Symbol:
Trhde
Name:
thyrotropin-releasing hormone degrading enzyme
RGD ID:
728895
Description:
Predicted to enable metalloaminopeptidase activity; peptide binding activity; and zinc ion binding activity. Predicted to be involved in peptide catabolic process and proteolysis. Predicted to be active in cytoplasm; extracellular space; and membrane. Orthologous to human TRHDE (thyrotropin releasing hormone degrading enzyme); INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
PAP-II; pyroglutamyl-peptidase II; thyroliberinase; thyrotropin-releasing hormone degrading ectoenzyme; thyrotropin-releasing hormone-degrading ectoenzyme; TRH-DE; TRH-degrading ectoenzyme; TRH-specific aminopeptidase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 51,829,473 - 52,236,843 (-) NCBI GRCr8 mRatBN7.2 7 49,943,271 - 50,350,613 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 49,945,766 - 50,367,371 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 51,852,771 - 52,257,524 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 54,055,893 - 54,460,654 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 53,833,748 - 54,238,531 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 57,253,023 - 57,679,795 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 57,253,023 - 57,679,795 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 57,265,684 - 57,693,174 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 53,591,770 - 54,021,219 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 53,612,156 - 54,024,183 (-) NCBI Celera 7 46,740,631 - 47,161,218 (-) NCBI Celera Cytogenetic Map 7 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Trhde Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of TRHDE mRNA] CTD PMID:31150632 Trhde Rat (1->4)-beta-D-glucan multiple interactions ISO Trhde (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TRHDE mRNA CTD PMID:36331819 Trhde Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of TRHDE mRNA CTD PMID:30723492 Trhde Rat 17beta-estradiol decreases expression ISO TRHDE (Homo sapiens) 6480464 Estradiol results in decreased expression of TRHDE mRNA CTD PMID:20106945 Trhde Rat 17beta-estradiol decreases expression ISO Trhde (Mus musculus) 6480464 Estradiol results in decreased expression of TRHDE mRNA CTD PMID:39298647 Trhde Rat 2,2',5,5'-tetrachlorobiphenyl decreases expression ISO TRHDE (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Trhde Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO TRHDE (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TRHDE mRNA CTD PMID:20106945 Trhde Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TRHDE mRNA CTD PMID:32109520 Trhde Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of TRHDE mRNA CTD PMID:22298810 Trhde Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Trhde Rat 2-palmitoylglycerol increases expression ISO TRHDE (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of TRHDE mRNA CTD PMID:37199045 Trhde Rat 4,4'-sulfonyldiphenol increases expression ISO TRHDE (Homo sapiens) 6480464 bisphenol S results in increased expression of TRHDE mRNA CTD PMID:30616060 Trhde Rat 4,4'-sulfonyldiphenol affects methylation ISO Trhde (Mus musculus) 6480464 bisphenol S affects the methylation of TRHDE gene CTD PMID:31683443 Trhde Rat 4,4'-sulfonyldiphenol decreases expression ISO Trhde (Mus musculus) 6480464 bisphenol S results in decreased expression of TRHDE mRNA CTD PMID:39298647 Trhde Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of TRHDE mRNA CTD PMID:24780913 and PMID:25825206 Trhde Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of TRHDE mRNA CTD PMID:31881176 Trhde Rat aflatoxin B1 affects expression ISO TRHDE (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of TRHDE protein CTD PMID:20106945 Trhde Rat aflatoxin B1 increases methylation ISO TRHDE (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of TRHDE intron CTD PMID:30157460 Trhde Rat aflatoxin B1 decreases methylation ISO TRHDE (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of TRHDE gene CTD PMID:27153756 Trhde Rat aristolochic acid A decreases expression ISO TRHDE (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of TRHDE mRNA CTD PMID:33212167 Trhde Rat arsane affects methylation ISO TRHDE (Homo sapiens) 6480464 Arsenic affects the methylation