Symbol:
Tcf4
Name:
transcription factor 4
RGD ID:
69271
Description:
Enables bHLH transcription factor binding activity and double-stranded DNA binding activity. Involved in positive regulation of transcription by RNA polymerase II. Predicted to be located in nucleus. Predicted to be part of beta-catenin-TCF7L2 complex. Predicted to be active in chromatin. Human ortholog(s) of this gene implicated in Fuchs' endothelial dystrophy; Lynch syndrome; and Pitt-Hopkins syndrome. Orthologous to human TCF4 (transcription factor 4); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
immunoglobulin transcription factor 2; ITF-2; R8f DNA-binding protein; RITF-2; SEF-2; SL3-3 enhancer factor 2; TCF-4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TCF4 (transcription factor 4) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):
Tcf4 (transcription factor 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tcf4 (transcription factor 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TCF4 (transcription factor 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TCF4 (transcription factor 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tcf4 (transcription factor 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TCF4 (transcription factor 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TCF4 (transcription factor 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tcf4 (transcription factor 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
RPGRIP1 (RPGR interacting protein 1) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
TCF4 (transcription factor 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tcf4 (transcription factor 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
hlh-2
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
da
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
tcf4
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 65,216,840 - 65,563,186 (+) NCBI GRCr8 mRatBN7.2 18 62,941,739 - 63,288,126 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 62,943,782 - 63,284,425 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 65,021,713 - 65,360,258 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 65,713,660 - 66,051,972 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 63,570,321 - 63,908,645 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 65,285,320 - 65,507,983 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 65,155,685 - 65,507,977 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 64,471,373 - 64,694,036 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 66,135,863 - 66,359,984 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 66,209,063 - 66,433,179 (+) NCBI Celera 18 61,145,273 - 61,368,542 (+) NCBI Celera Cytogenetic Map 18 q12.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tcf4 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO TCF4 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of TCF4 mRNA CTD PMID:22079256 Tcf4 Rat 1,2-dichloroethane increases expression ISO Tcf4 (Mus musculus) 6480464 ethylene dichloride results in increased expression of TCF4 mRNA CTD PMID:28960355 Tcf4 Rat 1,2-dimethylhydrazine increases expression ISO Tcf4 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of TCF4 mRNA CTD PMID:22206623 Tcf4 Rat 17alpha-ethynylestradiol affects expression ISO Tcf4 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of TCF4 mRNA CTD PMID:17555576 Tcf4 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of TCF4 mRNA CTD PMID:17557909 Tcf4 Rat 17alpha-ethynylestradiol increases expression ISO Tcf4 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of TCF4 mRNA CTD PMID:17942748 Tcf4 Rat 17beta-estradiol multiple interactions ISO TCF4 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of TCF4 mRNA and [Progesterone co-treated with Estradiol] results in decreased expression of TCF4 mRNA CTD PMID:17404688 and PMID:30165855 Tcf4 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of TCF4 mRNA CTD PMID:20068009 Tcf4 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO TCF4 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of TCF4 mRNA CTD PMID:29581250 Tcf4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tcf4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TCF4 mRNA CTD PMID:16611356 more ... Tcf4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TCF4 mRNA CTD PMID:33387578 Tcf4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of TCF4 mRNA CTD PMID:34747641 Tcf4 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TCF4 mRNA CTD PMID:32109520 Tcf4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Tcf4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of TCF4 mRNA CTD PMID:15328365 more ... Tcf4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Tcf4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of TCF4 mRNA and [Tetrachlorodibenzodioxin co-treated with Lipopolysaccharides] results in decreased methylation of TCF4 gene CTD PMID:16214954 and PMID:21212295 Tcf4 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Tcf4 Rat 2-butoxyethanol decreases expression ISO Tcf4 (Mus musculus) 6480464 n-butoxyethanol results in decreased expression of TCF4 mRNA CTD PMID:19812364 Tcf4 Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of TCF4 mRNA CTD PMID:30071829 Tcf4 Rat 3-Nitrobenzanthrone decreases expression ISO TCF4 (Homo sapiens) 6480464 3-nitrobenzanthrone results in decreased expression of TCF4 mRNA CTD PMID:34036453 Tcf4 Rat 4,4'-sulfonyldiphenol increases methylation ISO TCF4 (Homo sapiens) 6480464 bisphenol S results in increased methylation of TCF4 gene CTD PMID:31601247 Tcf4 Rat 4,4'-sulfonyldiphenol increases expression ISO TCF4 (Homo sapiens) 6480464 bisphenol S results in increased expression of TCF4 mRNA CTD PMID:34979203 Tcf4 Rat 4-hydroxyphenyl retinamide increases expression ISO Tcf4 (Mus musculus) 6480464 Fenretinide results in increased expression of TCF4 mRNA CTD PMID:28973697 Tcf4 Rat 4-tert-Octylphenol increases expression EXP 6480464 4-tert-octylphenol results in increased expression of TCF4 mRNA CTD PMID:17011747 Tcf4 Rat 5-aza-2'-deoxycytidine affects expression ISO TCF4 (Homo sapiens) 6480464 Decitabine affects the expression of TCF4 mRNA CTD PMID:23300844 Tcf4 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of TCF4 mRNA CTD PMID:31881176 Tcf4 Rat acetylsalicylic acid multiple interactions ISO TCF4 (Homo sapiens) 6480464 TCF4 protein promotes the reaction [Aspirin results in increased susceptibility to TNFSF10 protein] CTD PMID:21171083 Tcf4 Rat acetylsalicylic acid decreases activity ISO TCF4 (Homo sapiens) 6480464 Aspirin results in decreased activity of TCF4 protein CTD PMID:11593435 Tcf4 Rat acrolein multiple interactions ISO TCF4 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] affects the expression of TCF4 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which affects the expression of TCF4 mRNA CTD PMID:32699268 Tcf4 Rat actinomycin D multiple interactions EXP 6480464 Dactinomycin inhibits the reaction [Cadmium Chloride results in increased expression of TCF4 mRNA] CTD PMID:20459685 Tcf4 Rat aflatoxin B1 decreases expression ISO Tcf4 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of TCF4 mRNA CTD PMID:19770486 Tcf4 Rat aflatoxin B1 decreases methylation ISO TCF4 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of TCF4 intron CTD PMID:30157460 Tcf4 Rat all-trans-retinoic acid decreases expression ISO TCF4 (Homo sapiens) 6480464 Tretinoin results in decreased expression of TCF4 mRNA CTD PMID:21934132 and PMID:33167477 Tcf4 Rat alpha-pinene multiple interactions ISO TCF4 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] affects the expression of TCF4 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which affects the expression of TCF4 mRNA CTD PMID:32699268 Tcf4 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TCF4 mRNA CTD PMID:16483693 Tcf4 Rat antimycin A decreases expression ISO TCF4 (Homo sapiens) 6480464 Antimycin A results in decreased expression of TCF4 mRNA CTD PMID:33512557 Tcf4 Rat aristolochic acid A decreases expression ISO TCF4 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of TCF4 mRNA CTD PMID:33212167 Tcf4 Rat arsane multiple interactions ISO TCF4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of TCF4 mRNA CTD PMID:39836092 Tcf4 Rat arsenic atom multiple interactions ISO TCF4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of TCF4 mRNA CTD PMID:39836092 Tcf4 Rat arsenous acid increases expression ISO TCF4 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of TCF4 mRNA CTD PMID:15761015 Tcf4 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of