Symbol:
Tnfrsf1b
Name:
TNF receptor superfamily member 1B
RGD ID:
621238
Description:
Enables tumor necrosis factor receptor activity. Involved in several processes, including cellular response to growth factor stimulus; cellular response to tumor necrosis factor; and response to lipopolysaccharide. Located in neuronal cell body; perinuclear region of cytoplasm; and varicosity. Biomarker of Crohn's disease; myocardial infarction; sciatic neuropathy; and ureteral obstruction. Human ortholog(s) of this gene implicated in several diseases, including Parkinsonism; acne; bone disease (multiple); glomerulonephritis (multiple); and lung disease (multiple). Orthologous to human TNFRSF1B (TNF receptor superfamily member 1B); PARTICIPATES IN tumor necrosis factor mediated signaling pathway; amyotrophic lateral sclerosis pathway; cytokine mediated signaling pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
p75; p80 TNF-alpha receptor; TNF-R2; TNF-RII; TNFR-II; Tnfr2; tumor necrosis factor receptor 2; tumor necrosis factor receptor superfamily member 1B; tumor necrosis factor receptor superfamily, member 1b; tumor necrosis factor receptor type II
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TNFRSF1B (TNF receptor superfamily member 1B)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Tnfrsf1b (tumor necrosis factor receptor superfamily, member 1b)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tnfrsf1b (TNF receptor superfamily member 1B)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TNFRSF1B (TNF receptor superfamily member 1B)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TNFRSF1B (TNF receptor superfamily member 1B)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tnfrsf1b (TNF receptor superfamily member 1B)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TNFRSF1B (TNF receptor superfamily member 1B)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TNFRSF1B (TNF receptor superfamily member 1B)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tnfrsf1b (TNF receptor superfamily member 1B)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ZNF493 (zinc finger protein 493)
HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Tnfrsf1b (tumor necrosis factor receptor superfamily, member 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
TNFRSF1B (TNF receptor superfamily member 1B)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tnfrsf1b (tumor necrosis factor receptor superfamily, member 1B)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 162,356,250 - 162,387,411 (-) NCBI GRCr8 mRatBN7.2 5 157,070,642 - 157,104,216 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 157,070,642 - 157,104,206 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 159,775,748 - 159,806,642 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 161,549,033 - 161,579,923 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 161,505,389 - 161,536,279 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 163,136,390 - 163,167,299 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 163,136,390 - 163,167,299 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 166,815,372 - 166,845,910 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 163,666,541 - 163,697,484 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 163,674,328 - 163,707,672 (-) NCBI Celera 5 155,362,574 - 155,393,443 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tnfrsf1b Rat (1->4)-beta-D-glucan multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TNFRSF1B mRNA CTD PMID:36331819 Tnfrsf1b Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane decreases expression EXP 6480464 o and p'-DDT analog results in decreased expression of TNFRSF1B mRNA CTD PMID:22937105 Tnfrsf1b Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression EXP 6480464 o more ... CTD PMID:22937105 Tnfrsf1b Rat 