of TRHDE gene CTD PMID:25304211 Trhde Rat arsenic atom affects methylation ISO TRHDE (Homo sapiens) 6480464 Arsenic affects the methylation of TRHDE gene CTD PMID:25304211 Trhde Rat arsenite(3-) multiple interactions ISO TRHDE (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to TRHDE mRNA] CTD PMID:32406909 Trhde Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of TRHDE gene CTD PMID:35440735 Trhde Rat benzo[a]pyrene decreases expression ISO TRHDE (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of TRHDE mRNA CTD PMID:20106945 and PMID:32234424 Trhde Rat benzo[a]pyrene affects methylation ISO TRHDE (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of TRHDE intron CTD PMID:30157460 Trhde Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of TRHDE mRNA CTD PMID:21839799 Trhde Rat benzo[e]pyrene decreases methylation ISO TRHDE (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of TRHDE intron CTD PMID:30157460 Trhde Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TRHDE mRNA CTD PMID:25181051 more ... Trhde Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TRHDE mRNA CTD PMID:33296240 Trhde Rat carbamazepine affects expression ISO TRHDE (Homo sapiens) 6480464 Carbamazepine affects the expression of TRHDE mRNA CTD PMID:25979313 Trhde Rat chlorpyrifos decreases expression ISO Trhde (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of TRHDE mRNA CTD PMID:37019170 Trhde Rat choline multiple interactions ISO Trhde (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of TRHDE gene CTD PMID:20938992 Trhde Rat cisplatin multiple interactions ISO TRHDE (Homo sapiens) 6480464 Cisplatin inhibits the reaction [Piroxicam results in decreased expression of TRHDE mRNA] CTD PMID:21858171 Trhde Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of TRHDE mRNA CTD PMID:26577399 Trhde Rat cyclosporin A decreases expression ISO TRHDE (Homo sapiens) 6480464 Cyclosporine results in decreased expression of TRHDE mRNA CTD PMID:20106945 and PMID:27989131 Trhde Rat dorsomorphin multiple interactions ISO TRHDE (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Trhde Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of TRHDE mRNA CTD PMID:29391264 Trhde Rat ethanol affects splicing ISO Trhde (Mus musculus) 6480464 Ethanol affects the splicing of TRHDE mRNA CTD PMID:30319688 Trhde Rat folic acid multiple interactions ISO Trhde (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of TRHDE gene CTD PMID:20938992 Trhde Rat folic acid decreases expression ISO Trhde (Mus musculus) 6480464 Folic Acid results in decreased expression of TRHDE mRNA CTD PMID:25629700 Trhde Rat fonofos increases methylation ISO TRHDE (Homo sapiens) 6480464 Fonofos results in increased methylation of TRHDE promoter CTD PMID:22847954 Trhde Rat furan decreases expression EXP 6480464 furan results in decreased expression of TRHDE mRNA CTD PMID:25539665 Trhde Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of TRHDE mRNA CTD PMID:24915197 Trhde Rat L-methionine multiple interactions ISO Trhde (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of TRHDE gene CTD PMID:20938992 Trhde Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of TRHDE mRNA CTD PMID:29571894 Trhde Rat lead diacetate affects methylation EXP 6480464 lead acetate affects the methylation of TRHDE gene CTD PMID:29571894 Trhde Rat methapyrilene decreases methylation ISO TRHDE (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of TRHDE intron CTD PMID:30157460 Trhde Rat N-Nitrosopyrrolidine decreases expression ISO TRHDE (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of TRHDE mRNA CTD PMID:32234424 Trhde Rat O-methyleugenol decreases expression ISO TRHDE (Homo sapiens) 6480464 methyleugenol results in decreased expression of TRHDE mRNA CTD PMID:32234424 Trhde Rat parathion increases methylation ISO TRHDE (Homo sapiens) 6480464 Parathion results in increased methylation of TRHDE promoter CTD PMID:22847954 Trhde Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Trhde (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TRHDE mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of TRHDE mRNA CTD PMID:36331819 Trhde Rat phenylmercury acetate increases expression ISO TRHDE (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of TRHDE mRNA CTD PMID:26272509 Trhde Rat