Symbol:
Gabbr1
Name:
gamma-aminobutyric acid type B receptor subunit 1
RGD ID:
621537
Description:
Enables G protein-coupled GABA receptor activity; extracellular matrix protein binding activity; and protein heterodimerization activity. Involved in several processes, including negative regulation of adenylate cyclase activity; neuron-glial cell signaling; and regulation of secretion. Acts upstream of or within adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway. Located in several cellular components, including axolemma; dendrite; and synaptic vesicle. Part of GABA receptor complex. Is active in GABA-ergic synapse; glutamatergic synapse; and synaptic membrane. Used to study alcohol dependence. Biomarker of hypertension. Human ortholog(s) of this gene implicated in alcohol dependence; amphetamine abuse; cocaine dependence; heroin dependence; and nicotine dependence. Orthologous to human GABBR1 (gamma-aminobutyric acid type B receptor subunit 1); INTERACTS WITH 17beta-estradiol 3-benzoate; 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
GABA-B receptor 1; GABA-B-R1; GABA-BR1; GABABR1; gamma-aminobutyric acid (GABA) B receptor 1; gamma-aminobutyric acid (GABA) B receptor, 1; gb1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 1,469,779 - 1,499,352 (-) NCBI GRCr8 mRatBN7.2 20 1,464,534 - 1,494,114 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 1,464,534 - 1,493,994 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 1,517,886 - 1,547,375 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 1,521,372 - 1,550,860 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 1,462,860 - 1,492,324 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 1,955,344 - 1,984,907 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 1,955,359 - 1,984,863 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 3,996,333 - 4,025,508 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 1,553,297 - 1,582,426 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 1,554,603 - 1,577,774 (-) NCBI Celera 20 2,173,047 - 2,202,332 (-) NCBI Celera Cytogenetic Map 20 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gabbr1 Rat 17beta-estradiol multiple interactions ISO GABBR1 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of GABBR1 mRNA CTD PMID:20660070 Gabbr1 Rat 17beta-estradiol 3-benzoate increases expression EXP 6480464 estradiol 3-benzoate results in increased expression of GABBR1 mRNA CTD PMID:21277884 Gabbr1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:27291303 Gabbr1 Rat 2,2,2-trifluoroethanol multiple interactions ISO GABBR1 (Homo sapiens) 6480464 Trifluoroethanol inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of GABBR1 protein] CTD PMID:10683198 Gabbr1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Gabbr1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of GABBR1 mRNA CTD PMID:19465110 Gabbr1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of GABBR1 mRNA CTD PMID:33387578 Gabbr1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of GABBR1 mRNA CTD PMID:34747641 Gabbr1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Gabbr1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of GABBR1 mRNA CTD PMID:26377647 Gabbr1 Rat 2,4,6-trinitrobenzenesulfonic acid increases expression ISO Gabbr1 (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in increased expression of GABBR1 mRNA CTD PMID:17982090 Gabbr1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of GABBR1 mRNA CTD PMID:21346803 Gabbr1 Rat 3,3-diphenyl-N-(1-phenylethyl)-1-propanamine multiple interactions ISO GABBR1 (Homo sapiens) 6480464 Fendiline inhibits the reaction [2 more ... CTD PMID:15627515 Gabbr1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Gabbr1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of GABBR1 mRNA CTD PMID:20188158 and PMID:26251327 Gabbr1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO Gabbr1 (Mus musculus) 6480464 bisphenol S results in decreased methylation of GABBR1 exon CTD PMID:33297965 Gabbr1 Rat 4,4'-sulfonyldiphenol affects methylation ISO Gabbr1 (Mus musculus) 6480464 bisphenol S affects the methylation of GABBR1 gene CTD PMID:31683443 Gabbr1 Rat 4-hydroxyphenyl retinamide increases expression ISO Gabbr1 (Mus musculus) 6480464 Fenretinide results in increased expression of GABBR1 mRNA CTD PMID:28973697 Gabbr1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Gabbr1 (Mus musculus) 6480464 Fenretinide results in decreased expression of GABBR1 mRNA CTD PMID:28973697 Gabbr1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of GABBR1 mRNA CTD PMID:30047161 Gabbr1 Rat acrolein multiple interactions ISO GABBR1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of GABBR1 mRNA more ... CTD PMID:32699268 and PMID:32845096 Gabbr1 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of GABBR1 mRNA CTD PMID:28959563 Gabbr1 Rat acrylamide decreases expression ISO GABBR1 (Homo sapiens) 6480464 Acrylamide results in decreased expression of GABBR1 mRNA CTD PMID:32763439 Gabbr1 Rat all-trans-retinoic acid decreases expression ISO GABBR1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of GABBR1 mRNA CTD PMID:21934132 Gabbr1 Rat alpha-pinene multiple interactions ISO GABBR1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of GABBR1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of GABBR1 mRNA CTD PMID:32699268 Gabbr1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GABBR1 mRNA CTD PMID:16483693 Gabbr1 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of GABBR1 mRNA CTD PMID:30779732 Gabbr1 Rat aristolochic acid A decreases expression ISO GABBR1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of GABBR1 mRNA CTD PMID:33212167 Gabbr1 Rat arsane affects methylation ISO GABBR1 (Homo sapiens) 6480464 Arsenic affects the methylation of GABBR1 gene CTD PMID:25304211 Gabbr1 Rat arsenic atom affects methylation ISO GABBR1 (Homo sapiens) 6480464 Arsenic affects the methylation of GABBR1 gene CTD PMID:25304211 Gabbr1 Rat arsenite(3-) multiple interactions ISO GABBR1 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to