TCF4 gene CTD PMID:28931070 Tcf4 Rat benzo[a]pyrene decreases expression ISO TCF4 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of TCF4 mRNA CTD PMID:20064835 Tcf4 Rat benzo[a]pyrene affects methylation ISO TCF4 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of TCF4 intron CTD PMID:30157460 Tcf4 Rat benzo[a]pyrene increases methylation ISO Tcf4 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of TCF4 intron CTD PMID:27901495 Tcf4 Rat benzo[a]pyrene decreases methylation ISO TCF4 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of TCF4 5' UTR more ... CTD PMID:27901495 Tcf4 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of TCF4 mRNA CTD PMID:21839799 Tcf4 Rat benzo[a]pyrene decreases expression ISO Tcf4 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of TCF4 mRNA CTD PMID:19770486 and PMID:21715664 Tcf4 Rat benzo[e]pyrene decreases methylation ISO TCF4 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of TCF4 intron CTD PMID:30157460 Tcf4 Rat Benzo[k]fluoranthene increases expression ISO Tcf4 (Mus musculus) 6480464 benzo(k)fluoranthene results in increased expression of TCF4 mRNA CTD PMID:26377693 Tcf4 Rat bilirubin IXalpha decreases expression ISO TCF4 (Homo sapiens) 6480464 Bilirubin results in decreased expression of TCF4 mRNA CTD PMID:20196124 Tcf4 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Tcf4 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased methylation of and results in decreased expression of TCF4 mRNA CTD PMID:34120004 Tcf4 Rat bisphenol A increases expression ISO Tcf4 (Mus musculus) 6480464 bisphenol A results in increased expression of TCF4 mRNA CTD PMID:26063408 Tcf4 Rat bisphenol A multiple interactions ISO TCF4 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of TCF4 gene CTD PMID:31601247 Tcf4 Rat bisphenol A decreases methylation ISO TCF4 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of TCF4 gene CTD PMID:31601247 Tcf4 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of TCF4 gene CTD PMID:28505145 Tcf4 Rat bisphenol A affects methylation ISO Tcf4 (Mus musculus) 6480464 bisphenol A affects the methylation of TCF4 promoter CTD PMID:27334623 Tcf4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TCF4 mRNA CTD PMID:25181051 Tcf4 Rat bisphenol F multiple interactions ISO TCF4 (Homo sapiens) 6480464 [bisphenol F co-treated with Fulvestrant] results in decreased methylation of TCF4 gene CTD PMID:31601247 Tcf4 Rat bortezomib increases expression ISO TCF4 (Homo sapiens) 6480464 Bortezomib results in increased expression of TCF4 mRNA CTD PMID:17895889 Tcf4 Rat bosutinib multiple interactions ISO TCF4 (Homo sapiens) 6480464 bosutinib inhibits the reaction [CTNNB1 protein binds to TCF4 protein] CTD PMID:16489032 Tcf4 Rat Butylbenzyl phthalate multiple interactions ISO TCF4 (Homo sapiens) 6480464 butylbenzyl phthalate promotes the reaction [[TCF4 protein binds to LEF1 protein] which binds to VIM protein] more ... CTD PMID:22552774 Tcf4 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of TCF4 mRNA CTD PMID:19167457 Tcf4 Rat cadmium atom multiple interactions ISO TCF4 (Homo sapiens) 6480464 [Cadmium affects the localization of CTNNB1 protein] promotes the reaction [CTNNB1 protein binds to TCF4 protein] CTD PMID:24798214 Tcf4 Rat cadmium dichloride multiple interactions EXP 6480464 Cadmium Chloride promotes the reaction [DDIT3 protein binds to TCF4 protein] more ... CTD PMID:20459685 Tcf4 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of TCF4 mRNA and Cadmium Chloride results in increased expression of TCF4 protein CTD PMID:20459685 and PMID:33453195 Tcf4 Rat cadmium dichloride affects localization EXP 6480464 Cadmium Chloride affects the localization of TCF4 protein CTD PMID:20459685 Tcf4 Rat carbon nanotube decreases expression ISO Tcf4 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Tcf4 Rat CGP 52608 multiple interactions ISO TCF4 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TCF4 gene] CTD PMID:28238834 Tcf4 Rat chloroprene increases expression EXP 6480464 Chloroprene results in increased expression of TCF4 mRNA CTD PMID:23125180 Tcf4 Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of TCF4 mRNA CTD PMID:18668222 Tcf4 Rat chlorpyrifos decreases expression ISO Tcf4 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of TCF4 mRNA CTD PMID:32715474 Tcf4 Rat chromium(6+) multiple interactions ISO TCF4 (Homo sapiens) 6480464 chromium hexavalent ion promotes the reaction [[CTNNB1 protein co-treated with TCF4 protein] binds to MYC promoter] and chromium hexavalent ion promotes the reaction [[CTNNB1 protein co-treated with TCF4 protein] binds to PLAUR promoter] CTD PMID:27323401 Tcf4 Rat chromium(6+) increases expression ISO TCF4 (Homo sapiens) 6480464 chromium hexavalent ion results in increased expression of TCF4 protein CTD PMID:27323401 Tcf4 Rat cisplatin affects expression ISO TCF4 (Homo sapiens) 6480464 Cisplatin affects the expression of TCF4 mRNA CTD PMID:23300844 Tcf4 Rat cisplatin decreases expression ISO TCF4 (Homo sapiens) 6480464 Cisplatin results in decreased expression of TCF4 mRNA CTD PMID:27392435 and PMID:27594783 Tcf4 Rat cisplatin multiple interactions ISO TCF4 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of TCF4 mRNA CTD PMID:27392435 Tcf4 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of TCF4 mRNA CTD PMID:24386269 Tcf4 Rat cobalt dichloride decreases expression ISO TCF4 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of TCF4 mRNA CTD PMID:19320972 Tcf4 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of TCF4 mRNA CTD PMID:20187946 Tcf4 Rat copper atom multiple interactions ISO TCF4 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of TCF4 mRNA CTD PMID:20971185 Tcf4 Rat copper atom multiple interactions ISO Tcf4 (Mus musculus) 6480464 MT1 affects the reaction [Copper results in increased expression of TCF4 mRNA] and MT2 affects the reaction [Copper results in increased expression of TCF4 mRNA] CTD PMID:16629173 Tcf4 Rat copper(0) multiple interactions ISO TCF4 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of TCF4 mRNA CTD PMID:20971185 Tcf4 Rat copper(0) multiple interactions ISO Tcf4 (Mus musculus) 6480464 MT1 affects the reaction [Copper results in increased expression of TCF4 mRNA] and MT2 affects the reaction [Copper results in increased expression of TCF4 mRNA] CTD PMID:16629173 Tcf4 Rat copper(II) chloride multiple interactions ISO TCF4 (Homo sapiens) 6480464 2-amino-4-(3 more ... CTD PMID:39306268 Tcf4 Rat crocidolite asbestos affects methylation ISO TCF4 (Homo sapiens) 6480464 Asbestos more ... CTD PMID:29523930 Tcf4 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of TCF4 mRNA CTD PMID:26577399 Tcf4 Rat cyclosporin A decreases expression ISO TCF4 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of TCF4 mRNA CTD PMID:20106945 Tcf4 Rat deguelin increases expression ISO TCF4 (Homo sapiens) 6480464 deguelin results in increased expression of TCF4 mRNA CTD PMID:19861542 Tcf4 Rat deguelin decreases expression ISO TCF4 (Homo sapiens) 6480464 deguelin results in decreased expression of TCF4 mRNA CTD PMID:33512557 Tcf4 Rat Destruxin B decreases expression ISO TCF4 (Homo sapiens) 6480464 destruxin B results in decreased expression of TCF4 protein CTD PMID:24434019 Tcf4 Rat Destruxin B multiple interactions ISO TCF4 (Homo sapiens) 6480464 destruxin B affects the localization of and results in decreased expression of TCF4 protein and destruxin B results in decreased activity of [TCF4 protein co-treated with CTNNB1 protein] CTD PMID:22465936 Tcf4 Rat diarsenic trioxide increases expression ISO TCF4 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of TCF4 mRNA CTD PMID:15761015 Tcf4 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of TCF4 mRNA CTD PMID:21266533 Tcf4 Rat dibutyl phthalate multiple interactions ISO TCF4 (Homo sapiens) 6480464 Dibutyl Phthalate promotes the reaction [[TCF4 protein binds to LEF1 protein] which binds to VIM protein] more ... CTD PMID:22552774 Tcf4 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of TCF4 mRNA CTD PMID:17011747 Tcf4 Rat dioxygen decreases expression ISO Tcf4 (Mus musculus) 6480464 Oxygen deficiency results in decreased expression of TCF4 mRNA CTD PMID:22629407 Tcf4 Rat dioxygen multiple interactions ISO Tcf4 (Mus musculus) 6480464 Oxygen promotes the reaction [Oxygen deficiency results in decreased expression of TCF4 mRNA] CTD PMID:22629407 Tcf4 Rat diuron decreases expression ISO TCF4 (Homo sapiens) 6480464 Diuron results in decreased expression of TCF4 mRNA CTD PMID:35967413 Tcf4 Rat dorsomorphin multiple interactions ISO