phenylmercury acetate multiple interactions ISO TRHDE (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TRHDE mRNA CTD PMID:27188386 Trhde Rat phorbol 13-acetate 12-myristate multiple interactions ISO TRHDE (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of TRHDE mRNA CTD PMID:16979875 Trhde Rat piroxicam decreases expression ISO TRHDE (Homo sapiens) 6480464 Piroxicam results in decreased expression of TRHDE mRNA CTD PMID:21858171 Trhde Rat piroxicam multiple interactions ISO TRHDE (Homo sapiens) 6480464 Cisplatin inhibits the reaction [Piroxicam results in decreased expression of TRHDE mRNA] CTD PMID:21858171 Trhde Rat SB 431542 multiple interactions ISO TRHDE (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Trhde Rat sodium arsenite increases expression ISO TRHDE (Homo sapiens) 6480464 sodium arsenite results in increased expression of TRHDE mRNA CTD PMID:38568856 Trhde Rat sodium arsenite decreases expression ISO Trhde (Mus musculus) 6480464 sodium arsenite results in decreased expression of TRHDE mRNA CTD PMID:36209798 Trhde Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of TRHDE mRNA CTD PMID:25993096 Trhde Rat terbufos increases methylation ISO TRHDE (Homo sapiens) 6480464 terbufos results in increased methylation of TRHDE promoter CTD PMID:22847954 Trhde Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of TRHDE mRNA CTD PMID:31150632 Trhde Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of TRHDE mRNA] CTD PMID:31150632 Trhde Rat thioacetamide decreases activity EXP 6480464 Thioacetamide results in decreased activity of TRHDE protein CTD PMID:11856362 Trhde Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of TRHDE mRNA CTD PMID:23411599 and PMID:34492290 Trhde Rat titanium dioxide decreases methylation ISO Trhde (Mus musculus) 6480464 titanium dioxide results in decreased methylation of TRHDE gene CTD PMID:35295148 Trhde Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of TRHDE mRNA CTD PMID:33387578 Trhde Rat valproic acid affects expression ISO TRHDE (Homo sapiens) 6480464 Valproic Acid affects the expression of TRHDE mRNA CTD PMID:25979313 Trhde Rat valproic acid multiple interactions ISO TRHDE (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of TRHDE mRNA CTD PMID:27188386 Trhde Rat valproic acid increases expression ISO TRHDE (Homo sapiens) 6480464 Valproic Acid results in increased expression of TRHDE mRNA CTD PMID:23179753 more ... Trhde Rat valproic acid decreases expression ISO Trhde (Mus musculus) 6480464 Valproic Acid results in decreased expression of TRHDE mRNA CTD PMID:24896083 Trhde Rat valproic acid decreases methylation ISO TRHDE (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of TRHDE gene CTD PMID:29154799 Trhde Rat vorinostat increases expression ISO TRHDE (Homo sapiens) 6480464 vorinostat results in increased expression of TRHDE mRNA CTD PMID:27188386 Trhde Rat zinc atom multiple interactions ISO TRHDE (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of TRHDE mRNA CTD PMID:16979875 Trhde Rat zinc(0) multiple interactions ISO TRHDE (Homo sapiens) 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of TRHDE mRNA CTD PMID:16979875
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-palmitoylglycerol (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aflatoxin B1 (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) atrazine (EXP) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (ISO) bisphenol A (EXP) carbamazepine (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (ISO) Cuprizon (EXP) cyclosporin A (ISO) dorsomorphin (ISO) endosulfan (EXP) ethanol (ISO) folic acid (ISO) fonofos (ISO) furan (EXP) glycidol (EXP) L-methionine (ISO) lead diacetate (EXP) methapyrilene (ISO) N-Nitrosopyrrolidine (ISO) O-methyleugenol (ISO) parathion (ISO) perfluorooctane-1-sulfonic acid (ISO) phenylmercury acetate (ISO) phorbol 13-acetate 12-myristate (ISO) piroxicam (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium dichromate (EXP) terbufos (ISO) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) valproic acid (ISO) vorinostat (ISO) zinc atom (ISO) zinc(0) (ISO)
