation Hybrid Map 17 18905.0 UniSTS
D17S1673
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 40,352,503 - 40,352,746 UniSTS GRCh37 Build 36 17 37,606,029 - 37,606,272 RGD NCBI36 Celera 17 37,006,766 - 37,007,009 RGD Cytogenetic Map 17 q11.2 UniSTS HuRef 17 36,117,538 - 36,117,781 UniSTS Whitehead-YAC Contig Map 17 UniSTS
RH36528
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 40,352,067 - 40,352,222 UniSTS GRCh37 Build 36 17 37,605,593 - 37,605,748 RGD NCBI36 Celera 17 37,006,330 - 37,006,485 RGD Cytogenetic Map 17 q11.2 UniSTS HuRef 17 36,117,102 - 36,117,257 UniSTS GeneMap99-GB4 RH Map 17 309.42 UniSTS NCBI RH Map 17 474.9 UniSTS
D1S1425
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 19 q13.3 UniSTS Cytogenetic Map 1 p33 UniSTS Cytogenetic Map 17 q11.2 UniSTS Cytogenetic Map 1 p31.3 UniSTS Cytogenetic Map 22 q13.1 UniSTS Cytogenetic Map 9 q34.3 UniSTS Cytogenetic Map 6 q25.3 UniSTS Cytogenetic Map 19 p13.12 UniSTS Cytogenetic Map 1 q32.1 UniSTS Cytogenetic Map 2 p13.1 UniSTS Cytogenetic Map 5 q35.3 UniSTS Cytogenetic Map 2 p11.2 UniSTS Cytogenetic Map 4 q21.23 UniSTS Cytogenetic Map 22 q12.1 UniSTS Cytogenetic Map 8 q24.13 UniSTS Cytogenetic Map 1 p36.33 UniSTS Cytogenetic Map 11 q13 UniSTS Cytogenetic Map 1 q23.1 UniSTS Cytogenetic Map 10 q22 UniSTS Cytogenetic Map 4 q12 UniSTS Cytogenetic Map 10 p14 UniSTS Cytogenetic Map 6 p21.33 UniSTS Cytogenetic Map 10 q26.3 UniSTS Cytogenetic Map 7 q22.1 UniSTS Cytogenetic Map 19 q13.32 UniSTS Cytogenetic Map 17 q21.31 UniSTS Cytogenetic Map 7 p22.2 UniSTS Cytogenetic Map 12 q13.12 UniSTS Cytogenetic Map 18 p11.21 UniSTS Cytogenetic Map 14 q32.12 UniSTS Cytogenetic Map 2 q31.1 UniSTS Cytogenetic Map 18 p11.31 UniSTS Cytogenetic Map 13 q34 UniSTS Cytogenetic Map 4 p14 UniSTS Cytogenetic Map 8 p23.1 UniSTS Cytogenetic Map 4 p16.3 UniSTS Cytogenetic Map 3 q21.3 UniSTS Cytogenetic Map 19 p13.2 UniSTS Cytogenetic Map 8 q12.1 UniSTS Cytogenetic Map 11 q12.3 UniSTS Cytogenetic Map 16 p11.2 UniSTS Cytogenetic Map 10 p12 UniSTS Cytogenetic Map 12 q13 UniSTS Cytogenetic Map 11 p15.4 UniSTS Cytogenetic Map 19 p12 UniSTS Cytogenetic Map 16 p13.3 UniSTS Cytogenetic Map 8 q24 UniSTS Cytogenetic Map 2 p23.3 UniSTS Cytogenetic Map 5 q13.2 UniSTS Cytogenetic Map 5 q32 UniSTS Cytogenetic Map 1 q21.2 UniSTS Cytogenetic Map 3 q26.2 UniSTS Cytogenetic Map 6 q25.2-q25.3 UniSTS Cytogenetic Map 20 q11.2-q13.2 UniSTS Cytogenetic Map 12 q13.3 UniSTS Cytogenetic Map 1 q21-q23 UniSTS Cytogenetic Map 17 q21.32 UniSTS Cytogenetic Map 1 p35.3 UniSTS Cytogenetic Map 1 p12 UniSTS Cytogenetic Map 2 p23-p22 UniSTS Cytogenetic Map 2 q36.1 UniSTS Cytogenetic Map 11 q23.3 UniSTS Cytogenetic Map 2 p16.1 UniSTS Cytogenetic Map 19 q13.2 UniSTS Cytogenetic Map 16 q12.1 UniSTS Cytogenetic Map 17 q22-q23 UniSTS Cytogenetic Map 2 p11.1 UniSTS Cytogenetic Map 16 q12.2 UniSTS Cytogenetic Map 2 p12-p11.2 UniSTS Cytogenetic Map 3 q11.1 UniSTS Cytogenetic Map 2 p21 UniSTS Cytogenetic Map 17 q11.2-q12 UniSTS Cytogenetic Map 2 q37.1 