GABBR1 mRNA] CTD PMID:32406909 Gabbr1 Rat arsenous acid decreases expression ISO GABBR1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of GABBR1 mRNA CTD PMID:18231732 Gabbr1 Rat Azoxymethane multiple interactions ISO Gabbr1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of GABBR1 mRNA CTD PMID:29950665 Gabbr1 Rat baclofen increases response to substance ISO Gabbr1 (Mus musculus) 6480464 GABBR1 results in increased susceptibility to Baclofen CTD PMID:16990508 and PMID:20138995 Gabbr1 Rat Benoxacor increases expression ISO Gabbr1 (Mus musculus) 6480464 benoxacor results in increased expression of GABBR1 mRNA CTD PMID:34850242 Gabbr1 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of GABBR1 mRNA CTD PMID:21839799 Gabbr1 Rat benzo[a]pyrene increases methylation ISO GABBR1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of GABBR1 promoter CTD PMID:27901495 Gabbr1 Rat benzo[a]pyrene affects methylation ISO GABBR1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GABBR1 3' UTR CTD PMID:27901495 Gabbr1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of GABBR1 mRNA CTD PMID:25181051 Gabbr1 Rat bisphenol A decreases expression ISO Gabbr1 (Mus musculus) 6480464 bisphenol A results in decreased expression of GABBR1 mRNA CTD PMID:32156529 Gabbr1 Rat bisphenol A multiple interactions ISO GABBR1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of GABBR1 gene CTD PMID:31601247 Gabbr1 Rat bisphenol A decreases methylation ISO GABBR1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of GABBR1 gene CTD PMID:31601247 Gabbr1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of GABBR1 mRNA CTD PMID:34947998 Gabbr1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GABBR1 mRNA CTD PMID:30816183 and PMID:32145629 Gabbr1 Rat bisphenol F decreases expression ISO Gabbr1 (Mus musculus) 6480464 bisphenol F results in decreased expression of GABBR1 mRNA CTD PMID:38685157 Gabbr1 Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of GABBR1 promoter CTD PMID:22457795 Gabbr1 Rat cadmium dichloride decreases expression ISO GABBR1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of GABBR1 mRNA CTD PMID:38382870 and PMID:38568856 Gabbr1 Rat calcidiol decreases expression EXP 6480464 Calcifediol deficiency results in decreased expression of GABBR1 mRNA CTD PMID:17293106 Gabbr1 Rat calcium atom multiple interactions ISO GABBR1 (Homo sapiens) 6480464 Calcium promotes the reaction [3-aminopropylphosphinic acid binds to and results in increased activity of [GABBR1 protein binds to GABBR2 protein]] more ... CTD PMID:15627515 Gabbr1 Rat calcium atom affects expression EXP 6480464 Calcium affects the expression of GABBR1 mRNA CTD PMID:15913539 Gabbr1 Rat calcium(0) multiple interactions ISO GABBR1 (Homo sapiens) 6480464 Calcium promotes the reaction [3-aminopropylphosphinic acid binds to and results in increased activity of [GABBR1 protein binds to GABBR2 protein]] more ... CTD PMID:15627515 Gabbr1 Rat calcium(0) affects expression EXP 6480464 Calcium affects the expression of GABBR1 mRNA CTD PMID:15913539 Gabbr1 Rat chaetocin multiple interactions EXP 6480464 [chaetocin co-treated with Dronabinol] results in increased expression of GABBR1 mRNA and chaetocin affects the reaction [Dronabinol affects the expression of GABBR1 mRNA] CTD PMID:29022873 and PMID:29481316 Gabbr1 Rat chloral hydrate multiple interactions ISO GABBR1 (Homo sapiens) 6480464 Chloral Hydrate inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of GABBR1 protein] CTD PMID:10683198 Gabbr1 Rat Chloralose multiple interactions ISO GABBR1 (Homo sapiens) 6480464 Chloralose promotes the reaction [gamma-Aminobutyric Acid results in increased activity of GABBR1 protein] CTD PMID:10683198 Gabbr1 Rat chlorobutanol multiple interactions ISO GABBR1 (Homo sapiens) 6480464 Chlorobutanol inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of GABBR1 protein] CTD PMID:10683198 Gabbr1 Rat choline affects expression EXP 6480464 Choline affects the expression of GABBR1 mRNA alternative form and Choline affects the expression of GABBR1 protein alternative form CTD PMID:17264169 Gabbr1 Rat clozapine decreases expression ISO Gabbr1 (Mus musculus) 6480464 Clozapine results in decreased expression of GABBR1 mRNA CTD PMID:17266109 Gabbr1 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of GABBR1 mRNA CTD PMID:20187946 Gabbr1 Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of GABBR1 mRNA CTD PMID:11793422 Gabbr1 Rat cocaine decreases expression EXP 6480464 Cocaine results in decreased expression of GABBR1 mRNA CTD PMID:16076954 Gabbr1 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of GABBR1 mRNA CTD PMID:30556269 Gabbr1 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of GABBR1 mRNA CTD PMID:30556269 Gabbr1 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of GABBR1 mRNA CTD PMID:23914054 Gabbr1 Rat dextran sulfate multiple interactions ISO Gabbr1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of GABBR1 mRNA CTD PMID:29950665 Gabbr1 Rat diarsenic trioxide decreases expression ISO GABBR1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of GABBR1 mRNA CTD PMID:18231732 Gabbr1 Rat diazepam increases expression EXP 6480464 Diazepam results in increased expression of GABBR1 mRNA CTD PMID:15802192 Gabbr1 Rat Dibutyl phosphate affects expression ISO GABBR1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of GABBR1 mRNA CTD PMID:37042841 Gabbr1 Rat dibutyl phthalate decreases expression ISO Gabbr1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of GABBR1 mRNA CTD PMID:21266533 Gabbr1 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of GABBR1 mRNA CTD PMID:15620428 Gabbr1 Rat dichlorine decreases expression EXP 6480464 Chlorine results in decreased expression of GABBR1 mRNA CTD PMID:18636392 Gabbr1 Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in increased expression of GABBR1 mRNA CTD PMID:18636392 Gabbr1 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of GABBR1 mRNA CTD PMID:37077353 Gabbr1 Rat dorsomorphin multiple interactions ISO