TCF4 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of TCF4 mRNA CTD PMID:27188386 Tcf4 Rat elesclomol multiple interactions ISO TCF4 (Homo sapiens) 6480464 2-amino-4-(3 more ... CTD PMID:39306268 Tcf4 Rat ethanol multiple interactions ISO Tcf4 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of TCF4 mRNA CTD PMID:30319688 Tcf4 Rat ethyl methanesulfonate decreases expression ISO TCF4 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of TCF4 mRNA CTD PMID:23649840 Tcf4 Rat fenpyroximate decreases expression ISO TCF4 (Homo sapiens) 6480464 fenpyroximate results in decreased expression of TCF4 mRNA CTD PMID:33512557 Tcf4 Rat fenthion increases expression ISO Tcf4 (Mus musculus) 6480464 Fenthion results in increased expression of TCF4 mRNA CTD PMID:34813904 Tcf4 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of TCF4 mRNA CTD PMID:18035473 Tcf4 Rat folic acid decreases expression ISO Tcf4 (Mus musculus) 6480464 Folic Acid results in decreased expression of TCF4 mRNA CTD PMID:25629700 Tcf4 Rat folpet decreases expression ISO Tcf4 (Mus musculus) 6480464 folpet results in decreased expression of TCF4 mRNA CTD PMID:31558096 Tcf4 Rat fulvestrant multiple interactions ISO TCF4 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of TCF4 gene and [bisphenol F co-treated with Fulvestrant] results in decreased methylation of TCF4 gene CTD PMID:31601247 Tcf4 Rat fulvestrant increases methylation ISO TCF4 (Homo sapiens) 6480464 Fulvestrant results in increased methylation of TCF4 gene CTD PMID:31601247 Tcf4 Rat genistein decreases expression ISO TCF4 (Homo sapiens) 6480464 Genistein results in decreased expression of TCF4 mRNA CTD PMID:15256057 Tcf4 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of TCF4 mRNA CTD PMID:22061828 Tcf4 Rat geraniol decreases expression ISO TCF4 (Homo sapiens) 6480464 geraniol results in decreased expression of TCF4 mRNA CTD PMID:27683099 Tcf4 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of TCF4 mRNA CTD PMID:33150645 Tcf4 Rat glycidol increases methylation EXP 6480464 glycidol results in increased methylation of TCF4 promoter CTD PMID:33150595 Tcf4 Rat glyphosate increases methylation EXP 6480464 Glyphosate results in increased methylation of TCF4 gene CTD PMID:31011160 Tcf4 Rat hydroquinone decreases expression ISO TCF4 (Homo sapiens) 6480464 hydroquinone results in decreased expression of TCF4 mRNA CTD PMID:31256213 Tcf4 Rat ketoconazole decreases expression EXP 6480464 Ketoconazole results in decreased expression of TCF4 mRNA CTD PMID:37077353 Tcf4 Rat lead(0) decreases expression ISO TCF4 (Homo sapiens) 6480464 Lead results in decreased expression of TCF4 mRNA CTD PMID:37386098 Tcf4 Rat lipopolysaccharide multiple interactions ISO Tcf4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Lipopolysaccharides] results in decreased methylation of TCF4 gene CTD PMID:21212295 Tcf4 Rat lithium chloride multiple interactions ISO TCF4 (Homo sapiens) 6480464 Lithium Chloride results in increased activity of [TCF4 protein co-treated with CTNNB1 protein] and Resveratrol inhibits the reaction [Lithium Chloride results in increased activity of [TCF4 protein co-treated with CTNNB1 protein]] CTD PMID:22935447 Tcf4 Rat manganese atom multiple interactions ISO TCF4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of TCF4 mRNA CTD PMID:39836092 Tcf4 Rat manganese(0) multiple interactions ISO TCF4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of TCF4 mRNA CTD PMID:39836092 Tcf4 Rat manganese(II) chloride multiple interactions ISO TCF4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of TCF4 mRNA CTD PMID:39836092 Tcf4 Rat methamphetamine increases expression ISO Tcf4 (Mus musculus) 6480464 Methamphetamine results in increased expression of TCF4 mRNA CTD PMID:26307267 Tcf4 Rat methapyrilene decreases methylation ISO TCF4 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of TCF4 intron CTD PMID:30157460 Tcf4 Rat methidathion affects expression ISO Tcf4 (Mus musculus) 6480464 methidathion affects the expression of TCF4 mRNA CTD PMID:34813904 Tcf4 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of TCF4 gene CTD PMID:35440735 Tcf4 Rat methyl methanesulfonate decreases expression ISO TCF4 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of TCF4 mRNA CTD PMID:23649840 Tcf4 Rat methylmercury chloride decreases expression ISO TCF4 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of TCF4 mRNA CTD PMID:28001369 Tcf4 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of TCF4 gene CTD PMID:33148267 Tcf4 Rat N-tosyl-L-phenylalanyl chloromethyl ketone multiple interactions ISO TCF4 (Homo sapiens) 6480464 Tosylphenylalanyl Chloromethyl Ketone inhibits the reaction [Nitroglycerin inhibits the reaction [CTNNB1 protein binds to TCF4 protein]] CTD PMID:17030184 Tcf4 Rat nickel sulfate decreases expression ISO TCF4 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of TCF4 mRNA CTD PMID:16780908 Tcf4 Rat nickel sulfate increases expression ISO TCF4 (Homo sapiens) 6480464 nickel sulfate results in increased expression of TCF4 mRNA CTD PMID:22714537 Tcf4 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of TCF4 mRNA and nitrofen results in decreased expression of TCF4 protein CTD PMID:27665494 Tcf4 Rat nitroglycerin multiple interactions ISO TCF4 (Homo sapiens) 6480464 Nitroglycerin inhibits the reaction [CTNNB1 protein binds to TCF4 protein] and Tosylphenylalanyl Chloromethyl Ketone inhibits the reaction [Nitroglycerin inhibits the reaction [CTNNB1 protein binds to TCF4 protein]] CTD PMID:17030184 Tcf4 Rat okadaic acid multiple interactions ISO TCF4 (Homo sapiens) 6480464 Okadaic Acid promotes the reaction [CTNNB1 protein binds to TCF4 protein] CTD PMID:31115591 Tcf4 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of TCF4 mRNA CTD PMID:25729387 Tcf4 Rat ozone multiple interactions ISO TCF4 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] affects the expression of TCF4 mRNA more ... CTD PMID:32699268 Tcf4 Rat ozone multiple interactions ISO Tcf4 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of TCF4 mRNA CTD PMID:34911549 Tcf4 Rat p-tert-Amylphenol increases expression EXP 6480464 4-tert-octylphenol results in increased expression of TCF4 mRNA CTD PMID:17011747 Tcf4 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of TCF4 mRNA CTD PMID:33387578 Tcf4 Rat paraquat decreases expression ISO TCF4 (Homo sapiens) 6480464 Paraquat results in decreased expression of TCF4 mRNA CTD PMID:35182771 Tcf4 Rat perfluorooctane-1-sulfonic acid affects expression ISO Tcf4 (Mus musculus) 6480464 perfluorooctane sulfonic acid affects the expression of TCF4 mRNA CTD PMID:19429403 Tcf4 Rat perfluorooctanoic acid affects expression ISO Tcf4 (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of TCF4 mRNA CTD PMID:19429403 Tcf4 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of TCF4 gene CTD PMID:33148267 Tcf4 Rat phenobarbital affects methylation ISO Tcf4 (Mus musculus) 6480464 Phenobarbital affects the methylation of TCF4 gene CTD PMID:19233941 Tcf4 Rat phenobarbital affects expression ISO TCF4 (Homo sapiens) 6480464 Phenobarbital affects the expression of TCF4 mRNA CTD PMID:19159669 Tcf4 Rat picoxystrobin decreases expression ISO TCF4 (Homo sapiens) 6480464 picoxystrobin results in decreased expression of TCF4 mRNA CTD PMID:33512557 Tcf4 Rat potassium chromate decreases expression ISO TCF4 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of TCF4 mRNA CTD PMID:22079256 Tcf4 Rat potassium chromate multiple interactions ISO TCF4 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of TCF4 mRNA CTD PMID:22079256 Tcf4 Rat progesterone multiple interactions ISO TCF4 (Homo sapiens) 6480464 [Progesterone co-treated with Estradiol] results in decreased expression of TCF4 mRNA CTD PMID:17404688 Tcf4 Rat pyrimidifen decreases expression ISO TCF4 (Homo sapiens) 6480464 pyrimidifen results in decreased expression of TCF4 mRNA CTD PMID:33512557 Tcf4 Rat quercetin multiple interactions ISO TCF4 (Homo sapiens) 6480464 Quercetin inhibits the reaction [CTNNB1 protein binds to TCF4 protein] CTD PMID:15670774 Tcf4 Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [[Warfarin co-treated with Vitamin K] results in increased expression of TCF4 mRNA] and Quercetin inhibits the reaction [Warfarin results in increased expression of TCF4 mRNA] CTD PMID:23117658 Tcf4 Rat quercetin affects expression ISO TCF4 (Homo sapiens) 6480464 Quercetin affects the expression of TCF4 protein CTD PMID:15670774 Tcf4 Rat resveratrol multiple interactions ISO TCF4 (Homo sapiens) 6480464 resveratrol inhibits the reaction [Lithium Chloride results in