UniSTS Cytogenetic Map 1 p32-p31 UniSTS Cytogenetic Map 1 p21.3 UniSTS Cytogenetic Map 1 q32.2 UniSTS Cytogenetic Map 19 q13.1 UniSTS Cytogenetic Map 7 q21-q22 UniSTS Cytogenetic Map 1 q25.3 UniSTS Cytogenetic Map 18 p11.3-p11.2 UniSTS Cytogenetic Map 2 q33.2 UniSTS Cytogenetic Map 20 q13.13 UniSTS Cytogenetic Map 21 p11.1 UniSTS Cytogenetic Map 12 q24.31-q24.32 UniSTS Cytogenetic Map 9 q33.2 UniSTS Cytogenetic Map 11 q13.5 UniSTS Cytogenetic Map 12 p12.2-p11.2 UniSTS Cytogenetic Map 21 q22.3 UniSTS Cytogenetic Map 2 q14.3 UniSTS Cytogenetic Map 19 p13.3-p13.2 UniSTS Cytogenetic Map 7 q32.1 UniSTS Cytogenetic Map 8 p21.3 UniSTS Cytogenetic Map 17 q22-q23.2 UniSTS Cytogenetic Map 3 q27.1 UniSTS Cytogenetic Map 11 q13.1 UniSTS Cytogenetic Map 4 q21.21 UniSTS Cytogenetic Map 1 q32 UniSTS Cytogenetic Map 14 q32 UniSTS Cytogenetic Map 14 q24.2 UniSTS Cytogenetic Map 20 q13.33 UniSTS Cytogenetic Map 3 p21 UniSTS Cytogenetic Map 10 p11.23 UniSTS Cytogenetic Map 1 p35.1 UniSTS Cytogenetic Map 1 q25.2 UniSTS Cytogenetic Map 18 q12.1 UniSTS Cytogenetic Map 1 p34.3 UniSTS Cytogenetic Map 2 q11.2 UniSTS Cytogenetic Map 15 q23 UniSTS Cytogenetic Map 8 q24.3 UniSTS Cytogenetic Map 13 q12.11 UniSTS Cytogenetic Map 1 p36.31 UniSTS Cytogenetic Map 3 q21.1 UniSTS Cytogenetic Map 12 p12 UniSTS Cytogenetic Map 21 q22.11 UniSTS Cytogenetic Map 15 q15.3 UniSTS Cytogenetic Map X q12-q13 UniSTS Cytogenetic Map 22 q11.2 UniSTS Cytogenetic Map 7 q31.1-q31.3 UniSTS Cytogenetic Map X p22.11 UniSTS Cytogenetic Map 3 p21.1-p14.2 UniSTS Cytogenetic Map 2 p24 UniSTS Cytogenetic Map 20 p12.1 UniSTS Cytogenetic Map 3 q26.33 UniSTS Cytogenetic Map 12 q13.11-q14.3 UniSTS Cytogenetic Map 2 q37.3 UniSTS Cytogenetic Map 9 q21.33 UniSTS Cytogenetic Map 12 q12 UniSTS Cytogenetic Map X q13-q21 UniSTS Cytogenetic Map 8 q24.22 UniSTS Cytogenetic Map 11 p13 UniSTS Cytogenetic Map 17 q25.1 UniSTS Cytogenetic Map 6 q25.2-q27 UniSTS Cytogenetic Map 12 q24.32 UniSTS Cytogenetic Map 15 q22.31 UniSTS Cytogenetic Map X q13.1 UniSTS Cytogenetic Map 22 q12.2 UniSTS Cytogenetic Map 14 q12 UniSTS Cytogenetic Map 12 q23-q24.1 UniSTS Cytogenetic Map 4 q35.1 UniSTS Cytogenetic Map 17 q24.1 UniSTS Cytogenetic Map 17 p13.3 UniSTS Cytogenetic Map 14 q21 UniSTS Cytogenetic Map 9 p24.3 UniSTS Cytogenetic Map 7 p13 UniSTS Cytogenetic Map 2 p14 UniSTS Cytogenetic Map 21 q22.2 UniSTS Cytogenetic Map 2 q12.3 UniSTS Cytogenetic Map 8 p21.1 UniSTS Cytogenetic Map 17 p13.2 UniSTS Cytogenetic Map 3 q25.33 UniSTS Cytogenetic Map 19 q13.12 UniSTS Cytogenetic Map 5 q31.1 UniSTS Cytogenetic Map 1 p34 UniSTS Cytogenetic Map 19 p13.1 UniSTS Cytogenetic Map 5 q14.1 UniSTS Cytogenetic Map X q22.3 UniSTS Cytogenetic Map 7 p21.1 UniSTS Cytogenetic Map 6 p25.2 UniSTS Cytogenetic Map 10 q23.33 UniSTS Cytogenetic Map 15 q11-q12 UniSTS Cytogenetic Map 3 p22.2 UniSTS Cytogenetic Map 1 p13.3 UniSTS Cytogenetic Map 15 q21.1-q21.2 UniSTS Cytogenetic Map 6 p21.3 UniSTS Cytogenetic Map 7 q34 UniSTS Cytogenetic Map 4 q13.3 UniSTS Cytogenetic