GABBR1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GABBR1 mRNA CTD PMID:27188386 Gabbr1 Rat doxorubicin decreases expression ISO GABBR1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of GABBR1 mRNA CTD PMID:29803840 Gabbr1 Rat enflurane multiple interactions ISO GABBR1 (Homo sapiens) 6480464 Enflurane inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of GABBR1 protein] CTD PMID:10683198 Gabbr1 Rat ethanol multiple interactions ISO Gabbr1 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of GABBR1 mRNA CTD PMID:30319688 Gabbr1 Rat ether multiple interactions ISO GABBR1 (Homo sapiens) 6480464 Ether inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of GABBR1 protein] CTD PMID:10683198 Gabbr1 Rat ethylene glycol bis(2-aminoethyl)tetraacetic acid multiple interactions ISO GABBR1 (Homo sapiens) 6480464 Egtazic Acid inhibits the reaction [2 more ... CTD PMID:15627515 Gabbr1 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of GABBR1 mRNA CTD PMID:30307764 Gabbr1 Rat fulvestrant multiple interactions ISO GABBR1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of GABBR1 gene CTD PMID:31601247 Gabbr1 Rat fulvestrant increases methylation ISO GABBR1 (Homo sapiens) 6480464 Fulvestrant results in increased methylation of GABBR1 gene CTD PMID:31601247 Gabbr1 Rat gabapentin multiple interactions ISO GABBR1 (Homo sapiens) 6480464 CGP 71872 inhibits the reaction [gabapentin binds to and results in increased activity of [GABBR1 protein alternative form binds to GABBR2 protein]] and gabapentin binds to and results in increased activity of [GABBR1 protein alternative form binds to GABBR2 protein] CTD PMID:11125035 Gabbr1 Rat gamma-aminobutyric acid multiple interactions ISO GABBR1 (Homo sapiens) 6480464 2 more ... CTD PMID:10683198 more ... Gabbr1 Rat gamma-aminobutyric acid decreases expression EXP 6480464 gamma-Aminobutyric Acid results in decreased expression of GABBR1 mRNA CTD PMID:26924987 Gabbr1 Rat gamma-aminobutyric acid increases activity ISO GABBR1 (Homo sapiens) 6480464 gamma-Aminobutyric Acid results in increased activity of GABBR1 protein CTD PMID:10683198 Gabbr1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of GABBR1 mRNA CTD PMID:33387578 Gabbr1 Rat glyphosate increases expression EXP 6480464 Glyphosate results in increased expression of GABBR1 mRNA CTD PMID:26302742 Gabbr1 Rat hexachlorophene decreases expression ISO Gabbr1 (Mus musculus) 6480464 Hexachlorophene results in decreased expression of GABBR1 mRNA CTD PMID:29301063 Gabbr1 Rat isoflurane multiple interactions ISO GABBR1 (Homo sapiens) 6480464 Isoflurane inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of GABBR1 protein] CTD PMID:10683198 Gabbr1 Rat ketoconazole increases expression EXP 6480464 Ketoconazole results in increased expression of GABBR1 mRNA CTD PMID:37077353 Gabbr1 Rat lead(0) affects expression ISO GABBR1 (Homo sapiens) 6480464 Lead affects the expression of GABBR1 mRNA CTD PMID:28903495 Gabbr1 Rat leflunomide increases expression ISO Gabbr1 (Mus musculus) 6480464 leflunomide results in increased expression of GABBR1 mRNA CTD PMID:19751817 Gabbr1 Rat linalool increases expression EXP 6480464 linalool results in increased expression of GABBR1 mRNA CTD PMID:20536181 Gabbr1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of GABBR1 mRNA CTD PMID:30047161 Gabbr1 Rat methoxyflurane multiple interactions ISO GABBR1 (Homo sapiens) 6480464 Methoxyflurane inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of GABBR1 protein] CTD PMID:10683198 Gabbr1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of GABBR1 mRNA CTD PMID:25729387 Gabbr1 Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of GABBR1 mRNA CTD PMID:25729387 Gabbr1 Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in increased expression of GABBR1 mRNA CTD PMID:18636392 Gabbr1 Rat ozone decreases expression ISO Gabbr1 (Mus musculus) 6480464 Ozone results in decreased expression of GABBR1 mRNA CTD PMID:33026818 Gabbr1 Rat ozone multiple interactions ISO Gabbr1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of GABBR1 mRNA CTD PMID:34911549 Gabbr1 Rat ozone multiple interactions ISO GABBR1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of GABBR1 mRNA more ... CTD PMID:32699268 and PMID:32845096 Gabbr1 Rat paracetamol decreases expression ISO Gabbr1 (Mus musculus) 6480464 Acetaminophen results in decreased expression of GABBR1 mRNA CTD PMID:11752693 Gabbr1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of GABBR1 mRNA CTD PMID:33387578 Gabbr1 Rat paraquat decreases expression ISO Gabbr1 (Mus musculus) 6480464 Paraquat results in decreased expression of GABBR1 mRNA CTD PMID:21371552 Gabbr1 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of GABBR1 protein CTD PMID:24521700 Gabbr1 Rat phencyclidine decreases expression ISO Gabbr1 (Mus musculus) 6480464 Phencyclidine results in decreased expression of GABBR1 mRNA CTD PMID:17266109 Gabbr1 Rat phenylmercury acetate increases expression ISO GABBR1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of GABBR1 mRNA CTD PMID:26272509 Gabbr1 Rat phenylmercury acetate multiple interactions ISO GABBR1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GABBR1 mRNA CTD PMID:27188386 Gabbr1 Rat picoxystrobin decreases expression ISO GABBR1 (Homo sapiens) 6480464 picoxystrobin results in decreased expression of GABBR1 mRNA CTD PMID:33512557 Gabbr1 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of GABBR1 mRNA CTD PMID:19162173 Gabbr1 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of GABBR1 mRNA CTD PMID:30047161 Gabbr1 Rat progesterone multiple interactions ISO GABBR1 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of GABBR1 mRNA CTD PMID:20660070 Gabbr1 Rat SB 431542 multiple interactions ISO GABBR1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of GABBR1 mRNA CTD PMID:27188386 Gabbr1 Rat scopolamine increases expression EXP 6480464 Scopolamine results in increased expression of GABBR1 mRNA CTD PMID:17540011 Gabbr1 Rat sevoflurane multiple interactions ISO GABBR1 (Homo sapiens) 6480464 