1,1-dichloroethene increases expression ISO Tnfrsf1b (Mus musculus) 6480464 vinylidene chloride results in increased expression of TNFRSF1B mRNA CTD PMID:26682919 Tnfrsf1b Rat 1,2-dimethylhydrazine increases expression ISO Tnfrsf1b (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of TNFRSF1B mRNA CTD PMID:22206623 Tnfrsf1b Rat 1-naphthyl isothiocyanate multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 [1-Naphthylisothiocyanate co-treated with Cholic Acids] affects the expression of TNFRSF1B mRNA CTD PMID:27344345 Tnfrsf1b Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of TNFRSF1B mRNA CTD PMID:17557909 Tnfrsf1b Rat 17beta-estradiol multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of TNFRSF1B mRNA CTD PMID:20660070 Tnfrsf1b Rat 17beta-estradiol decreases expression ISO Tnfrsf1b (Mus musculus) 6480464 Estradiol results in decreased expression of TNFRSF1B mRNA CTD PMID:39298647 Tnfrsf1b Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of TNFRSF1B mRNA CTD PMID:32741896 Tnfrsf1b Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of TNFRSF1B mRNA CTD PMID:32741896 Tnfrsf1b Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 [Flame Retardants results in increased abundance of 2 more ... CTD PMID:38995820 Tnfrsf1b Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 AHR protein affects the reaction [Tetrachlorodibenzodioxin results in increased expression of TNFRSF1B mRNA] CTD PMID:16891777 Tnfrsf1b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TNFRSF1B mRNA CTD PMID:34747641 Tnfrsf1b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases response to substance ISO Tnfrsf1b (Mus musculus) 6480464 TNFRSF1B gene mutant form results in decreased susceptibility to Tetrachlorodibenzodioxin CTD PMID:24718703 Tnfrsf1b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO TNFRSF1B (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of TNFRSF1B mRNA CTD PMID:22298810 Tnfrsf1b Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Tnfrsf1b (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of TNFRSF1B mRNA CTD PMID:12167310 more ... Tnfrsf1b Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TNFRSF1B mRNA CTD PMID:19520675 Tnfrsf1b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tnfrsf1b (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TNFRSF1B mRNA CTD PMID:20702594 Tnfrsf1b Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO Tnfrsf1b (Mus musculus) 6480464 2 more ... CTD PMID:20702594 Tnfrsf1b Rat 2-amino-2-deoxy-D-glucopyranose multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 Glucosamine analog inhibits the reaction [TNF results in increased expression of TNFRSF1B mRNA] and Glucosamine inhibits the reaction [TNF results in increased expression of TNFRSF1B mRNA] CTD PMID:18173918 Tnfrsf1b Rat 2-butoxyethanol increases expression ISO Tnfrsf1b (Mus musculus) 6480464 n-butoxyethanol results in increased expression of TNFRSF1B mRNA CTD PMID:19812364 Tnfrsf1b Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Tnfrsf1b (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of TNFRSF1B mRNA CTD PMID:20188158 Tnfrsf1b Rat 3,4-methylenedioxymethamphetamine increases expression ISO Tnfrsf1b (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of TNFRSF1B mRNA CTD PMID:20188158 Tnfrsf1b Rat 4,4'-sulfonyldiphenol decreases expression ISO Tnfrsf1b (Mus musculus) 6480464 bisphenol S results in decreased expression of TNFRSF1B mRNA CTD PMID:39298647 Tnfrsf1b Rat 4,4'-sulfonyldiphenol increases expression ISO TNFRSF1B (Homo sapiens) 6480464 bisphenol S results in increased expression of TNFRSF1B mRNA CTD PMID:33312107 Tnfrsf1b Rat 4-hydroxyphenyl retinamide increases expression ISO Tnfrsf1b (Mus musculus) 6480464 Fenretinide results in increased expression of TNFRSF1B mRNA CTD PMID:28973697 Tnfrsf1b Rat 4-tert-butylphenol increases expression ISO TNFRSF1B (Homo