Map 19 p13.13 UniSTS Cytogenetic Map 19 q13.41 UniSTS Cytogenetic Map 17 q24.3 UniSTS Cytogenetic Map 12 p13.33 UniSTS Cytogenetic Map 11 q14.1 UniSTS Cytogenetic Map 3 p22-p21.3 UniSTS Cytogenetic Map 16 q22.3 UniSTS Cytogenetic Map 1 p22.1 UniSTS Cytogenetic Map 6 p12.1 UniSTS Cytogenetic Map 19 q13.33-q13.41 UniSTS Cytogenetic Map 2 p25.3 UniSTS Cytogenetic Map 22 q13.2 UniSTS Cytogenetic Map 5 p12 UniSTS Cytogenetic Map 6 q21 UniSTS Cytogenetic Map 7 q35 UniSTS Cytogenetic Map 17 p12 UniSTS Cytogenetic Map 7 q11.1 UniSTS Cytogenetic Map 2 p25.1-p24.1 UniSTS Cytogenetic Map 3 q23 UniSTS Cytogenetic Map 4 q31.21 UniSTS Cytogenetic Map 5 p13.1 UniSTS Cytogenetic Map X q22.1 UniSTS Cytogenetic Map 9 q21.11 UniSTS Cytogenetic Map 5 q13 UniSTS Cytogenetic Map 1 p22.2 UniSTS Cytogenetic Map 12 q13.13 UniSTS Cytogenetic Map 12 q24 UniSTS Cytogenetic Map X q24 UniSTS Cytogenetic Map 1 q24.2 UniSTS Cytogenetic Map 22 q13.31 UniSTS Cytogenetic Map 8 p11.23 UniSTS Cytogenetic Map 1 q23.3 UniSTS Cytogenetic Map 16 p12 UniSTS Cytogenetic Map 10 p15-p14 UniSTS Cytogenetic Map 19 q13 UniSTS Cytogenetic Map 1 q22-q23 UniSTS Cytogenetic Map 20 q11.23 UniSTS Cytogenetic Map 7 q31 UniSTS Cytogenetic Map 10 q26 UniSTS Cytogenetic Map 7 p22.1 UniSTS Cytogenetic Map 6 p22.3 UniSTS Cytogenetic Map 6 p21.2 UniSTS Cytogenetic Map 11 q13.4 UniSTS Cytogenetic Map 11 q24.2 UniSTS Cytogenetic Map X q28 UniSTS Cytogenetic Map 1 p33-p32 UniSTS Cytogenetic Map 5 q35.2 UniSTS Cytogenetic Map 3 p14.3 UniSTS Cytogenetic Map 12 q24.33 UniSTS Cytogenetic Map 3 q26.1-q26.2 UniSTS Cytogenetic Map 12 p13 UniSTS Cytogenetic Map 7 q36.1 UniSTS Cytogenetic Map 8 p11.21 UniSTS Cytogenetic Map 12 q13.1-q13.2 UniSTS Cytogenetic Map 1 p36.11 UniSTS Cytogenetic Map 19 q13.33 UniSTS Cytogenetic Map 16 p12.3 UniSTS Cytogenetic Map 13 q14.11 UniSTS Cytogenetic Map 9 p13.2 UniSTS Cytogenetic Map 4 q22.1 UniSTS Cytogenetic Map 3 q13.2 UniSTS Cytogenetic Map 8 p22 UniSTS Cytogenetic Map 22 q11.23 UniSTS Cytogenetic Map 22 q11.21 UniSTS Cytogenetic Map 1 q42.3 UniSTS Cytogenetic Map 19 q13.43 UniSTS Cytogenetic Map 5 q12.3 UniSTS Cytogenetic Map 20 q11.21 UniSTS Cytogenetic Map 9 q34.11 UniSTS Cytogenetic Map 12 q14.3 UniSTS Cytogenetic Map 6 q15 UniSTS Cytogenetic Map 6 q22.32 UniSTS Cytogenetic Map 6 p21.1 UniSTS Cytogenetic Map 19 q13.31 UniSTS Cytogenetic Map 16 p13.11 UniSTS Cytogenetic Map 10 q24.32 UniSTS Cytogenetic Map 4 p16.1 UniSTS Cytogenetic Map 18 q11.1 UniSTS Cytogenetic Map 16 q23.2 UniSTS Cytogenetic Map 3 q12.1 UniSTS Cytogenetic Map 15 q24-q25 UniSTS Cytogenetic Map 7 q31.1 UniSTS Cytogenetic Map 15 q26.1 UniSTS Cytogenetic Map 8 q13.1 UniSTS Cytogenetic Map 6 pter-p12.1 UniSTS Cytogenetic Map 6 q16 UniSTS Cytogenetic Map 12 q14.1 UniSTS Cytogenetic Map 17 q21.2 UniSTS Cytogenetic Map 9 q22.2 UniSTS Cytogenetic Map 17 q23.2 UniSTS Cytogenetic Map 11 q23.1-q23.2 UniSTS Cytogenetic Map 13 q14 UniSTS Cytogenetic Map 4 q23 UniSTS Cytogenetic Map 16 p12.2 UniSTS Cytogenetic Map 