sevoflurane inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of GABBR1 protein] CTD PMID:10683198 Gabbr1 Rat sodium arsenite decreases expression ISO GABBR1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of GABBR1 mRNA CTD PMID:34032870 Gabbr1 Rat T-2 toxin increases expression EXP 6480464 T-2 Toxin results in increased expression of GABBR1 mRNA CTD PMID:26141394 Gabbr1 Rat T-2 toxin decreases expression ISO GABBR1 (Homo sapiens) 6480464 T-2 Toxin results in decreased expression of GABBR1 mRNA CTD PMID:34581912 Gabbr1 Rat tebufenpyrad decreases expression ISO GABBR1 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of GABBR1 mRNA CTD PMID:33512557 Gabbr1 Rat tert-butanol multiple interactions ISO GABBR1 (Homo sapiens) 6480464 tert-Butyl Alcohol inhibits the reaction [gamma-Aminobutyric Acid results in increased activity of GABBR1 protein] CTD PMID:10683198 Gabbr1 Rat tetrachloromethane affects expression ISO Gabbr1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of GABBR1 mRNA CTD PMID:17484886 Gabbr1 Rat tetraphene increases expression ISO Gabbr1 (Mus musculus) 6480464 benz(a)anthracene results in increased expression of GABBR1 mRNA CTD PMID:26377693 Gabbr1 Rat thapsigargin affects localization EXP 6480464 Thapsigargin affects the localization of GABBR1 protein CTD PMID:24668805 Gabbr1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of GABBR1 mRNA CTD PMID:34492290 Gabbr1 Rat titanium dioxide multiple interactions ISO Gabbr1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of GABBR1 mRNA CTD PMID:29950665 Gabbr1 Rat titanium dioxide decreases methylation ISO Gabbr1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of GABBR1 gene CTD PMID:35295148 Gabbr1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of GABBR1 mRNA CTD PMID:25729387 Gabbr1 Rat triadimefon decreases expression EXP 6480464 triadimefon results in decreased expression of GABBR1 mRNA CTD PMID:30047161 Gabbr1 Rat tribromoethanol multiple interactions ISO GABBR1 (Homo sapiens) 6480464 tribromoethanol promotes the reaction [gamma-Aminobutyric Acid results in increased activity of GABBR1 protein] CTD PMID:10683198 Gabbr1 Rat trichloroethene multiple interactions ISO GABBR1 (Homo sapiens) 6480464 Trichloroethylene promotes the reaction [gamma-Aminobutyric Acid results in increased activity of GABBR1 protein] CTD PMID:10683198 Gabbr1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of GABBR1 mRNA CTD PMID:33387578 Gabbr1 Rat trifluoperazine multiple interactions ISO GABBR1 (Homo sapiens) 6480464 Trifluoperazine inhibits the reaction [2 more ... CTD PMID:15627515 Gabbr1 Rat triptonide decreases expression ISO Gabbr1 (Mus musculus) 6480464 triptonide results in decreased expression of GABBR1 mRNA CTD PMID:33045310 Gabbr1 Rat valproic acid affects expression ISO Gabbr1 (Mus musculus) 6480464 Valproic Acid affects the expression of GABBR1 mRNA CTD PMID:17963808 Gabbr1 Rat valproic acid affects expression ISO GABBR1 (Homo sapiens) 6480464 Valproic Acid affects the expression of GABBR1 mRNA CTD PMID:25979313 Gabbr1 Rat valproic acid increases expression ISO GABBR1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of GABBR1 mRNA CTD PMID:28001369 and PMID:38447685 Gabbr1 Rat valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of GABBR1 mRNA CTD PMID:32428529
17beta-estradiol (ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,2,2-trifluoroethanol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2,4-dinitrotoluene (EXP) 3,3-diphenyl-N-(1-phenylethyl)-1-propanamine (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) acrylamide (EXP,ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) ammonium chloride (EXP) amphetamine (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) Azoxymethane (ISO) baclofen (ISO) Benoxacor (ISO) benzo[a]pyrene (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (EXP,ISO) calcidiol (EXP) calcium atom (EXP,ISO) calcium(0) (EXP,ISO) chaetocin (EXP) chloral hydrate (ISO) Chloralose (ISO) chlorobutanol (ISO) choline (EXP) clozapine (ISO) cocaine (EXP) copper atom (EXP) copper(0) (EXP) decabromodiphenyl ether (EXP) dextran sulfate (ISO) diarsenic trioxide (ISO) diazepam (EXP) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dichlorine (EXP) diethylstilbestrol (EXP) dorsomorphin (ISO) doxorubicin (ISO) enflurane (ISO) ethanol (ISO) ether (ISO) ethylene glycol bis(2-aminoethyl)tetraacetic acid (ISO) fenvalerate (EXP) fulvestrant (ISO) gabapentin (ISO) gamma-aminobutyric acid (EXP,ISO) gentamycin (EXP) glyphosate (EXP) hexachlorophene (ISO) isoflurane (ISO) ketoconazole (EXP) lead(0) (ISO) leflunomide (ISO) linalool (EXP) methimazole (EXP) methoxyflurane (ISO) oxaliplatin (EXP) ozone (EXP,ISO) paracetamol (EXP,ISO) paraquat (EXP,ISO) phencyclidine (ISO) phenylmercury acetate (ISO) picoxystrobin (ISO) pirinixic acid (EXP) pregnenolone 16alpha-carbonitrile (EXP) progesterone (ISO) SB 431542 (ISO) scopolamine (EXP) sevoflurane (ISO) sodium arsenite (ISO) T-2 toxin (EXP,ISO) tebufenpyrad (ISO) tert-butanol (ISO) tetrachloromethane (ISO) tetraphene (ISO) thapsigargin (EXP) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) triadimefon (EXP) tribromoethanol (ISO) trichloroethene (EXP,ISO) trifluoperazine (ISO) triptonide (ISO) valproic acid (EXP,ISO)
Cellular Component
axolemma (IDA) cell projection (IEA) cytoplasm (IEA,ISO) dendrite (IEA) dendritic shaft (IDA) dendritic spine (IDA) endoplasmic reticulum membrane (IDA) extracellular space (IDA) G protein-coupled GABA receptor complex (IEA,IPI,ISO) G protein-coupled receptor dimeric complex (IEA,ISO) G protein-coupled receptor heterodimeric complex (IBA,IEA,ISO,ISS) GABA receptor complex (IDA) GABA-ergic synapse (IDA,IEA,ISO) glutamatergic synapse (IDA) membrane (IEA,ISO) mitochondrial membrane (IDA) neuronal cell body (IDA) perikaryon (IEA) plasma membrane (IDA,IEA,ISO,ISS) postsynaptic membrane (IDA,IEA,ISO) presynapse (IEA,ISO) presynaptic membrane (IDA,IEA,ISO) Schaffer collateral - CA1 synapse (IEA,ISO) synapse (IEA) synaptic membrane (IDA) synaptic vesicle (IDA)
1.