sapiens) 6480464 butylphen results in increased expression of TNFRSF1B protein CTD PMID:15816839 Tnfrsf1b Rat 5-aza-2'-deoxycytidine affects expression ISO TNFRSF1B (Homo sapiens) 6480464 Decitabine affects the expression of TNFRSF1B mRNA CTD PMID:23300844 Tnfrsf1b Rat 5-aza-2'-deoxycytidine increases expression ISO TNFRSF1B (Homo sapiens) 6480464 Decitabine results in increased expression of TNFRSF1B protein CTD PMID:19117987 Tnfrsf1b Rat 5-fluorouracil affects response to substance ISO TNFRSF1B (Homo sapiens) 6480464 TNFRSF1B protein affects the susceptibility to Fluorouracil CTD PMID:16477629 Tnfrsf1b Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of TNFRSF1B mRNA CTD PMID:24780913 Tnfrsf1b Rat aflatoxin B1 affects methylation ISO TNFRSF1B (Homo sapiens) 6480464 Aflatoxin B1 affects the methylation of TNFRSF1B intron CTD PMID:30157460 Tnfrsf1b Rat Aflatoxin G1 multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 TNFRSF1B protein inhibits the reaction [aflatoxin G1 results in increased expression of CXCL2 mRNA] more ... CTD PMID:36997055 Tnfrsf1b Rat aldehydo-D-glucosamine multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 Glucosamine analog inhibits the reaction [TNF results in increased expression of TNFRSF1B mRNA] and Glucosamine inhibits the reaction [TNF results in increased expression of TNFRSF1B mRNA] CTD PMID:18173918 Tnfrsf1b Rat alfacalcidol decreases expression ISO TNFRSF1B (Homo sapiens) 6480464 alfacalcidol results in decreased expression of TNFRSF1B protein modified form CTD PMID:15044820 Tnfrsf1b Rat Aloe emodin increases expression ISO TNFRSF1B (Homo sapiens) 6480464 aloe emodin results in increased expression of TNFRSF1B protein CTD PMID:19928967 Tnfrsf1b Rat alpha-naphthoflavone multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 alpha-naphthoflavone inhibits the reaction [hydroquinone results in increased expression of TNFRSF1B protein] CTD PMID:34200499 Tnfrsf1b Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TNFRSF1B mRNA CTD PMID:16483693 Tnfrsf1b Rat antirheumatic drug decreases expression ISO TNFRSF1B (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of TNFRSF1B mRNA CTD PMID:24449571 Tnfrsf1b Rat aripiprazole multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of TNFRSF1B mRNA CTD PMID:31476115 Tnfrsf1b Rat aristolochic acid A increases expression ISO TNFRSF1B (Homo sapiens) 6480464 aristolochic acid I results in increased expression of TNFRSF1B mRNA CTD PMID:33212167 Tnfrsf1b Rat arsane affects expression ISO TNFRSF1B (Homo sapiens) 6480464 Arsenic affects the expression of TNFRSF1B protein CTD PMID:24675094 Tnfrsf1b Rat arsane affects methylation ISO TNFRSF1B (Homo sapiens) 6480464 Arsenic affects the methylation of TNFRSF1B gene CTD PMID:25304211 Tnfrsf1b Rat arsenic atom affects expression ISO TNFRSF1B (Homo sapiens) 6480464 Arsenic affects the expression of TNFRSF1B protein CTD PMID:24675094 Tnfrsf1b Rat arsenic atom affects methylation ISO TNFRSF1B (Homo sapiens) 6480464 Arsenic affects the methylation of TNFRSF1B gene CTD PMID:25304211 Tnfrsf1b Rat arsenite(3-) decreases expression ISO Tnfrsf1b (Mus musculus) 6480464 arsenite results in decreased expression of TNFRSF1B mRNA CTD PMID:18191166 Tnfrsf1b Rat arsenous acid increases expression ISO TNFRSF1B (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of TNFRSF1B mRNA CTD PMID:24345465 Tnfrsf1b Rat arsenous acid decreases expression ISO Tnfrsf1b (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of TNFRSF1B mRNA CTD PMID:12243866 Tnfrsf1b Rat arsenous acid decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of TNFRSF1B mRNA CTD PMID:19730151 Tnfrsf1b Rat arsenous acid multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 [sanguinarine co-treated with Arsenic Trioxide] results in increased expression of TNFRSF1B mRNA CTD PMID:24345465 Tnfrsf1b Rat arsenous