increased activity of [TCF4 protein co-treated with CTNNB1 protein]] more ... CTD PMID:22935447 Tcf4 Rat resveratrol multiple interactions ISO Tcf4 (Mus musculus) 6480464 resveratrol inhibits the reaction [TCF4 protein binds to CTNNB1 protein] and resveratrol inhibits the reaction [WNT3A protein promotes the reaction [TCF4 protein binds to CTNNB1 protein]] CTD PMID:22935447 Tcf4 Rat rotenone decreases expression ISO TCF4 (Homo sapiens) 6480464 Rotenone results in decreased expression of TCF4 mRNA CTD PMID:33512557 Tcf4 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO TCF4 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of TCF4 mRNA CTD PMID:33725128 Tcf4 Rat SB 431542 multiple interactions ISO TCF4 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of TCF4 mRNA CTD PMID:27188386 Tcf4 Rat silicon dioxide decreases expression ISO Tcf4 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of TCF4 mRNA CTD PMID:19073995 Tcf4 Rat sodium arsenate increases expression ISO Tcf4 (Mus musculus) 6480464 sodium arsenate results in increased expression of TCF4 mRNA CTD PMID:21795629 Tcf4 Rat sodium arsenite increases expression ISO TCF4 (Homo sapiens) 6480464 sodium arsenite results in increased expression of TCF4 mRNA CTD PMID:22714537 Tcf4 Rat sodium arsenite multiple interactions ISO TCF4 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of TCF4 mRNA CTD PMID:39836092 Tcf4 Rat sodium arsenite decreases expression ISO TCF4 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TCF4 mRNA CTD PMID:38568856 Tcf4 Rat sodium arsenite affects methylation ISO TCF4 (Homo sapiens) 6480464 sodium arsenite affects the methylation of TCF4 gene CTD PMID:28589171 Tcf4 Rat succimer multiple interactions ISO Tcf4 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of TCF4 mRNA CTD PMID:21641980 Tcf4 Rat sulindac decreases activity ISO TCF4 (Homo sapiens) 6480464 Sulindac results in decreased activity of TCF4 protein CTD PMID:11593435 Tcf4 Rat sulindac multiple interactions ISO TCF4 (Homo sapiens) 6480464 TCF4 protein promotes the reaction [Sulindac results in increased susceptibility to TNFSF10 protein] CTD PMID:21171083 Tcf4 Rat tamoxifen affects expression ISO Tcf4 (Mus musculus) 6480464 Tamoxifen affects the expression of TCF4 mRNA CTD PMID:17555576 Tcf4 Rat tebufenpyrad decreases expression ISO TCF4 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of TCF4 mRNA CTD PMID:33512557 Tcf4 Rat tert-butyl hydroperoxide decreases expression ISO TCF4 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of TCF4 mRNA CTD PMID:15336504 Tcf4 Rat testosterone enanthate increases expression ISO TCF4 (Homo sapiens) 6480464 testosterone enanthate results in increased expression of TCF4 mRNA CTD PMID:17440010 Tcf4 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of TCF4 mRNA CTD PMID:16239168 Tcf4 Rat thifluzamide decreases expression ISO TCF4 (Homo sapiens) 6480464 thifluzamide results in decreased expression of TCF4 mRNA CTD PMID:33512557 Tcf4 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of TCF4 mRNA CTD PMID:25729387 Tcf4 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of TCF4 mRNA CTD PMID:25729387 Tcf4 Rat torcetrapib increases expression ISO TCF4 (Homo sapiens) 6480464 torcetrapib results in increased expression of TCF4 mRNA CTD PMID:23228038 Tcf4 Rat trichostatin A multiple interactions ISO TCF4 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:22552774 and PMID:27188386 Tcf4 Rat trichostatin A decreases expression ISO TCF4 (Homo sapiens) 6480464 trichostatin A results in decreased expression of TCF4 mRNA CTD PMID:26272509 Tcf4 Rat triphenyl phosphate affects expression ISO TCF4 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TCF4 mRNA CTD PMID:37042841 Tcf4 Rat triptonide decreases expression ISO Tcf4 (Mus musculus) 6480464 triptonide results in decreased expression of TCF4 mRNA CTD PMID:33045310 Tcf4 Rat troglitazone decreases expression ISO Tcf4 (Mus musculus) 6480464 troglitazone results in decreased expression of TCF4 mRNA CTD PMID:28973697 Tcf4 Rat tungsten decreases expression ISO Tcf4 (Mus musculus) 6480464 Tungsten results in decreased expression of TCF4 mRNA CTD PMID:30912803 Tcf4 Rat tunicamycin decreases expression ISO TCF4 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of TCF4 mRNA CTD PMID:22378314 Tcf4 Rat undecane increases expression EXP 6480464 undecane results in increased expression of TCF4 protein CTD PMID:17337753 Tcf4 Rat valproic acid decreases expression ISO TCF4 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of TCF4 mRNA CTD PMID:23179753 more ... Tcf4 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of TCF4 mRNA CTD PMID:29427782 Tcf4 Rat valproic acid decreases methylation ISO TCF4 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of TCF4 gene CTD PMID:28853863 and PMID:29201983 Tcf4 Rat venlafaxine hydrochloride increases expression EXP 6480464 Venlafaxine Hydrochloride results in increased expression of TCF4 mRNA CTD PMID:25423262 Tcf4 Rat vitamin K multiple interactions EXP 6480464 [Warfarin co-treated with Vitamin K] results in increased expression of TCF4 mRNA and Quercetin inhibits the reaction [[Warfarin co-treated with Vitamin K] results in increased expression of TCF4 mRNA] CTD PMID:23117658 Tcf4 Rat warfarin increases expression EXP 6480464 Warfarin results in increased expression of TCF4 mRNA CTD PMID:23117658 Tcf4 Rat warfarin multiple interactions EXP 6480464 [Warfarin co-treated with Vitamin K] results in increased expression of TCF4 mRNA more ... CTD PMID:23117658 Tcf4 Rat zinc atom increases expression ISO TCF4 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of TCF4 mRNA CTD PMID:22171008 Tcf4 Rat zinc(0) increases expression ISO TCF4 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of TCF4 mRNA CTD PMID:22171008
(-)-epigallocatechin 3-gallate (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-butoxyethanol (ISO) 3,4-methylenedioxymethamphetamine (EXP) 3-Nitrobenzanthrone (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 4-tert-Octylphenol (EXP) 5-aza-2'-deoxycytidine (ISO) acetamide (EXP) acetylsalicylic acid (ISO) acrolein (ISO) actinomycin D (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) ammonium chloride (EXP) antimycin A (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atrazine (EXP) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (ISO) Benzo[k]fluoranthene (ISO) bilirubin IXalpha (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bortezomib (ISO) bosutinib (ISO) Butylbenzyl phthalate (ISO) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (EXP) carbon nanotube (ISO) CGP 52608 (ISO) chloroprene (EXP) chlorpyrifos (EXP,ISO) chromium(6+) (ISO) cisplatin (ISO) cobalt dichloride (EXP,ISO) cocaine (EXP) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) cyclosporin A (ISO) deguelin (ISO) Destruxin B (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP,ISO) diethylstilbestrol (EXP) dioxygen (ISO) diuron (ISO) dorsomorphin (ISO) elesclomol (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) fenpyroximate (ISO) fenthion (ISO) flavonoids (EXP) folic acid (ISO) folpet (ISO) fulvestrant (ISO) genistein (ISO) gentamycin (EXP) geraniol (ISO) glycidol (EXP) glyphosate (EXP) hydroquinone (ISO) ketoconazole (EXP) lead(0) (ISO) lipopolysaccharide (ISO) lithium chloride (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methamphetamine (ISO) methapyrilene (ISO) methidathion (ISO) methoxychlor (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) N,N-diethyl-m-toluamide (EXP) N-tosyl-L-phenylalanyl chloromethyl ketone (ISO) nickel sulfate (ISO) nitrofen (EXP) nitroglycerin (ISO) okadaic acid (ISO) oxaliplatin (EXP) ozone (ISO) p-tert-Amylphenol (EXP) paracetamol (EXP) paraquat (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) permethrin (EXP) phenobarbital (ISO) picoxystrobin (ISO) potassium chromate (ISO) progesterone (ISO) pyrimidifen (ISO) quercetin (EXP,ISO) resveratrol (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) succimer (ISO) sulindac (ISO) tamoxifen (ISO) tebufenpyrad (ISO) tert-butyl hydroperoxide (ISO) testosterone enanthate (ISO) tetrachloromethane (EXP) thifluzamide (ISO) topotecan (EXP) torcetrapib (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (ISO) tungsten (ISO) tunicamycin (ISO) undecane (EXP) valproic acid (EXP,ISO) venlafaxine hydrochloride (EXP) vitamin K (EXP) warfarin (EXP) zinc atom (ISO) zinc(0) (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Frameshift mutational target gene analysis identifies similarities and differences in constitutional mismatch repair-deficiency and Lynch syndrome.