Lamina-specific differences in GABA(B) autoreceptor-mediated regulation of spontaneous GABA release in rat entorhinal cortex.
Bailey SJ, etal., Neuropharmacology. 2004 Jan;46(1):31-42.
2.
[Expression of gamma-amino butyric acid and its receptor in the marginal division of rat striatum]
Bao XM, etal., Di Yi Jun Yi Da Xue Xue Bao 2002 Nov;22(11):961-5.
3.
Cellular and subcellular localization of the GABA(B) receptor 1a/b subunit in the rat periaqueductal gray matter.
Barbaresi P J Comp Neurol. 2007 Dec 10;505(5):478-92.
4.
Structural analysis of the complement control protein (CCP) modules of GABA(B) receptor 1a: only one of the two CCP modules is compactly folded.
Blein S, etal., J Biol Chem. 2004 Nov 12;279(46):48292-306. Epub 2004 Aug 9.
5.
GABA-B receptor activation in the rat globus pallidus potently suppresses pentylenetetrazol-induced tonic seizures.
Chen L, etal., J Biomed Sci. 2004 Jul-Aug;11(4):457-64.
6.
Constitutive expression of functional GABA(B) receptors in mIL-tsA58 cells requires both GABA(B(1)) and GABA(B(2)) genes.
Chronwall BM, etal., J Neurochem 2001 Jun;77(5):1237-47.
7.
The oligomeric state sets GABA(B) receptor signalling efficacy.
Comps-Agrar L, etal., EMBO J. 2011 May 6;30(12):2336-49. doi: 10.1038/emboj.2011.143.
8.
Evidence for pharmacologically distinct GABAB receptors associated with cAMP production in rat brain.
Cunningham MD and Enna SJ, Brain Res. 1996 May 13;720(1-2):220-4.
9.
GABBR1 and SLC6A1, Two Genes Involved in Modulation of GABA Synaptic Transmission, Influence Risk for Alcoholism: Results from Three Ethnically Diverse Populations.
Enoch MA, etal., Alcohol Clin Exp Res. 2016 Jan;40(1):93-101. doi: 10.1111/acer.12929.
10.
GABAergic gene expression in postmortem hippocampus from alcoholics and cocaine addicts; corresponding findings in alcohol-naïve P and NP rats.
Enoch MA, etal., PLoS One. 2012;7(1):e29369. doi: 10.1371/journal.pone.0029369. Epub 2012 Jan 13.
11.
Baclofen antagonizes nicotine-, cocaine-, and morphine-induced dopamine release in the nucleus accumbens of rat.
Fadda P, etal., Synapse. 2003 Oct;50(1):1-6.
12.
Functional GABA(B) receptors expressed in cultured calvarial osteoblasts.
Fujimori S, etal., Biochem Biophys Res Commun 2002 May 24;293(5):1445-52.
13.
An autocrine role for pituitary GABA: activation of GABA-B receptors and regulation of growth hormone levels.
Gamel-Didelon K, etal., Neuroendocrinology. 2002 Sep;76(3):170-7.
14.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
15.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
16.
Evidence for a selective prefrontal cortical GABA(B) receptor-mediated inhibition of glutamate release in the ventral tegmental area: a dual probe microdialysis study in the awake rat.
Harte M and O'Connor WT, Neuroscience. 2005;130(1):215-22.
17.
GABA receptor proteins within lipid rafts in the AY-9944 model of atypical absence seizures.
Huo JZ, etal., Epilepsia. 2009 Apr;50(4):776-88.
18.
Cloning and tissue distribution of novel splice variants of the rat GABAB receptor.
Isomoto S, etal., Biochem Biophys Res Commun 1998 Dec 9;253(1):10-5.
19.
Astrocyte-mediated potentiation of inhibitory synaptic transmission.
Kang J, etal., Nat Neurosci. 1998 Dec;1(8):683-92. doi: 10.1038/3684.
20.
GISP: a novel brain-specific protein that promotes surface expression and function of GABA(B) receptors.
Kantamneni S, etal., J Neurochem. 2007 Feb;100(4):1003-17. Epub 2007 Jan 4.
21.
Expression cloning of GABA(B) receptors uncovers similarity to metabotropic glutamate receptors.
Kaupmann K, etal., Nature 1997 Mar 20;386(6622):239-46.
22.
Distinct localization of GABA(B) receptors relative to synaptic sites in the rat cerebellum and ventrobasal thalamus.
Kulik A, etal., Eur J Neurosci 2002 Jan;15(2):291-307.
23.
Subcellular localization of metabotropic GABA(B) receptor subunits GABA(B1a/b) and GABA(B2) in the rat hippocampus.
Kulik A, etal., J Neurosci. 2003 Dec 3;23(35):11026-35.
24.
Association and interaction analyses of GABBR1 and GABBR2 with nicotine dependence in European- and African-American populations.
Li MD, etal., PLoS One. 2009 Sep 18;4(9):e7055. doi: 10.1371/journal.pone.0007055.
25.
Ethanol modulates GABA(B) receptor expression in cortex and hippocampus of the adult rat brain.
Li SP, etal., Brain Res. 2005 Nov 2;1061(1):27-35. Epub 2005 Oct 24.
26.
Chronic nicotine and smoking exposure decreases GABA(B1) receptor expression in the rat hippocampus.
Li SP, etal., Neurosci Lett 2002 Dec 13;334(2):135-9.
27.
Prenatal GABAB1 and GABAB2 receptors: cellular and subcellular organelle localization in early fetal rat cortical neurons.
Li SP, etal., Synapse. 2006 Dec 15;60(8):557-66.
28.
Development of tolerance upon repeated administration with the GABAB receptor positive allosteric modulator, COR659, on alcohol drinking in rodents.
Lorrai I, etal., Am J Drug Alcohol Abuse. 2022 Nov 2;48(6):662-672. doi: 10.1080/00952990.2022.2116713. Epub 2022 Sep 12.
29.
GABAB receptors in Schwann cells influence proliferation and myelin protein expression.
Magnaghi V, etal., Eur J Neurosci. 2004 May;19(10):2641-9.