Trhde Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 51,829,473 - 52,236,843 (-) NCBI GRCr8 mRatBN7.2 7 49,943,271 - 50,350,613 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 49,945,766 - 50,367,371 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 51,852,771 - 52,257,524 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 54,055,893 - 54,460,654 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 53,833,748 - 54,238,531 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 57,253,023 - 57,679,795 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 57,253,023 - 57,679,795 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 57,265,684 - 57,693,174 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 53,591,770 - 54,021,219 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 53,612,156 - 54,024,183 (-) NCBI Celera 7 46,740,631 - 47,161,218 (-) NCBI Celera Cytogenetic Map 7 q22 NCBI
TRHDE Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 72,087,266 - 72,670,758 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 72,087,266 - 72,670,758 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 72,666,150 - 73,064,538 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 70,952,730 - 71,345,689 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 70,952,729 - 71,345,688 NCBI Celera 12 72,329,850 - 72,723,987 (+) NCBI Celera Cytogenetic Map 12 q21.1 NCBI HuRef 12 69,714,852 - 70,107,634 (+) NCBI HuRef CHM1_1 12 72,632,089 - 73,024,946 (+) NCBI CHM1_1 T2T-CHM13v2.0 12 72,063,195 - 72,646,521 (+) NCBI T2T-CHM13v2.0
Trhde Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 114,234,725 - 114,638,207 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 114,234,726 - 114,638,212 (-) Ensembl GRCm39 Ensembl GRCm38 10 114,398,820 - 114,802,302 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 114,398,821 - 114,802,307 (-) Ensembl GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 114,398,823 - 114,802,307 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 113,835,877 - 114,238,426 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 113,803,133 - 114,205,474 (-) NCBI MGSCv36 mm8 Celera 10 116,334,960 - 116,737,119 (-) NCBI Celera Cytogenetic Map 10 D2 NCBI cM Map 10 61.59 NCBI
Trhde Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955405 12,229,448 - 12,623,675 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955405 12,229,448 - 12,624,753 (+) NCBI ChiLan1.0 ChiLan1.0
TRHDE Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 80,300,714 - 80,696,949 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 80,297,114 - 80,693,349 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 69,795,208 - 70,191,298 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 72,652,776 - 73,047,182 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 72,652,958 - 73,073,418 (+) Ensembl panpan1.1 panPan2
TRHDE Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 13,744,907 - 14,118,023 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 13,744,591 - 14,115,437 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 13,685,019 - 14,055,891 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 13,883,046 - 14,254,797 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 13,883,046 - 14,249,827 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 13,743,941 - 14,115,272 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 13,995,000 - 14,365,815 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 14,116,319 - 14,488,005 (+) NCBI UU_Cfam_GSD_1.0
Trhde Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 44,067,297 - 44,437,562 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936568 1,290,774 - 1,662,542 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936568 1,290,758 - 1,660,520 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TRHDE Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 36,274,165 - 36,658,701 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 36,266,883 - 36,663,208 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 39,289,649 - 39,520,695 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TRHDE Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 67,912,122 - 68,313,509 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 67,912,138 - 68,315,962 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 177,295,134 - 177,727,707 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Trhde
.
Predicted Target Of