Maletzki C, etal., Mol Carcinog. 2017 Jul;56(7):1753-1764. doi: 10.1002/mc.22632. Epub 2017 Mar 30.
4.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
5.
Role of the basic helix-loop-helix transcription factor, scleraxis, in the regulation of Sertoli cell function and differentiation.
Muir T, etal., Mol Endocrinol. 2005 Aug;19(8):2164-74. Epub 2005 Apr 14.
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
8.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
11.
Isolation of two E-box binding factors that interact with the rat tyrosine hydroxylase enhancer.
Yoon SO and Chikaraishi DM, J Biol Chem 1994 Jul 15;269(28):18453-62.
Tcf4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 65,216,840 - 65,563,186 (+) NCBI GRCr8 mRatBN7.2 18 62,941,739 - 63,288,126 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 62,943,782 - 63,284,425 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 65,021,713 - 65,360,258 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 65,713,660 - 66,051,972 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 63,570,321 - 63,908,645 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 65,285,320 - 65,507,983 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 65,155,685 - 65,507,977 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 64,471,373 - 64,694,036 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 66,135,863 - 66,359,984 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 66,209,063 - 66,433,179 (+) NCBI Celera 18 61,145,273 - 61,368,542 (+) NCBI Celera Cytogenetic Map 18 q12.1 NCBI
TCF4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 18 55,222,185 - 55,635,957 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 18 55,222,185 - 55,664,787 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 18 52,889,416 - 53,303,188 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 18 51,040,560 - 51,406,858 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 18 51,045,966 - 51,406,441 NCBI Celera 18 49,606,934 - 49,973,119 (-) NCBI Celera Cytogenetic Map 18 q21.2 NCBI HuRef 18 49,599,225 - 50,013,477 (-) NCBI HuRef CHM1_1 18 52,884,825 - 53,298,977 (-) NCBI CHM1_1 T2T-CHM13v2.0 18 55,425,274 - 55,839,077 (-) NCBI T2T-CHM13v2.0
Tcf4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 69,476,500 - 69,821,038 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 69,476,427 - 69,822,150 (+) Ensembl GRCm39 Ensembl GRCm38 18 69,343,429 - 69,687,967 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 69,343,356 - 69,689,079 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 69,504,146 - 69,847,621 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 69,469,890 - 69,809,713 (+) NCBI MGSCv36 mm8 Celera 18 70,630,746 - 70,974,890 (+) NCBI Celera Cytogenetic Map 18 E2 NCBI cM Map 18 43.23 NCBI
Tcf4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955402 39,735,600 - 40,066,151 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955402 39,735,596 - 40,066,151 (-) NCBI ChiLan1.0 ChiLan1.0
TCF4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 17 72,749,860 - 73,162,662 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 18 58,441,348 - 58,855,275 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 18 48,603,069 - 48,969,010 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 18 51,938,357 - 52,351,679 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 18 51,938,357 - 52,352,030 (-) Ensembl panpan1.1 panPan2
TCF4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 20,060,788 - 20,417,367 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 20,060,788 - 20,417,348 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 21,044,957 - 21,401,584 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 19,945,098 - 20,307,635 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 19,945,046 - 20,305,954 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 20,000,058 - 20,356,878 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 19,895,148 - 20,251,707 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 20,166,172 - 20,523,442 (+) NCBI UU_Cfam_GSD_1.0
Tcf4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404944 33,171,849 - 33,525,514 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936497 8,410,860 - 8,764,296 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936497 8,410,882 - 8,765,678 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TCF4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 104,719,151 - 105,079,919 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 104,718,809 - 105,079,919 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 115,117,555 - 115,353,531 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TCF4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 18 24,116,595 - 24,483,037 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 18 24,116,547 - 24,478,228 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666060 1,054,633 - 1,421,014 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tcf4
.
Predicted Target Of
Count of predictions: 33 Count of miRNA genes: 26 Interacting mature miRNAs: 32 Transcripts: ENSRNOT00000020431 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331733 Bp233 Blood pressure QTL 233 3.97196 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 24796977 79788953 Rat 1331741 Bp232 Blood pressure QTL 232 3.59112 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 21372893 83213037 Rat 1298072 Cia26 Collagen induced arthritis QTL 26 3.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 54709769 83828827 Rat 1300125 Rf26 Renal function QTL 26 3.2 urine potassium amount (VT:0010539) urine potassium excretion rate (CMO:0000761) 18 52539863 65844950 Rat 631834 Sach3 Saccharin preference QTL 3 3.9 0.01 consumption behavior trait (VT:0002069) calculated saccharin drink intake volume (CMO:0001600) 18 58805687 63636873 Rat 6893683 Bw110 Body weight QTL 110 2.7 0.002 body mass (VT:0001259) body weight (CMO:0000012) 18 43345022 83828827 Rat 9589041 Epfw12 Epididymal fat weight QTL 12 17.08 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 18 46640675 83828827 Rat 8694432 Bw165 Body weight QTL 165 3.81 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 46640675 83828827 Rat 70185 BpQTLcluster15 Blood pressure QTL cluster 15 4.61 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 18 59712417 76477814 Rat 9589816 Gluco68 Glucose level QTL 68 7.25 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 29792965 74792965 Rat 1331770 Bp234 Blood pressure QTL 234 3.807 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 59796478 71893566 Rat 2300177 Bmd65 Bone mineral density QTL 65 19.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 2301969 Bp324 Blood pressure QTL 324 4.