30.
Decreased central GABA B receptor binding sites in diabetic rats.
Martin P, etal., Neuropsychobiology. 1988;19(3):146-8.
31.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
32.
Role of GABA(B) receptor in the regulation of excitatory synaptic transmission in trigeminal motoneurons.
Min MY, etal., J Biomed Sci 2002 Jul-Aug;9(4):348-58.
33.
Trans-activation between 7TM domains: implication in heterodimeric GABAB receptor activation.
Monnier C, etal., EMBO J. 2011 Jan 5;30(1):32-42. doi: 10.1038/emboj.2010.270. Epub 2010 Nov 9.
34.
Moderation of baclofen response by a GABAB receptor polymorphism: results from the BacALD randomized controlled trial.
Morley KC, etal., Addiction. 2018 Dec;113(12):2205-2213. doi: 10.1111/add.14373. Epub 2018 Jul 24.
35.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
36.
The metabotropic GABAB receptor directly interacts with the activating transcription factor 4.
Nehring RB, etal., J Biol Chem 2000 Nov 10;275(45):35185-91.
37.
Alternative splicing generates a novel isoform of the rat metabotropic GABA(B)R1 receptor.
Pfaff T, etal., Eur J Neurosci 1999 Aug;11(8):2874-82.
38.
GOA pipeline
RGD automated data pipeline
39.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
40.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
41.
Crosstalk between GABAB and mGlu1a receptors reveals new insight into GPCR signal integration.
Rives ML, etal., EMBO J. 2009 Aug 5;28(15):2195-208. doi: 10.1038/emboj.2009.177. Epub 2009 Jul 9.
42.
Association analysis of exonic variants of the gene encoding the GABAB receptor and alcohol dependence.
Sander T, etal., Psychiatr Genet. 1999 Jun;9(2):69-73. doi: 10.1097/00041444-199906000-00004.
43.
Increased GABA B receptor subtype expression in the nucleus of the solitary tract of the spontaneously hypertensive rat.
Spary EJ, etal., J Mol Neurosci. 2008 Jun;35(2):211-24. Epub 2008 Mar 13.
44.
GABA Receptors Genes Polymorphisms and Alcohol Dependence: No Evidence of an Association in an Italian Male Population.
Terranova C, etal., Clin Psychopharmacol Neurosci. 2014 Aug;12(2):142-8. doi: 10.9758/cpn.2014.12.2.142. Epub 2014 Aug 12.
45.
The sushi domains of secreted GABA(B1) isoforms selectively impair GABA(B) heteroreceptor function.
Tiao JY, etal., J Biol Chem. 2008 Nov 7;283(45):31005-11. doi: 10.1074/jbc.M804464200. Epub 2008 Sep 2.
46.
Modulation of noradrenaline release in the median preoptic area by GABAergic inputs from the organum vasculosum of the lamina terminalis in the rat.
Ushigome A, etal., Neurochem Int. 2004 Feb;44(3):139-44.
47.
Marlin-1 is expressed in testis and associates to the cytoskeleton and GABAB receptors.
Vidal RL, etal., J Cell Biochem. 2008 Feb 15;103(3):886-95.
48.
Cloning and characterization of a novel variant of rat GABA(B)R1 with a truncated C-terminus.
Wei K, etal., Brain Res Mol Brain Res 2001 Apr 18;89(1-2):103-10.
49.
Cloning and tissue distribution of a novel isoform of the rat GABA(B)R1 receptor subunit.
Wei K, etal., Neuroreport 2001 Mar 26;12(4):833-7.
50.
Pre- and postsynaptic inhibition mediated by GABA(B) receptors in rat ventrolateral periaqueductal gray neurons.
Yang K, etal., Biochem Biophys Res Commun. 2003 Mar 7;302(2):233-7.
51.
Variants in GABBR1 Gene Are Associated with Methamphetamine Dependence and Two Years' Relapse after Drug Rehabilitation.
Zhao Y, etal., J Neuroimmune Pharmacol. 2018 Dec;13(4):523-531. doi: 10.1007/s11481-018-9802-9. Epub 2018 Aug 24.
Gabbr1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 1,469,779 - 1,499,352 (-) NCBI GRCr8 mRatBN7.2 20 1,464,534 - 1,494,114 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 1,464,534 - 1,493,994 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 1,517,886 - 1,547,375 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 1,521,372 - 1,550,860 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 1,462,860 - 1,492,324 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 1,955,344 - 1,984,907 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 1,955,359 - 1,984,863 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 3,996,333 - 4,025,508 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 1,553,297 - 1,582,426 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 1,554,603 - 1,577,774 (-) NCBI Celera 20 2,173,047 - 2,202,332 (-) NCBI Celera Cytogenetic Map 20 p12 NCBI
GABBR1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 29,602,238 - 29,633,183 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 29,555,629 - 29,633,976 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 29,570,015 - 29,600,960 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 29,677,984 - 29,708,839 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 29,677,984 - 29,708,839 NCBI Celera 6 31,176,094 - 31,207,052 (-) NCBI Celera Cytogenetic Map 6 p22.1 NCBI HuRef 6 29,377,091 - 29,408,050 (-) NCBI HuRef CHM1_1 6 29,572,149 - 29,603,041 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 29,476,949 - 29,507,887 (-) NCBI T2T-CHM13v2.0
Gabbr1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 37,356,888 - 37,385,197 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 37,356,858 - 37,385,959 (+) Ensembl GRCm39 Ensembl GRCm38 17 37,045,966 - 37,074,305 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 37,045,966 - 37,075,067 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 37,182,911 - 37,211,250 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 36,654,124 - 36,682,342 (+) NCBI MGSCv36 mm8 Celera 17 40,469,514 - 40,497,873 (+) NCBI Celera Cytogenetic Map 17 B1 NCBI cM Map 17 19.16 NCBI
Gabbr1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955583 85,255 - 115,189 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955583 85,255 - 115,140 (-) NCBI ChiLan1.0 ChiLan1.0
GABBR1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 44,209,980 - 44,252,225 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 40,173,327 - 40,215,570 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 29,405,026 - 29,437,108 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 30,065,119 - 30,095,663 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 30,065,119 - 30,095,304 (-) Ensembl panpan1.1 panPan2
GABBR1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 35 26,212,274 - 26,243,910 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 35 26,213,076 - 26,237,572 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 35 26,026,852 - 26,036,580 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 35 26,519,961 - 26,546,313 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 35 26,519,961 - 26,547,127 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 35 26,175,827 - 26,201,883 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 35 26,235,461 - 26,261,547 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 35 27,705,638 - 27,731,798 (-) NCBI UU_Cfam_GSD_1.0
Gabbr1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 32,454,274 - 32,483,774 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936723 1,107,995 - 1,137,178 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936723 1,108,105 - 1,137,602 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GABBR1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 22,548,566 - 22,577,771 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 22,547,938 - 22,577,639 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 25,210,392 - 25,239,486 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GABBR1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 42,985,816 - 43,017,278 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 42,986,513 - 43,014,577 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 29,132,753 - 29,162,814 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gabbr1
.