11 q24.3 UniSTS Cytogenetic Map 7 p14 UniSTS Cytogenetic Map 15 q24.1 UniSTS Cytogenetic Map 16 q24.2 UniSTS Cytogenetic Map 12 q13.11 UniSTS Cytogenetic Map 9 p13.3 UniSTS Cytogenetic Map 8 q22.1 UniSTS Cytogenetic Map 6 q16.2 UniSTS Cytogenetic Map 5 p15.2 UniSTS Cytogenetic Map 20 q13.12 UniSTS Cytogenetic Map 14 q22.3 UniSTS Cytogenetic Map 2 q13 UniSTS Cytogenetic Map 3 p21.3 UniSTS Cytogenetic Map 12 q13.2 UniSTS Cytogenetic Map 20 p13 UniSTS Cytogenetic Map 3 q29 UniSTS Cytogenetic Map 5 q23.3-q31.1 UniSTS Cytogenetic Map 1 p36 UniSTS Cytogenetic Map 19 p13.11 UniSTS Cytogenetic Map 17 q12 UniSTS Cytogenetic Map 2 q35 UniSTS Cytogenetic Map 17 p11.2 UniSTS Cytogenetic Map 1 p34.2 UniSTS Cytogenetic Map 12 p13.31 UniSTS Cytogenetic Map 3 q12.3 UniSTS Cytogenetic Map 11 q23 UniSTS Cytogenetic Map 12 q24.31 UniSTS Cytogenetic Map 17 q25.3 UniSTS Cytogenetic Map 20 q11 UniSTS Cytogenetic Map 16 q22.1 UniSTS Cytogenetic Map 5 q23.3 UniSTS Cytogenetic Map 15 q15.1 UniSTS Cytogenetic Map 17 q21 UniSTS Cytogenetic Map 1 q42 UniSTS Cytogenetic Map X p11.23 UniSTS Cytogenetic Map 12 q24.13 UniSTS Cytogenetic Map 3 q27.3 UniSTS Cytogenetic Map 14 q21.3 UniSTS Cytogenetic Map 19 p13.3 UniSTS Cytogenetic Map 2 p15 UniSTS Cytogenetic Map 17 q22 UniSTS Cytogenetic Map 20 q13.32 UniSTS Cytogenetic Map 14 q24.3 UniSTS Cytogenetic Map X q21.1 UniSTS
RH45469
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 17 q11.2 UniSTS GeneMap99-GB4 RH Map 17 309.01 UniSTS NCBI RH Map 17 474.9 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2435
2788
2249
4961
1726
2349
5
623
1951
465
2268
7298
6466
53
3725
1
851
1741
1614
171
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000293328 ⟹ ENSP00000293328
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,177 - 42,276,391 (-) Ensembl
Ensembl Acc Id:
ENST00000415845 ⟹ ENSP00000398379
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,177 - 42,276,707 (-) Ensembl
Ensembl Acc Id:
ENST00000468312
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,217,690 - 42,276,406 (-) Ensembl
Ensembl Acc Id:
ENST00000468496
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,207,582 - 42,217,282 (-) Ensembl
Ensembl Acc Id:
ENST00000481253
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,207,559 - 42,210,592 (-) Ensembl
Ensembl Acc Id:
ENST00000481517
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,210,417 - 42,217,871 (-) Ensembl
Ensembl Acc Id:
ENST00000498674
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,189 - 42,203,417 (-) Ensembl
Ensembl Acc Id:
ENST00000698774
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,176 - 42,276,411 (-) Ensembl
Ensembl Acc Id:
ENST00000698775 ⟹ ENSP00000513922
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,176 - 42,276,412 (-) Ensembl
Ensembl Acc Id:
ENST00000698776 ⟹ ENSP00000513923
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,176 - 42,288,331 (-) Ensembl
Ensembl Acc Id:
ENST00000698777 ⟹ ENSP00000513924