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 59712417 76477814 Rat 1578667 Bss21 Bone structure and strength QTL 21 3.5 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 18 11791518 83218561 Rat 2303120 Mamtr8 Mammary tumor resistance QTL 8 0.001 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 18 31359408 83218561 Rat 12880368 Bw187 Body weight QTL 187 0.045 body mass (VT:0001259) body weight (CMO:0000012) 18 52539763 76104388 Rat 724542 Kidm2 Kidney mass QTL 2 2.6 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 18 59172115 83828827 Rat 61367 Iddm4 Insulin dependent diabetes mellitus QTL 4 2.33 0.0074 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 38192455 83192455 Rat 2293658 Bmd23 Bone mineral density QTL 23 7.3 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 18 51464733 63636873 Rat 1359020 Ppulsi2 Prepulse inhibition QTL 2 2.71 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 18 52292875 73997283 Rat 2312600 Bp341 Blood pressure QTL 341 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 59330409 70263868 Rat 9590318 Scort22 Serum corticosterone level QTL 22 7.64 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 18 29792965 74792965 Rat 1331752 Bw27 Body weight QTL 27 2.963 body mass (VT:0001259) body weight (CMO:0000012) 18 52292875 65845095 Rat 1578661 Bss20 Bone structure and strength QTL 20 3.7 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 18 11791518 83218561 Rat 1331754 Bp230 Blood pressure QTL 230 4.61609 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 29792965 74792965 Rat 12904069 Cm123 Cardiac mass QTL 123 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 18 52539763 76104388 Rat 12904070 Cm124 Cardiac mass QTL 124 0.01 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 18 52539763 76104388 Rat 2303584 Gluco55 Glucose level QTL 55 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 18 48520044 83828827 Rat 12904071 Am18 Aortic mass QTL 18 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 18 52539763 76104388 Rat 12904067 Cm122 Cardiac mass QTL 122 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 18 52539763 76104388 Rat 61384 Bp48 Blood pressure QTL 48 19.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 60622311 77209844 Rat 2301417 Bp319 Blood pressure QTL 319 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 52539763 76104388 Rat 12904073 Kidm71 Kidney mass QTL 71 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 18 52539763 76104388 Rat 6903353 Bp353 Blood pressure QTL 353 2.8 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 59796478 83828827 Rat 738008 Hcar14 Hepatocarcinoma resistance QTL 14 4.3 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion number (CMO:0001462) 18 51464733 83218561 Rat 6903356 Bp354 Blood pressure QTL 354 4.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 59796478 83828827 Rat 631518 Bw11 Body weight QTL 11 2.8 body mass (VT:0001259) body weight (CMO:0000012) 18 35870723 80870723 Rat 8694366 Abfw8 Abdominal fat weight QTL 8 6.38 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 18 46640675 83828827 Rat 631509 Sald2 Serum aldosterone level QTL 2 2.9 blood aldosterone amount (VT:0005346) serum aldosterone level (CMO:0000487) 18 52539763 69140759 Rat 2300157 Bmd66 Bone mineral density QTL 66 13.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 738005 Anxrr11 Anxiety related response QTL 11 3.4 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 18 30039813 75039813 Rat 631274 Sprol1 Serum protein level QTL 1 5.3 blood total protein amount (VT:0005567) serum total protein level (CMO:0000661) 18 31393320 77209694 Rat 1358193 Emca2 Estrogen-induced mammary cancer QTL 2 1.6 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 18 18007599 63571040 Rat 2293704 Bss35 Bone structure and strength QTL 35 4.59 0.0002 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 18 28964853 73964853 Rat 2325839 Bp348 Blood pressure QTL 348 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 25570985 70570985 Rat 1600373 Mamtr6 Mammary tumor resistance QTL 6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 18 19278901 83218561 Rat 2293708 Bss46 Bone structure and strength QTL 46 8.8 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 18 11791518 63636873 Rat 8694378 Bw157 Body weight QTL 157 3.59 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 29792965 74792965 Rat 1600375 Mcs22 Mammary carcinoma susceptibility QTL 22 3.3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 18 52539763 63933058 Rat 2303571 Bw92 Body weight QTL 92 3 body mass (VT:0001259) body weight (CMO:0000012) 18 48520044 83828827 Rat 1598826 Anxrr20 Anxiety related response QTL 20 3.04 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 18 41432971 83828827 Rat 631675 Iddm15 Insulin dependent diabetes mellitus QTL 15 urine glucose amount (VT:0001758) percentage of study population developing diabetes mellitus during a period of time (CMO:0001114) 18 60622311 77209844 Rat 61429 Cia17 Collagen induced arthritis QTL 17 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 31359408 70263868 Rat 7411719 Strs5 Sensitivity to stroke QTL 5 9.4 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 18 49999958 65845095 Rat
D18Rat87
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 18 65,415,948 - 65,416,174 (+) Marker Load Pipeline mRatBN7.2 18 63,140,870 - 63,141,096 (+) MAPPER mRatBN7.2 Rnor_6.0 18 65,366,908 - 65,367,133 NCBI Rnor6.0 Rnor_5.0 18 64,552,961 - 64,553,186 UniSTS Rnor5.0 RGSC_v3.4 18 66,217,583 - 66,217,809 RGD RGSC3.4 RGSC_v3.4 18 66,217,584 - 66,217,809 UniSTS RGSC3.4 RGSC_v3.1 18 66,290,766 - 66,291,155 RGD Celera 18 61,226,357 - 61,226,604 UniSTS SHRSP x BN Map 18 37.6799 UniSTS SHRSP x BN Map 18 37.6799 RGD Cytogenetic Map 18 q12.1 UniSTS
D18Arb7
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 18 65,470,666 - 65,470,833 (+) Marker Load Pipeline mRatBN7.2 18 63,195,600 - 63,195,769 (+) MAPPER mRatBN7.2 Rnor_6.0 18 65,420,163 - 65,420,329 NCBI Rnor6.0 Rnor_5.0 18 64,606,216 - 64,606,382 UniSTS Rnor5.0 RGSC_v3.4 18 66,272,157 - 66,272,324 RGD RGSC3.4 RGSC_v3.4 18 66,272,158 - 66,272,324 UniSTS RGSC3.4 RGSC_v3.1 18 66,345,358 - 66,345,525 RGD Celera 18 61,280,814 - 61,281,024 UniSTS RH 3.4 Map 18 662.0 UniSTS RH 3.4 Map 18 662.0 RGD RH 2.0 Map 18 259.9 RGD SHRSP x BN Map 18 37.6799 RGD FHH x ACI Map 18 43.06 RGD Cytogenetic Map 18 q12.1 UniSTS
BE108561
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 63,196,366 - 63,196,526 (+) MAPPER mRatBN7.2 Rnor_6.0 18 65,420,927 - 65,421,086 NCBI Rnor6.0 Rnor_5.0 18 64,606,980 - 64,607,139 UniSTS Rnor5.0 RGSC_v3.4 18 66,272,922 - 66,273,081 UniSTS RGSC3.4 Celera 18 61,281,622 - 61,281,781 UniSTS RH 3.4 Map 18 655.5 UniSTS Cytogenetic Map 18 q12.1 UniSTS
RH142887
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 63,065,460 - 63,065,663 (+) MAPPER mRatBN7.2 Rnor_6.0 18 65,291,324 - 65,291,526 NCBI Rnor6.0 Rnor_5.0 18 64,477,377 - 64,477,579 UniSTS Rnor5.0 RGSC_v3.4 18 66,141,867 - 66,142,069 UniSTS RGSC3.4 Celera 18 61,151,277 - 61,151,479 UniSTS RH 3.4 Map 18 654.5 UniSTS Cytogenetic Map 18 q12.1 UniSTS
AW534410
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 63,197,110 - 63,197,279 (+) MAPPER mRatBN7.2 Rnor_6.0 18 65,421,671 - 65,421,839 NCBI Rnor6.0 Rnor_5.0 18 64,607,724 - 64,607,892 UniSTS Rnor5.0 RGSC_v3.4 18 66,273,666 - 66,273,834 UniSTS RGSC3.4 Celera 18 61,282,366 - 61,282,534 UniSTS RH 3.4 Map 18 656.7 UniSTS Cytogenetic Map 18 q12.1 UniSTS
BE120385
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 18 65,342,375 - 65,342,595 (+) Marker Load Pipeline mRatBN7.2 18 63,067,291 - 63,067,511 (+) MAPPER mRatBN7.2 Rnor_6.0 18 65,293,155 - 65,293,374 NCBI Rnor6.0 Rnor_5.0 18 64,479,208 - 64,479,427 UniSTS Rnor5.0 RGSC_v3.4 18 66,143,698 - 66,143,917 UniSTS RGSC3.4 Celera 18 61,153,108 - 61,153,327 UniSTS RH 3.4 Map 18 654.5 UniSTS Cytogenetic Map 18 q12.1 UniSTS
BE116587