acid decreases expression ISO TNFRSF1B (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of TNFRSF1B mRNA CTD PMID:15761015 Tnfrsf1b Rat asbestos decreases expression ISO TNFRSF1B (Homo sapiens) 6480464 Asbestos results in decreased expression of TNFRSF1B mRNA CTD PMID:22398240 Tnfrsf1b Rat asbestos increases expression ISO TNFRSF1B (Homo sapiens) 6480464 Asbestos results in increased expression of TNFRSF1B mRNA CTD PMID:22398240 Tnfrsf1b Rat bathocuproine disulfonic acid multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 [bathocuproine sulfonate co-treated with pyrrolidine dithiocarbamic acid] inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in decreased expression of TNFRSF1B mRNA] CTD PMID:15477007 Tnfrsf1b Rat benzo[a]pyrene increases expression ISO Tnfrsf1b (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of TNFRSF1B mRNA CTD PMID:20713471 Tnfrsf1b Rat benzo[a]pyrene affects methylation ISO TNFRSF1B (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of TNFRSF1B promoter CTD PMID:27901495 Tnfrsf1b Rat benzo[a]pyrene increases methylation ISO TNFRSF1B (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of TNFRSF1B exon CTD PMID:27901495 Tnfrsf1b Rat benzo[a]pyrene decreases expression ISO Tnfrsf1b (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of TNFRSF1B mRNA CTD PMID:21569818 Tnfrsf1b Rat benzo[a]pyrene diol epoxide I decreases expression ISO TNFRSF1B (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Tnfrsf1b Rat benzoates decreases expression ISO TNFRSF1B (Homo sapiens) 6480464 Benzoates analog results in decreased expression of TNFRSF1B mRNA CTD PMID:29472718 Tnfrsf1b Rat beta-D-glucosamine multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 Glucosamine analog inhibits the reaction [TNF results in increased expression of TNFRSF1B mRNA] and Glucosamine inhibits the reaction [TNF results in increased expression of TNFRSF1B mRNA] CTD PMID:18173918 Tnfrsf1b Rat beta-lapachone decreases expression ISO TNFRSF1B (Homo sapiens) 6480464 beta-lapachone results in decreased expression of TNFRSF1B mRNA CTD PMID:38218311 Tnfrsf1b Rat bis(2-chloroethyl) sulfide multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 TNF protein affects the reaction [Mustard Gas affects the expression of TNFRSF1B mRNA] CTD PMID:16173061 Tnfrsf1b Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TNFRSF1B mRNA CTD PMID:25181051 Tnfrsf1b Rat bisphenol A affects expression ISO Tnfrsf1b (Mus musculus) 6480464 bisphenol A affects the expression of TNFRSF1B mRNA CTD PMID:35341816 Tnfrsf1b Rat bisphenol A increases expression ISO TNFRSF1B (Homo sapiens) 6480464 bisphenol A results in increased expression of TNFRSF1B mRNA CTD PMID:33312107 Tnfrsf1b Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TNFRSF1B mRNA CTD PMID:30816183 and PMID:32528016 Tnfrsf1b Rat bisphenol F increases expression ISO TNFRSF1B (Homo sapiens) 6480464 bisphenol F results in increased expression of TNFRSF1B mRNA CTD PMID:33312107 Tnfrsf1b Rat bleomycin A2 increases expression EXP 6480464 Bleomycin results in increased expression of TNFRSF1B protein CTD PMID:15371238 Tnfrsf1b Rat bleomycin A2 increases response to substance ISO Tnfrsf1b (Mus musculus) 6480464 TNFRSF1B results in increased susceptibility to Bleomycin CTD PMID:12003776 Tnfrsf1b Rat Brevianamide A increases expression ISO Tnfrsf1b (Mus musculus) 6480464 brevianamide A results in increased expression of TNFRSF1B mRNA CTD PMID:19818335 Tnfrsf1b Rat cadmium atom increases expression ISO TNFRSF1B (Homo sapiens) 6480464 Cadmium results in increased expression of TNFRSF1B mRNA CTD PMID:33559965 Tnfrsf1b Rat cadmium dichloride multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of TNFRSF1B mRNA CTD PMID:12634122 Tnfrsf1b Rat cadmium dichloride increases expression ISO Tnfrsf1b (Mus musculus) 6480464 Cadmium Chloride results in increased