Count of predictions: 508 Count of miRNA genes: 267 Interacting mature miRNAs: 321 Transcripts: ENSRNOT00000007461 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
7411569 Bw137 Body weight QTL 137 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 21921195 66921195 Rat 1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 2293667 Bss42 Bone structure and strength QTL 42 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 7 47651439 92651439 Rat 10053722 Scort27 Serum corticosterone level QTL 27 2.41 0.0083 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 43228750 88228750 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 1578652 Bmd15 Bone mineral density QTL 15 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 7 9866467 60460686 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 10059605 Kidm47 Kidney mass QTL 47 2.91 0.05 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 47251783 65728867 Rat 2293678 Bss24 Bone structure and strength QTL 24 6.71 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 7 47651439 92651439 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 2298547 Neuinf5 Neuroinflammation QTL 5 3.7 nervous system integrity trait (VT:0010566) spinal cord Cd74 protein level (CMO:0002131) 7 9462246 58265113 Rat 631513 Scl7 Serum cholesterol level QTL 7 4.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 37960569 82960569 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 2293685 Bmd21 Bone mineral density QTL 21 4.2 0.0003 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 7 47651439 92651439 Rat 10755453 Coatc12 Coat color QTL 12 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 31112832 76112832 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 1354639 Spl5 Serum phospholipid level QTL 5 3.9 blood LDL phospholipid amount (VT:0010505) blood low density lipoprotein phospholipid level (CMO:0001568) 7 19654317 52888450 Rat 10755451 Coatc11 Coat color QTL 11 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 17944357 62944357 Rat 634326 Hc3 Hypercalciuria QTL 3 2.1 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 7 42787314 87787314 Rat 2317059 Aia15 Adjuvant induced arthritis QTL 15 2.46 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 17004598 62004598 Rat 2293696 Bmd32 Bone mineral density QTL 32 5.1 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 7 47651439 92651439 Rat 7411605 Foco14 Food consumption QTL 14 24.1 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 34293282 79293282 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 631534 Lnnr1 Liver neoplastic nodule remodeling QTL 1 3.85 0.001 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 7 34293282 79293282 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 2293707 Bss32 Bone structure and strength QTL 32 7.64 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 47651439 92651439 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2303629 Vencon3 Ventilatory control QTL 3 7.25 respiration trait (VT:0001943) respiration rate (CMO:0000289) 7 41109692 56793354 Rat 2293644 Bmd29 Bone mineral density QTL 29 5.4 0.0001 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 7 47651439 92651439 Rat 70190 Mcs6 Mammary carcinoma susceptibility QTL 6 2.29 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 26737401 63902784 Rat 2300178 Bmd54 Bone mineral density QTL 54 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 7 47651439 92651439 Rat 61428 Scl3 Serum cholesterol level QTL 3 3.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 44867533 89867533 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 1300138 Hrtrt9 Heart rate QTL 9 4.72 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 29409683 53612950 Rat 10402855 Bp379 Blood pressure QTL 379 0.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 29409683 74409683 Rat 738033 Anxrr6 Anxiety related response QTL 6 4.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 7 15573889 60573889 Rat
D7Got80
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 50,032,914 - 50,033,085 (+) MAPPER mRatBN7.2 Rnor_6.0 7 57,340,069 - 57,340,239 NCBI Rnor6.0 Rnor_5.0 7 57,352,464 - 57,352,634 UniSTS Rnor5.0 RGSC_v3.4 7 53,679,915 - 53,680,086 RGD RGSC3.4 RGSC_v3.4 7 53,679,916 - 53,680,086 UniSTS RGSC3.4 RGSC_v3.1 7 53,700,549 - 53,700,719 RGD Celera 7 46,827,288 - 46,827,458 UniSTS RH 3.4 Map 7 440.1 UniSTS RH 3.4 Map 7 440.1 RGD RH 2.0 Map 7 403.5 RGD Cytogenetic Map 7 q22 UniSTS