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 63,249,761 - 63,249,911 (+) MAPPER mRatBN7.2 Rnor_6.0 18 65,474,323 - 65,474,472 NCBI Rnor6.0 Rnor_5.0 18 64,660,376 - 64,660,525 UniSTS Rnor5.0 RGSC_v3.4 18 66,326,318 - 66,326,467 UniSTS RGSC3.4 Celera 18 61,335,006 - 61,335,155 UniSTS RH 3.4 Map 18 656.7 UniSTS Cytogenetic Map 18 q12.1 UniSTS
STS-Z40794
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 63,275,653 - 63,275,991 (+) MAPPER mRatBN7.2 Rnor_6.0 18 65,500,290 - 65,500,627 NCBI Rnor6.0 Rnor_5.0 18 64,686,343 - 64,686,680 UniSTS Rnor5.0 RGSC_v3.4 18 66,352,292 - 66,352,629 UniSTS RGSC3.4 Celera 18 61,360,850 - 61,361,187 UniSTS Cytogenetic Map 18 q12.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020431 ⟹ ENSRNOP00000020431
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 62,943,782 - 63,283,340 (+) Ensembl Rnor_6.0 Ensembl 18 65,285,318 - 65,507,977 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000080844 ⟹ ENSRNOP00000070343
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 63,162,395 - 63,283,340 (+) Ensembl Rnor_6.0 Ensembl 18 65,388,685 - 65,507,590 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000081797 ⟹ ENSRNOP00000070021
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 62,943,782 - 63,283,340 (+) Ensembl Rnor_6.0 Ensembl 18 65,155,685 - 65,507,592 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114956 ⟹ ENSRNOP00000096285
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 63,192,969 - 63,284,425 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000118039 ⟹ ENSRNOP00000087117
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 63,211,719 - 63,283,340 (+) Ensembl
RefSeq Acc Id:
NM_053369 ⟹ NP_445821
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,219,645 - 65,558,407 (+) NCBI mRatBN7.2 18 62,944,515 - 63,283,346 (+) NCBI Rnor_6.0 18 65,285,320 - 65,507,983 (+) NCBI Rnor_5.0 18 64,471,373 - 64,694,036 (+) NCBI RGSC_v3.4 18 66,135,863 - 66,359,984 (+) RGD Celera 18 61,145,273 - 61,368,542 (+) RGD
Sequence:
GCACGAGTACGGGCTCAAATGTAGAAGACAGAAGTAGCTCAGGGTCCTGGGGGAATGGAGGTCATCCAAGCCCGTCCAGGAACTATGGAGATGGGACTCCCTATGACCACATGACTAGCAGGGATCTT
hide sequence
RefSeq Acc Id:
XM_039097157 ⟹ XP_038953085
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,218,184 - 65,563,186 (+) NCBI mRatBN7.2 18 62,943,046 - 63,288,126 (+) NCBI
RefSeq Acc Id:
XM_039097158 ⟹ XP_038953086
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,218,554 - 65,563,186 (+) NCBI mRatBN7.2 18 62,943,418 - 63,288,126 (+) NCBI
RefSeq Acc Id:
XM_039097159 ⟹ XP_038953087
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,216,857 - 65,563,186 (+) NCBI mRatBN7.2 18 62,941,739 - 63,288,126 (+) NCBI
RefSeq Acc Id:
XM_039097160 ⟹ XP_038953088
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,219,079 - 65,563,186 (+) NCBI mRatBN7.2 18 62,943,787 - 63,288,126 (+) NCBI
RefSeq Acc Id:
XM_039097169 ⟹ XP_038953097
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,216,857 - 65,563,186 (+) NCBI mRatBN7.2 18 62,941,759 - 63,288,126 (+) NCBI
RefSeq Acc Id:
XM_039097170 ⟹ XP_038953098
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,218,555 - 65,563,186 (+) NCBI mRatBN7.2 18 62,943,418 - 63,288,126 (+) NCBI
RefSeq Acc Id:
XM_039097173 ⟹ XP_038953101
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,385,902 - 65,563,186 (+) NCBI mRatBN7.2 18 63,116,364 - 63,288,126 (+) NCBI
RefSeq Acc Id:
XM_039097174 ⟹ XP_038953102
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,391,557 - 65,563,186 (+) NCBI mRatBN7.2 18 63,116,475 - 63,288,126 (+) NCBI
RefSeq Acc Id:
XM_039097176 ⟹ XP_038953104
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,391,557 - 65,563,186 (+) NCBI mRatBN7.2 18 63,116,475 - 63,288,126 (+) NCBI
RefSeq Acc Id:
XM_039097177 ⟹ XP_038953105
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,373,247 - 65,563,186 (+) NCBI mRatBN7.2 18 63,098,138 - 63,288,126 (+) NCBI
RefSeq Acc Id:
XM_039097184 ⟹ XP_038953112
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,393,151 - 65,563,186 (+) NCBI mRatBN7.2 18 63,118,042 - 63,288,126 (+) NCBI
RefSeq Acc Id:
XM_039097185 ⟹ XP_038953113
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,393,151 - 65,563,186 (+) NCBI mRatBN7.2 18 63,118,042 - 63,288,126 (+) NCBI
RefSeq Acc Id:
XM_039097186 ⟹ XP_038953114
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,466,811 - 65,563,186 (+) NCBI mRatBN7.2 18 63,192,711 - 63,288,126 (+) NCBI
RefSeq Acc Id:
XM_039097187 ⟹ XP_038953115
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,466,811 - 65,563,186 (+) NCBI mRatBN7.2 18 63,192,708 - 63,288,126 (+) NCBI
RefSeq Acc Id:
XM_039097188 ⟹ XP_038953116
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,466,811 - 65,563,186 (+) NCBI mRatBN7.2 18 63,192,708 - 63,288,126 (+) NCBI
RefSeq Acc Id:
XM_039097189 ⟹ XP_038953117
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,466,811 - 65,563,186 (+) NCBI mRatBN7.2 18 63,192,709 - 63,288,126 (+) NCBI
RefSeq Acc Id:
XM_039097190 ⟹ XP_038953118
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,466,811 - 65,563,186 (+) NCBI mRatBN7.2 18 63,192,706 - 63,288,126 (+) NCBI
RefSeq Acc Id:
XM_039097191 ⟹ XP_038953119
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,468,220 - 65,563,186 (+) NCBI mRatBN7.2 18 63,193,154 - 63,288,126 (+) NCBI
RefSeq Acc Id:
XM_063277614 ⟹ XP_063133684
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,218,554 - 65,563,186 (+) NCBI
RefSeq Acc Id:
XM_063277615 ⟹ XP_063133685
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,218,553 - 65,563,186 (+) NCBI
RefSeq Acc Id:
XM_063277616 ⟹ XP_063133686
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,218,553 - 65,563,186 (+) NCBI
RefSeq Acc Id:
XM_063277617 ⟹ XP_063133687
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,218,552 - 65,563,186 (+) NCBI
RefSeq Acc Id:
XM_063277618 ⟹ XP_063133688
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,218,552 - 65,563,186 (+) NCBI
RefSeq Acc Id:
XM_063277619 ⟹ XP_063133689
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,218,554 - 65,563,186 (+) NCBI
RefSeq Acc Id:
XM_063277620 ⟹ XP_063133690
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,218,553 - 65,563,186 (+) NCBI
RefSeq Acc Id:
XM_063277621 ⟹ XP_063133691
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,218,552 - 65,563,186 (+) NCBI
RefSeq Acc Id:
XM_063277622 ⟹ XP_063133692
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,218,204 - 65,563,186 (+) NCBI
RefSeq Acc Id:
XM_063277623 ⟹ XP_063133693
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,216,857 - 65,563,186 (+) NCBI
RefSeq Acc Id:
XM_063277624 ⟹ XP_063133694
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,216,845 - 65,563,186 (+) NCBI
RefSeq Acc Id:
XM_063277625 ⟹ XP_063133695
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,216,840 - 65,563,186 (+) NCBI
RefSeq Acc Id:
XM_063277626 ⟹ XP_063133696
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,216,857 - 65,563,186 (+) NCBI
RefSeq Acc Id:
XM_063277627 ⟹ XP_063133697
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,385,902 - 65,563,186 (+) NCBI
RefSeq Acc Id:
XM_063277628 ⟹ XP_063133698
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,393,145 - 65,563,186 (+) NCBI
RefSeq Acc Id:
XM_063277629 ⟹ XP_063133699
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,393,432 - 65,563,186 (+) NCBI
RefSeq Acc Id:
XM_063277630 ⟹ XP_063133700
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,466,811 - 65,563,186 (+) NCBI
RefSeq Acc Id:
XM_063277631 ⟹ XP_063133701
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 65,466,811 - 65,563,186 (+) NCBI