Predicted Target Of
Count of predictions: 475 Count of miRNA genes: 216 Interacting mature miRNAs: 248 Transcripts: ENSRNOT00000040232, ENSRNOT00000051634 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
7387283 Uae44 Urinary albumin excretion QTL 44 0.1712 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 20 1 26123605 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 1354642 Despr15 Despair related QTL 15 0.0027 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 20 1 24159021 Rat 1600382 Edcs3 Endometrial carcinoma susceptibility QTL3 3.5 0.003 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 20 1 25159026 Rat 8694189 Bw153 Body weight QTL 153 3.13 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 20 1 29191651 Rat 724519 Bp144 Blood pressure QTL 144 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 20 1 3624629 Rat 9590109 Sffal8 Serum free fatty acids level QTL 8 5.32 0.01 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 20 1 29191651 Rat 9590275 Scort15 Serum corticosterone level QTL 15 3.48 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 29191651 Rat 9589155 Insul32 Insulin level QTL 32 6.38 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 1 29191651 Rat 7411650 Foco23 Food consumption QTL 23 20.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 29191651 Rat 2317851 Alcrsp22 Alcohol response QTL 22 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 1641893 Alcrsp7 Alcohol response QTL 7 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 6893685 Bw111 Body weight QTL 111 2.7 0.004 body mass (VT:0001259) body weight (CMO:0000012) 20 1 32578807 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat
D20Wox20
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 1,486,171 - 1,486,366 (+) MAPPER mRatBN7.2 Rnor_6.0 20 1,976,981 - 1,977,175 NCBI Rnor6.0 Rnor_5.0 20 4,017,606 - 4,017,800 UniSTS Rnor5.0 RGSC_v3.4 20 1,574,604 - 1,574,798 UniSTS RGSC3.4 Celera 20 2,194,504 - 2,194,698 UniSTS Cytogenetic Map 20 p12 UniSTS
RH133825
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 1,490,813 - 1,491,014 (+) MAPPER mRatBN7.2 Rnor_6.0 20 1,981,623 - 1,981,823 NCBI Rnor6.0 Rnor_5.0 20 4,022,248 - 4,022,448 UniSTS Rnor5.0 RGSC_v3.4 20 1,579,247 - 1,579,447 UniSTS RGSC3.4 Celera 20 2,199,153 - 2,199,353 UniSTS RH 3.4 Map 20 1.5 UniSTS Cytogenetic Map 20 p12 UniSTS
RH136700
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 1,492,138 - 1,492,269 (+) MAPPER mRatBN7.2 Rnor_6.0 20 1,982,947 - 1,983,077 NCBI Rnor6.0 Rnor_5.0 20 4,023,572 - 4,023,702 UniSTS Rnor5.0 RGSC_v3.4 20 1,580,571 - 1,580,701 UniSTS RGSC3.4 Celera 20 2,200,477 - 2,200,607 UniSTS Cytogenetic Map 20 p12 UniSTS
RH138703
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 1,468,689 - 1,468,845 (+) MAPPER mRatBN7.2 Rnor_6.0 20 1,959,500 - 1,959,655 NCBI Rnor6.0 Rnor_5.0 20 4,000,489 - 4,000,644 UniSTS Rnor5.0 RGSC_v3.4 20 1,557,453 - 1,557,608 UniSTS RGSC3.4 Celera 20 2,177,197 - 2,177,352 UniSTS RH 3.4 Map 20 1.8 UniSTS Cytogenetic Map 20 p12 UniSTS
UniSTS:496042
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 1,466,624 - 1,466,728 (+) MAPPER mRatBN7.2 Rnor_6.0 20 1,957,435 - 1,957,538 NCBI Rnor6.0 Rnor_5.0 20 3,998,424 - 3,998,527 UniSTS Rnor5.0 RGSC_v3.4 20 1,555,388 - 1,555,491 UniSTS RGSC3.4 Celera 20 2,175,132 - 2,175,235 UniSTS Cytogenetic Map 20 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000040232 ⟹ ENSRNOP00000047788
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 1,464,558 - 1,493,439 (-) Ensembl Rnor_6.0 Ensembl 20 1,955,368 - 1,984,737 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000051634 ⟹ ENSRNOP00000047498
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 1,464,534 - 1,493,994 (-) Ensembl Rnor_6.0 Ensembl 20 1,955,359 - 1,984,774 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000078531
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 20 1,979,804 - 1,984,247 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000079445 ⟹ ENSRNOP00000074507
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 20 1,981,436 - 1,984,802 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000082545 ⟹ ENSRNOP00000075630
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 20 1,956,651 - 1,980,150 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000084582 ⟹ ENSRNOP00000075610
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 1,464,534 - 1,493,439 (-) Ensembl Rnor_6.0 Ensembl 20 1,956,577 - 1,980,101 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000085050 ⟹ ENSRNOP00000075181
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 1,464,534 - 1,493,439 (-) Ensembl Rnor_6.0 Ensembl 20 1,956,379 - 1,980,150 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000087524 ⟹ ENSRNOP00000070386
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 20 1,956,622 - 1,984,720 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000088396 ⟹ ENSRNOP00000072226