D7Wox33
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 51,833,723 - 51,833,851 (+) Marker Load Pipeline mRatBN7.2 7 49,947,519 - 49,947,647 (+) MAPPER mRatBN7.2 Rnor_6.0 7 57,254,777 - 57,254,902 NCBI Rnor6.0 Rnor_5.0 7 57,267,438 - 57,267,563 UniSTS Rnor5.0 RGSC_v3.4 7 53,593,524 - 53,593,651 UniSTS RGSC3.4 Celera 7 46,742,385 - 46,742,510 UniSTS Cytogenetic Map 7 q22 UniSTS
RH131058
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 50,368,172 - 50,368,392 (+) MAPPER mRatBN7.2 Rnor_6.0 7 57,680,597 - 57,680,816 NCBI Rnor6.0 Rnor_5.0 7 57,693,976 - 57,694,195 UniSTS Rnor5.0 RGSC_v3.4 7 54,022,021 - 54,022,240 UniSTS RGSC3.4 Celera 7 47,162,017 - 47,162,236 UniSTS RH 3.4 Map 7 442.8 UniSTS Cytogenetic Map 7 q22 UniSTS
RH144062
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 50,352,592 - 50,352,699 (+) MAPPER mRatBN7.2 Rnor_6.0 7 57,665,019 - 57,665,125 NCBI Rnor6.0 Rnor_5.0 7 57,678,398 - 57,678,504 UniSTS Rnor5.0 RGSC_v3.4 7 54,006,445 - 54,006,551 UniSTS RGSC3.4 Celera 7 47,146,450 - 47,146,556 UniSTS RH 3.4 Map 7 442.21 UniSTS Cytogenetic Map 7 q22 UniSTS
BI302213
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 50,068,604 - 50,068,813 (+) MAPPER mRatBN7.2 Rnor_6.0 7 57,375,691 - 57,375,899 NCBI Rnor6.0 Rnor_5.0 7 57,388,086 - 57,388,294 UniSTS Rnor5.0 RGSC_v3.4 7 53,715,604 - 53,715,812 UniSTS RGSC3.4 Celera 7 46,862,952 - 46,863,160 UniSTS RH 3.4 Map 7 442.6 UniSTS Cytogenetic Map 7 q22 UniSTS
RH141425
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 49,946,078 - 49,946,258 (+) MAPPER mRatBN7.2 Rnor_6.0 7 57,253,336 - 57,253,515 NCBI Rnor6.0 Rnor_5.0 7 57,265,997 - 57,266,176 UniSTS Rnor5.0 RGSC_v3.4 7 53,592,083 - 53,592,262 UniSTS RGSC3.4 Celera 7 46,740,944 - 46,741,123 UniSTS RH 3.4 Map 7 440.8 UniSTS Cytogenetic Map 7 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
47
113
79
78
47
25
47
6
203
94
93
45
58
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000007461 ⟹ ENSRNOP00000007461
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 49,945,766 - 50,367,371 (-) Ensembl Rnor_6.0 Ensembl 7 57,253,023 - 57,679,795 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000109488 ⟹ ENSRNOP00000079029
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 49,948,355 - 50,367,371 (-) Ensembl
RefSeq Acc Id:
NM_001108991 ⟹ NP_001102461
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 51,832,111 - 52,236,843 (-) NCBI mRatBN7.2 7 49,945,907 - 50,350,613 (-) NCBI Rnor_6.0 7 57,253,023 - 57,679,795 (-) NCBI Rnor_5.0 7 57,265,684 - 57,693,174 (-) NCBI RGSC_v3.4 7 53,591,770 - 54,021,219 (-) RGD Celera 7 46,740,631 - 47,161,218 (-) RGD
Sequence:
CAGAGTACGGGAAGACAGTTTACGTTTTGAATACGTTCTCATGGTAGGGTAGATGGTGCTCCCGAAAATGGACGCCCGGGCCGGACACTTCTTCACTTGTCTTCTCTGGAGGGCAGAGCAATATCGGA
hide sequence
RefSeq Acc Id:
XM_039079684 ⟹ XP_038935612
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 51,829,473 - 52,236,096 (-) NCBI mRatBN7.2 7 49,943,271 - 50,349,819 (-) NCBI
RefSeq Acc Id:
XM_039079685 ⟹ XP_038935613
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 51,970,855 - 52,236,096 (-) NCBI mRatBN7.2 7 50,098,062 - 50,349,819 (-) NCBI
RefSeq Acc Id:
NP_001102461 ⟸ NM_001108991
- UniProtKB:
Q10836 (UniProtKB/Swiss-Prot), G3V6Q2 (UniProtKB/Swiss-Prot), A0A8I5ZM45 (UniProtKB/TrEMBL), A6IGK0 (UniProtKB/TrEMBL)
- Sequence:
MALDGERGEQEEEKKKKKKKKKRKKKEEEGAEKSSSPFAATMGEDDAALRASGRGLSDPWADSVGVRPRTTERHIAVHKRLVLAFAVSIVALLAVTMLAVLLSLRFDECGASAAMPGTDGGLGGFPER
hide sequence
Ensembl Acc Id:
ENSRNOP00000007461 ⟸ ENSRNOT00000007461
RefSeq Acc Id:
XP_038935612 ⟸ XM_039079684
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZM45 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038935613 ⟸ XM_039079685
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSRNOP00000079029 ⟸ ENSRNOT00000109488
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Trhde
thyrotropin-releasing hormone degrading enzyme
Symbol and Name status set to approved
1299863 APPROVED
2005-09-30
Trhde
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
expressed in the brain, liver and serum
625628
gene_function
catalyzes the hydrolysis of hyrotropin-releasing hormone (TRH) at the pyroGlu-His bond
625628
gene_protein
97 kDa
625628