RefSeq Acc Id:
NP_445821 ⟸ NM_053369
- UniProtKB:
A0A0G2JWU7 (UniProtKB/TrEMBL)
- Sequence:
MTSRDLGSHDNLSPPFANSRIQSKTERGSYSSYGRENVQGCHQSLLGGDMDMGNPGTLSPTKPGSQYYPYSSNNARRRPLHSSTMEVQTKKVRKVPPGLPSSVYAPSASTADYNRDSPGYSSSKPAAS
hide sequence
Ensembl Acc Id:
ENSRNOP00000070343 ⟸ ENSRNOT00000080844
Ensembl Acc Id:
ENSRNOP00000020431 ⟸ ENSRNOT00000020431
Ensembl Acc Id:
ENSRNOP00000070021 ⟸ ENSRNOT00000081797
RefSeq Acc Id:
XP_038953087 ⟸ XM_039097159
- Peptide Label:
isoform X1
- UniProtKB:
F1LQ90 (UniProtKB/TrEMBL), A6IXY6 (UniProtKB/TrEMBL), A0A0G2JWU7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953097 ⟸ XM_039097169
- Peptide Label:
isoform X10
- UniProtKB:
Q99N33 (UniProtKB/Swiss-Prot), Q62655 (UniProtKB/Swiss-Prot), A6IXY7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953085 ⟸ XM_039097157
- Peptide Label:
isoform X1
- UniProtKB:
F1LQ90 (UniProtKB/TrEMBL), A6IXY6 (UniProtKB/TrEMBL), A0A0G2JWU7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953086 ⟸ XM_039097158
- Peptide Label:
isoform X1
- UniProtKB:
F1LQ90 (UniProtKB/TrEMBL), A6IXY6 (UniProtKB/TrEMBL), A0A0G2JWU7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953098 ⟸ XM_039097170
- Peptide Label:
isoform X10
- UniProtKB:
Q99N33 (UniProtKB/Swiss-Prot), Q62655 (UniProtKB/Swiss-Prot), A6IXY7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953088 ⟸ XM_039097160
- Peptide Label:
isoform X1
- UniProtKB:
F1LQ90 (UniProtKB/TrEMBL), A6IXY6 (UniProtKB/TrEMBL), A0A0G2JWU7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953105 ⟸ XM_039097177
- Peptide Label:
isoform X19
- UniProtKB:
A6IXY8 (UniProtKB/TrEMBL), A0A0G2JXN5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953101 ⟸ XM_039097173
- Peptide Label:
isoform X15
- UniProtKB:
Q99N33 (UniProtKB/Swiss-Prot), Q62655 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038953102 ⟸ XM_039097174
- Peptide Label:
isoform X16
- UniProtKB:
Q99N33 (UniProtKB/Swiss-Prot), Q62655 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038953104 ⟸ XM_039097176
- Peptide Label:
isoform X18
- UniProtKB:
Q99N33 (UniProtKB/Swiss-Prot), Q62655 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038953112 ⟸ XM_039097184
- Peptide Label:
isoform X19
- UniProtKB:
A6IXY8 (UniProtKB/TrEMBL), A0A0G2JXN5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953113 ⟸ XM_039097185
- Peptide Label:
isoform X19
- UniProtKB:
A6IXY8 (UniProtKB/TrEMBL), A0A0G2JXN5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953118 ⟸ XM_039097190
- Peptide Label:
isoform X26
- UniProtKB:
A0A8I6A561 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953115 ⟸ XM_039097187
- Peptide Label:
isoform X23
- UniProtKB:
A0A8I6A561 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953116 ⟸ XM_039097188
- Peptide Label:
isoform X22
- UniProtKB:
A0A8I6A561 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953117 ⟸ XM_039097189
- Peptide Label:
isoform X24
- UniProtKB:
A0A8I6A561 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953114 ⟸ XM_039097186
- Peptide Label:
isoform X21
- UniProtKB:
A0A8I6GLJ0 (UniProtKB/TrEMBL), A6IXY9 (UniProtKB/TrEMBL), A0A8I6A561 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038953119 ⟸ XM_039097191
- Peptide Label:
isoform X28
- UniProtKB:
A0A8I6A561 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000096285 ⟸ ENSRNOT00000114956
Ensembl Acc Id:
ENSRNOP00000087117 ⟸ ENSRNOT00000118039
RefSeq Acc Id:
XP_063133695 ⟸ XM_063277625
- Peptide Label:
isoform X13
- UniProtKB:
Q99N33 (UniProtKB/Swiss-Prot), Q62655 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063133694 ⟸ XM_063277624
- Peptide Label:
isoform X12
- UniProtKB:
Q99N33 (UniProtKB/Swiss-Prot), Q62655 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063133693 ⟸ XM_063277623
- Peptide Label:
isoform X11
- UniProtKB:
Q99N33 (UniProtKB/Swiss-Prot), Q62655 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063133696 ⟸ XM_063277626
- Peptide Label:
isoform X14
- UniProtKB:
Q99N33 (UniProtKB/Swiss-Prot), Q62655 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063133692 ⟸ XM_063277622
- Peptide Label:
isoform X10
- UniProtKB:
Q99N33 (UniProtKB/Swiss-Prot), Q62655 (UniProtKB/Swiss-Prot), A6IXY7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133691 ⟸ XM_063277621
- Peptide Label:
isoform X9
- UniProtKB:
A0A0G2JWU7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133688 ⟸ XM_063277618
- Peptide Label:
isoform X6
- UniProtKB:
A0A0G2JWU7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133687 ⟸ XM_063277617
- Peptide Label:
isoform X5
- UniProtKB:
A0A0G2JWU7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133685 ⟸ XM_063277615
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2JWU7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133686 ⟸ XM_063277616
- Peptide Label:
isoform X4
- UniProtKB:
A0A0G2JWU7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133690 ⟸ XM_063277620
- Peptide Label:
isoform X8
- UniProtKB:
A0A0G2JWU7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133689 ⟸ XM_063277619
- Peptide Label:
isoform X7
- UniProtKB:
A0A0G2JWU7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133684 ⟸ XM_063277614
- Peptide Label:
isoform X2
- UniProtKB:
A0A0G2JWU7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133697 ⟸ XM_063277627
- Peptide Label:
isoform X17
- UniProtKB:
Q99N33 (UniProtKB/Swiss-Prot), Q62655 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063133698 ⟸ XM_063277628
- Peptide Label:
isoform X20
- UniProtKB:
A0A0G2JXN5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133699 ⟸ XM_063277629
- Peptide Label:
isoform X20
- UniProtKB:
A0A0G2JXN5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133700 ⟸ XM_063277630
- Peptide Label:
isoform X25
- UniProtKB:
A0A8I6A561 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133701 ⟸ XM_063277631
- Peptide Label:
isoform X27
- UniProtKB:
A0A8I6A561 (UniProtKB/TrEMBL)
BioCyc Gene G2FUF-7088 BioCyc
Ensembl Genes ENSRNOG00000012405 Ensembl, ENTREZGENE
Ensembl Transcript ENSRNOT00000020431 ENTREZGENE
ENSRNOT00000080844 ENTREZGENE
ENSRNOT00000081797 ENTREZGENE
ENSRNOT00000114956 ENTREZGENE
ENSRNOT00000118039 ENTREZGENE
ENSRNOT00000126184 ENTREZGENE
ENSRNOT00000144722 ENTREZGENE
Gene3D-CATH 4.10.280.10 UniProtKB/Swiss-Prot
InterPro bHLH_dom UniProtKB/Swiss-Prot
HLH_DNA-bd_sf UniProtKB/Swiss-Prot
NeuroDiff_E-box_TFs UniProtKB/Swiss-Prot
KEGG Report rno:84382 UniProtKB/Swiss-Prot
NCBI Gene 84382 ENTREZGENE
PANTHER BASIC HELIX-LOOP-HELIX TRANSCRIPTION FACTOR UniProtKB/Swiss-Prot
TRANSCRIPTION FACTOR 4 UniProtKB/Swiss-Prot
Pfam HLH UniProtKB/Swiss-Prot
PhenoGen Tcf4 PhenoGen
PROSITE BHLH UniProtKB/Swiss-Prot
RatGTEx ENSRNOG00000012405 RatGTEx
SMART HLH UniProtKB/Swiss-Prot
Superfamily-SCOP SSF47459 UniProtKB/Swiss-Prot
TIGR TC217074
UniProt A0A0G2JWU7 ENTREZGENE, UniProtKB/TrEMBL
A0A0G2JXN5 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6A561 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6GLJ0 ENTREZGENE, UniProtKB/TrEMBL
A6IXY6 ENTREZGENE, UniProtKB/TrEMBL
A6IXY7 ENTREZGENE, UniProtKB/TrEMBL
A6IXY8 ENTREZGENE, UniProtKB/TrEMBL
A6IXY9 ENTREZGENE, UniProtKB/TrEMBL
F1LQ90 ENTREZGENE, UniProtKB/TrEMBL
ITF2_RAT UniProtKB/Swiss-Prot, ENTREZGENE
Q99N33 ENTREZGENE
UniProt Secondary Q99N33 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Tcf4
transcription factor 4
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_domains
contains a basic helix-loop-helix motif
68862