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,176 - 42,288,633 (-) Ensembl
Ensembl Acc Id:
ENST00000698778 ⟹ ENSP00000513925
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,181 - 42,276,397 (-) Ensembl
Ensembl Acc Id:
ENST00000698779 ⟹ ENSP00000513926
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,190 - 42,276,397 (-) Ensembl
Ensembl Acc Id:
ENST00000698801
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,176 - 42,223,807 (-) Ensembl
Ensembl Acc Id:
ENST00000698802 ⟹ ENSP00000513944
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,176 - 42,232,127 (-) Ensembl
Ensembl Acc Id:
ENST00000698803 ⟹ ENSP00000513945
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,176 - 42,276,352 (-) Ensembl
Ensembl Acc Id:
ENST00000698804
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,176 - 42,276,356 (-) Ensembl
Ensembl Acc Id:
ENST00000698805
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,176 - 42,276,358 (-) Ensembl
Ensembl Acc Id:
ENST00000698806 ⟹ ENSP00000513946
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,176 - 42,276,371 (-) Ensembl
Ensembl Acc Id:
ENST00000698807
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,176 - 42,276,391 (-) Ensembl
Ensembl Acc Id:
ENST00000698808 ⟹ ENSP00000513947
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,176 - 42,276,397 (-) Ensembl
Ensembl Acc Id:
ENST00000698809 ⟹ ENSP00000513948
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,176 - 42,276,397 (-) Ensembl
Ensembl Acc Id:
ENST00000698810 ⟹ ENSP00000513949
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,176 - 42,276,413 (-) Ensembl
Ensembl Acc Id:
ENST00000698811
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,181 - 42,205,280 (-) Ensembl
Ensembl Acc Id:
ENST00000698812 ⟹ ENSP00000513950
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,181 - 42,232,129 (-) Ensembl
Ensembl Acc Id:
ENST00000698813 ⟹ ENSP00000513951
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,181 - 42,276,397 (-) Ensembl
Ensembl Acc Id:
ENST00000698814 ⟹ ENSP00000513952
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,181 - 42,276,397 (-) Ensembl
Ensembl Acc Id:
ENST00000698815 ⟹ ENSP00000513953
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,199,181 - 42,276,397 (-) Ensembl
Ensembl Acc Id:
ENST00000698816
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,211,861 - 42,276,325 (-) Ensembl
Ensembl Acc Id:
ENST00000698817
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 42,222,884 - 42,232,139 (-) Ensembl
RefSeq Acc Id:
NM_012448 ⟹ NP_036580
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 42,199,177 - 42,276,391 (-) NCBI GRCh37 17 40,351,195 - 40,428,478 (-) NCBI Build 36 17 37,604,721 - 37,681,950 (-) NCBI Archive HuRef 17 36,116,230 - 36,193,344 (-) ENTREZGENE CHM1_1 17 40,586,923 - 40,664,134 (-) NCBI T2T-CHM13v2.0 17 43,055,661 - 43,132,878 (-) NCBI
Sequence:
GGCGGCCGGAGCCGTCACCCCGGGCGGGGACCCAGCGCAGGCAACTCCGCGCGGCGGCCCGGCCGAGGGAGGGAGCGAGCGGGCGGGCGGGCAAGCCAGACAGCTGGGCCGGAGCAGCCGCGGGCGCC
hide sequence
RefSeq Acc Id:
XM_005257626 ⟹ XP_005257683
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 42,214,532 - 42,276,391 (-) NCBI GRCh37 17 40,351,195 - 40,428,478 (-) NCBI
Sequence:
GCGCGCGTCCCTGGGCCTCCGCGCGTGAGCGGCGCGCGCGCCCCCGCGGGCCCCGGCGGGAGGAGAGTCGGCGGCCGGAGCCGTCACCCCGGGCGGGGACCCAGCGCAGGCAACTCCGCGCGGCGGCC
hide sequence
RefSeq Acc Id:
XM_017024977 ⟹ XP_016880466
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 42,199,177 - 42,276,391 (-) NCBI
Sequence:
AGCCGTCACCCCGGGCGGGGACCCAGCGCAGGCAACTCCGCGCGGCGGCCCGGCCGAGGGAGGG
hide sequence
RefSeq Acc Id:
XM_024450897 ⟹ XP_024306665
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 42,199,177 - 42,288,370 (-) NCBI
Sequence:
TACACAGCGCGCGAGCCCGCGCCAGCAGCCCTCCCAGCCCCGCTTGCTCCCTCCCTGCCTCGCCCTCAGTCGCCGGCTCCCCTGCAAGTGCGCAACAGCGGCGGCCGTTCCCGGCGGGCGGCGCCGGG
hide sequence
RefSeq Acc Id:
XM_024450898 ⟹ XP_024306666
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 42,199,177 - 42,275,633 (-) NCBI
Sequence:
TACGTAACTATAGTCGTTTGTCACTTAATGATACATGGTGACAAAGTTCTAAGAAATGCATTAGGCGATTTTGTCATTGTGGTACCATCATAGAGGGTACTTACACAAACGTAGATGGTGAGCCCTAC
hide sequence
RefSeq Acc Id:
XM_047436593 ⟹ XP_047292549
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 42,199,177 - 42,288,370 (-) NCBI
RefSeq Acc Id:
XM_054316998 ⟹ XP_054172973
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 17 43,055,661 - 43,144,521 (-) NCBI
RefSeq Acc Id:
XM_054316999 ⟹ XP_054172974
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 17 43,055,661 - 43,125,343 (-) NCBI
RefSeq Acc Id:
XM_054317000 ⟹ XP_054172975
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 17 43,055,661 - 43,132,878 (-) NCBI
RefSeq Acc Id:
XM_054317001 ⟹ XP_054172976
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 17 43,055,661 - 43,144,356 (-) NCBI
RefSeq Acc Id:
XM_054317002 ⟹ XP_054172977
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 17 43,071,012 - 43,132,878 (-) NCBI
RefSeq Acc Id:
NP_036580 ⟸ NM_012448
- UniProtKB:
Q8WWS8 (UniProtKB/Swiss-Prot), P51692 (UniProtKB/Swiss-Prot), A0A8V8TP16 (UniProtKB/TrEMBL)
- Sequence:
MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSS
hide sequence
RefSeq Acc Id:
XP_005257683 ⟸ XM_005257626
- Peptide Label:
isoform X3
- UniProtKB:
A0A8V8TM91 (UniProtKB/TrEMBL)
- Sequence:
MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGL
hide sequence
RefSeq Acc Id:
XP_016880466 ⟸ XM_017024977
- Peptide Label:
isoform X2
- UniProtKB:
A0A8V8TP16 (UniProtKB/TrEMBL)
- Sequence:
MNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDT
hide sequence
RefSeq Acc Id:
XP_024306665 ⟸ XM_024450897
- Peptide Label:
isoform X1
- UniProtKB:
P51692 (UniProtKB/Swiss-Prot), Q8WWS8 (UniProtKB/Swiss-Prot), A0A8V8TP16 (UniProtKB/TrEMBL)
- Sequence:
MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSS
hide sequence
RefSeq Acc Id:
XP_024306666 ⟸ XM_024450898
- Peptide Label:
isoform X1
- UniProtKB:
P51692 (UniProtKB/Swiss-Prot), Q8WWS8 (UniProtKB/Swiss-Prot), A0A8V8TP16 (UniProtKB/TrEMBL)
- Sequence:
MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGL
hide sequence
Ensembl Acc Id:
ENSP00000293328 ⟸ ENST00000293328
Ensembl Acc Id:
ENSP00000398379 ⟸ ENST00000415845
RefSeq Acc Id:
XP_047292549 ⟸ XM_047436593
- Peptide Label:
isoform X2
- UniProtKB:
A0A8V8TP16 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSP00000513945 ⟸ ENST00000698803
Ensembl Acc Id:
ENSP00000513926 ⟸ ENST00000698779
Ensembl Acc Id:
ENSP00000513952 ⟸ ENST00000698814
Ensembl Acc Id:
ENSP00000513924 ⟸ ENST00000698777
Ensembl Acc Id:
ENSP00000513949 ⟸ ENST00000698810
Ensembl Acc Id:
ENSP00000513922 ⟸ ENST00000698775
Ensembl Acc Id:
ENSP00000513925 ⟸ ENST00000698778
Ensembl Acc Id:
ENSP00000513951 ⟸ ENST00000698813
Ensembl Acc Id:
ENSP00000513947 ⟸ ENST00000698808
Ensembl Acc Id:
ENSP00000513923 ⟸ ENST00000698776
Ensembl Acc Id:
ENSP00000513953 ⟸ ENST00000698815
Ensembl Acc Id:
ENSP00000513944 ⟸ ENST00000698802
Ensembl Acc Id:
ENSP00000513946 ⟸ ENST00000698806
Ensembl Acc Id:
ENSP00000513948 ⟸ ENST00000698809
Ensembl Acc Id:
ENSP00000513950 ⟸ ENST00000698812
RefSeq Acc Id:
XP_054172973 ⟸ XM_054316998
- Peptide Label:
isoform X1
- UniProtKB:
P51692 (UniProtKB/Swiss-Prot), Q8WWS8 (UniProtKB/Swiss-Prot), A0A8V8TP16 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054172976 ⟸ XM_054317001
- Peptide Label:
isoform X2
- UniProtKB:
A0A8V8TP16 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054172975 ⟸ XM_054317000
- Peptide Label:
isoform X2
- UniProtKB:
A0A8V8TP16 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054172974 ⟸ XM_054316999
- Peptide Label:
isoform X1
- UniProtKB:
P51692 (UniProtKB/Swiss-Prot), Q8WWS8 (UniProtKB/Swiss-Prot), A0A8V8TP16 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054172977 ⟸ XM_054317002
- Peptide Label:
isoform X3
- UniProtKB:
A0A8V8TM91 (UniProtKB/TrEMBL)
RGD ID: 6794594 Promoter ID: HG_KWN:26182 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: OTTHUMT00000319797, OTTHUMT00000319798, OTTHUMT00000319799 Position: Human Assembly Chr Position (strand) Source Build 36 17 37,681,926 - 37,682,642 (-) MPROMDB
RGD ID: 7235067 Promoter ID: EPDNEW_H23279 Type: initiation region Name: STAT5B_3 Description: signal transducer and activator of transcription 5B SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H23280 EPDNEW_H23285 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 17 42,275,631 - 42,275,691 EPDNEW
RGD ID: 7235069 Promoter ID: EPDNEW_H23280 Type: initiation region Name: STAT5B_1 Description: signal transducer and activator of transcription 5B SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H23279 EPDNEW_H23285 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 17 42,276,375 - 42,276,435 EPDNEW
RGD ID: 7235081 Promoter ID: EPDNEW_H23285 Type: initiation region Name: STAT5B_2 Description: signal transducer and activator of transcription 5B SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H23279 EPDNEW_H23280 Experiment Methods: Single-end sequencing.; Paired-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 17 42,288,537 - 42,288,597 EPDNEW