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 1,464,549 - 1,489,444 (-) Ensembl Rnor_6.0 Ensembl 20 1,955,359 - 1,980,253 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000089485
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 20 1,959,633 - 1,960,651 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000090936 ⟹ ENSRNOP00000071413
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 1,464,534 - 1,493,439 (-) Ensembl Rnor_6.0 Ensembl 20 1,956,622 - 1,984,720 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000090937 ⟹ ENSRNOP00000069181
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 20 1,956,555 - 1,984,863 (-) Ensembl
RefSeq Acc Id:
NM_031028 ⟹ NP_112290
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 1,469,779 - 1,499,236 (-) NCBI mRatBN7.2 20 1,464,534 - 1,493,994 (-) NCBI Rnor_6.0 20 1,955,344 - 1,984,802 (-) NCBI Rnor_5.0 20 3,996,333 - 4,025,508 (-) NCBI RGSC_v3.4 20 1,553,297 - 1,582,426 (-) RGD Celera 20 2,173,047 - 2,202,332 (-) RGD
Sequence:
CCGTCGCCCCGGGGAAGGAGAGACGGGGGTGGGGTTTGCGGGTAGCGATCGAGAAGGGGAGAGACCCCGGCCAGGCAGGAGCCTGGATTCCTGTGGAAGAAGAACAGGGGGAGGGGAAGCTGGAGGAC
hide sequence
RefSeq Acc Id:
XM_006255879 ⟹ XP_006255941
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 1,469,794 - 1,499,349 (-) NCBI mRatBN7.2 20 1,464,534 - 1,494,112 (-) NCBI Rnor_6.0 20 1,955,352 - 1,984,907 (-) NCBI Rnor_5.0 20 3,996,333 - 4,025,508 (-) NCBI
Sequence:
CCCCCGCCCCGTCTTCCCCTGCACCCTCCTTCCTCCCTCCGCCCGAGAGCTTCCCCGGTCCCCG
hide sequence
RefSeq Acc Id:
XM_039099118 ⟹ XP_038955046
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 1,469,794 - 1,499,349 (-) NCBI mRatBN7.2 20 1,465,110 - 1,493,923 (-) NCBI
RefSeq Acc Id:
XM_063279560 ⟹ XP_063135630
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 1,469,794 - 1,499,344 (-) NCBI
RefSeq Acc Id:
XR_005497343
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 1,475,079 - 1,499,352 (-) NCBI mRatBN7.2 20 1,469,834 - 1,494,114 (-) NCBI
RefSeq Acc Id:
NP_112290 ⟸ NM_031028
- Peptide Label:
precursor
- UniProtKB:
Q9Z308 (UniProtKB/Swiss-Prot), Q9Z0U4 (UniProtKB/Swiss-Prot), Q9Z0F9 (UniProtKB/Swiss-Prot), O08621 (UniProtKB/Swiss-Prot), O08620 (UniProtKB/Swiss-Prot), Q6MFX8 (UniProtKB/TrEMBL), A0A0A0MY30 (UniProtKB/TrEMBL), A6KR59 (UniProtKB/TrEMBL)
- Sequence:
MLLLLLVPLFLRPLGAGGAQTPNATSEGCQIIHPPWEGGIRYRGLTRDQVKAINFLPVDYEIEYVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVRICSKSYLTLENGKVFLTGGDLPALDGARVEF
hide sequence
RefSeq Acc Id:
XP_006255941 ⟸ XM_006255879
- Peptide Label:
isoform X1
- UniProtKB:
A6KR60 (UniProtKB/TrEMBL)
- Sequence:
MLLLLLVPLFLRPLGAGGAQTPNATSEGCQIIHPPWEGGIRYRGLTRDQVKAINFLPVDYEIEY
hide sequence
Ensembl Acc Id:
ENSRNOP00000074507 ⟸ ENSRNOT00000079445
Ensembl Acc Id:
ENSRNOP00000075610 ⟸ ENSRNOT00000084582
Ensembl Acc Id:
ENSRNOP00000075630 ⟸ ENSRNOT00000082545
Ensembl Acc Id:
ENSRNOP00000070386 ⟸ ENSRNOT00000087524
Ensembl Acc Id:
ENSRNOP00000075181 ⟸ ENSRNOT00000085050
Ensembl Acc Id:
ENSRNOP00000047498 ⟸ ENSRNOT00000051634
Ensembl Acc Id:
ENSRNOP00000071413 ⟸ ENSRNOT00000090936
Ensembl Acc Id:
ENSRNOP00000069181 ⟸ ENSRNOT00000090937
Ensembl Acc Id:
ENSRNOP00000047788 ⟸ ENSRNOT00000040232
Ensembl Acc Id:
ENSRNOP00000072226 ⟸ ENSRNOT00000088396
RefSeq Acc Id:
XP_038955046 ⟸ XM_039099118
- Peptide Label:
isoform X2
- UniProtKB:
F7FE05 (UniProtKB/TrEMBL), A0A9K3Y6U0 (UniProtKB/TrEMBL), Q924M0 (UniProtKB/TrEMBL), A6KR60 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063135630 ⟸ XM_063279560
- Peptide Label:
isoform X3
- UniProtKB:
A6KR59 (UniProtKB/TrEMBL)
RGD ID: 13701271 Promoter ID: EPDNEW_R11791 Type: single initiation site Name: Gabbr1_2 Description: gamma-aminobutyric acid type B receptor subunit 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R11792 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 1,980,263 - 1,980,323 EPDNEW
RGD ID: 13701279 Promoter ID: EPDNEW_R11792 Type: initiation region Name: Gabbr1_1 Description: gamma-aminobutyric acid type B receptor subunit 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R11791 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 1,984,830 - 1,984,890 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-11
Gabbr1
gamma-aminobutyric acid type B receptor subunit 1
Gabbr1
gamma-aminobutyric acid (GABA) B receptor 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-12-14
Gabbr1
gamma-aminobutyric acid (GABA) B receptor 1
gamma-aminobutyric acid (GABA) B receptor, 1
Name updated
1299863 APPROVED
2002-08-07
Gabbr1
gamma-aminobutyric acid (GABA) B receptor, 1
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
in cerebellar Purkinje cells, cerebral cortex, thalamus and hippocampal CA1 and CA3 regions of the brain
632816
gene_expression
expressed in calvarial osteoblasts
625463
gene_mapping
found within the rat major histocompatibility RT1 complex
1300431
gene_product
member of the metabotropic G-protein-coupled receptor for gamma-aminobutyric acid (GABA) family
632816