expression of TNFRSF1B mRNA CTD PMID:15501611 Tnfrsf1b Rat carbon monoxide increases expression ISO TNFRSF1B (Homo sapiens) 6480464 Carbon Monoxide results in increased expression of TNFRSF1B protein modified form CTD PMID:18629312 Tnfrsf1b Rat carbon nanotube affects expression ISO Tnfrsf1b (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of TNFRSF1B mRNA CTD PMID:23845593 Tnfrsf1b Rat carbon nanotube increases expression ISO Tnfrsf1b (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Tnfrsf1b Rat chloroquine multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 Chloroquine inhibits the reaction [lipopolysaccharide and Escherichia coli O111 B4 results in increased secretion of TNFRSF1B protein] CTD PMID:22341560 Tnfrsf1b Rat ciguatoxin CTX1B affects expression ISO Tnfrsf1b (Mus musculus) 6480464 Ciguatoxins affects the expression of TNFRSF1B mRNA CTD PMID:18353800 Tnfrsf1b Rat cisplatin increases expression ISO Tnfrsf1b (Mus musculus) 6480464 Cisplatin results in increased expression of TNFRSF1B mRNA and Cisplatin results in increased expression of TNFRSF1B protein CTD PMID:15701814 more ... Tnfrsf1b Rat cisplatin affects expression ISO TNFRSF1B (Homo sapiens) 6480464 Cisplatin affects the expression of TNFRSF1B mRNA CTD PMID:23300844 Tnfrsf1b Rat cisplatin multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 SB 203580 inhibits the reaction [Cisplatin results in increased expression of TNFRSF1B protein] CTD PMID:15701814 Tnfrsf1b Rat cocaine affects expression ISO Tnfrsf1b (Mus musculus) 6480464 Cocaine affects the expression of TNFRSF1B mRNA CTD PMID:15681117 Tnfrsf1b Rat Cuprizon affects expression EXP 6480464 Cuprizone affects the expression of TNFRSF1B mRNA CTD PMID:27523638 Tnfrsf1b Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of TNFRSF1B mRNA CTD PMID:26577399 Tnfrsf1b Rat curcumin multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 Curcumin inhibits the reaction [TNF protein results in increased expression of TNFRSF1B mRNA] and Curcumin inhibits the reaction [TNF protein results in increased expression of TNFRSF1B protein] CTD PMID:17666914 Tnfrsf1b Rat DDE affects expression EXP 6480464 Dichlorodiphenyl Dichloroethylene affects the expression of TNFRSF1B mRNA CTD PMID:24576310 Tnfrsf1b Rat dexamethasone multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 [IL10 protein co-treated with Dexamethasone] inhibits the reaction [Lipopolysaccharides results in decreased expression of TNFRSF1B protein] and Dexamethasone inhibits the reaction [Lipopolysaccharides results in decreased expression of TNFRSF1B protein] CTD PMID:37177863 Tnfrsf1b Rat dextran multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 [Dextrans co-treated with ferrite analog] results in decreased expression of TNFRSF1B mRNA CTD PMID:26576301 Tnfrsf1b Rat dextran sulfate increases expression ISO Tnfrsf1b (Mus musculus) 6480464 Dextran Sulfate results in increased expression of TNFRSF1B mRNA CTD PMID:20824662 Tnfrsf1b Rat diarsenic trioxide decreases expression ISO Tnfrsf1b (Mus musculus) 6480464 Arsenic Trioxide results in decreased expression of TNFRSF1B mRNA CTD PMID:12243866 Tnfrsf1b Rat diarsenic trioxide multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 [sanguinarine co-treated with Arsenic Trioxide] results in increased expression of TNFRSF1B mRNA CTD PMID:24345465 Tnfrsf1b Rat diarsenic trioxide increases expression ISO TNFRSF1B (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of TNFRSF1B mRNA CTD PMID:24345465 Tnfrsf1b Rat diarsenic trioxide decreases expression ISO TNFRSF1B (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of TNFRSF1B mRNA CTD PMID:15761015 Tnfrsf1b Rat diarsenic trioxide decreases expression EXP 6480464 Arsenic Trioxide results in decreased expression of TNFRSF1B mRNA CTD PMID:19730151 Tnfrsf1b Rat dichromium trioxide multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of TNFRSF1B mRNA CTD PMID:12634122 Tnfrsf1b Rat doxorubicin multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 TNFRSF1B protein affects the reaction [Doxorubicin affects the expression of PLCD1 mRNA] more ... CTD PMID:16505099 and PMID:16618758 Tnfrsf1b Rat doxorubicin decreases expression ISO TNFRSF1B (Homo sapiens) 6480464 Doxorubicin results in decreased expression of TNFRSF1B mRNA CTD PMID:29803840 Tnfrsf1b Rat doxorubicin affects response to substance ISO Tnfrsf1b (Mus musculus) 6480464 TNFRSF1B protein affects the susceptibility to Doxorubicin CTD PMID:16618758 Tnfrsf1b Rat doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of TNFRSF1B protein CTD PMID:17651020 Tnfrsf1b Rat epoxiconazole affects expression ISO Tnfrsf1b (Mus musculus) 6480464 epoxiconazole affects the expression of TNFRSF1B mRNA CTD PMID:35436446 Tnfrsf1b Rat ethanol multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 Ethanol inhibits the reaction [FOXO3 protein results in increased expression of TNFRSF1B mRNA] CTD PMID:26470730 Tnfrsf1b Rat ethanol increases expression ISO TNFRSF1B (Homo sapiens) 6480464 Ethanol results in increased expression of TNFRSF1B protein modified form CTD PMID:26733986 Tnfrsf1b Rat ethylparaben decreases expression ISO TNFRSF1B (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in decreased expression of TNFRSF1B mRNA CTD PMID:37690743 Tnfrsf1b Rat fluoranthene multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of TNFRSF1B mRNA CTD PMID:28329830 Tnfrsf1b Rat furosemide affects expression EXP 6480464 Furosemide affects the expression of TNFRSF1B mRNA CTD PMID:17497460 Tnfrsf1b Rat Fusarenone X increases expression ISO Tnfrsf1b (Mus musculus) 6480464 fusarenon-X results in increased expression of TNFRSF1B mRNA CTD PMID:24983900 Tnfrsf1b Rat gefitinib decreases expression ISO TNFRSF1B (Homo sapiens) 6480464 gefitinib results in decreased expression of TNFRSF1B mRNA CTD PMID:16685379 Tnfrsf1b Rat glyphosate increases methylation EXP 6480464 Glyphosate results in increased methylation of TNFRSF1B gene CTD PMID:31011160 Tnfrsf1b Rat Heliotrine increases expression EXP 6480464 heliotrine results in increased expression of TNFRSF1B mRNA CTD PMID:34185104 Tnfrsf1b Rat hopane increases expression ISO TNFRSF1B (Homo sapiens) 6480464 hopane results in increased expression of TNFRSF1B CTD PMID:20123637 Tnfrsf1b Rat hydrogen peroxide decreases response to substance ISO TNFRSF1B (Homo sapiens) 6480464 TNFRSF1B protein results in decreased susceptibility to Hydrogen Peroxide CTD PMID:22110694 Tnfrsf1b Rat hydroquinone multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 alpha-naphthoflavone inhibits the reaction [hydroquinone results in increased expression of TNFRSF1B protein] CTD PMID:34200499 Tnfrsf1b Rat hydroquinone increases expression ISO Tnfrsf1b (Mus musculus) 6480464 hydroquinone results in increased expression of TNFRSF1B mRNA CTD PMID:22414385 Tnfrsf1b Rat hydroquinone increases expression ISO TNFRSF1B (Homo sapiens) 6480464 hydroquinone results in increased expression of TNFRSF1B protein CTD PMID:34200499 Tnfrsf1b Rat indole-3-methanol multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of TNFRSF1B mRNA CTD PMID:22129741 Tnfrsf1b Rat inulin multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of TNFRSF1B mRNA CTD PMID:36331819 Tnfrsf1b Rat ionomycin multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 [bathocuproine sulfonate co-treated with pyrrolidine dithiocarbamic acid] inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in decreased expression of TNFRSF1B mRNA] and [Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in decreased expression of TNFRSF1B mRNA CTD PMID:15477007 Tnfrsf1b Rat ketoconazole increases expression ISO Tnfrsf1b (Mus musculus) 6480464 Ketoconazole results in increased expression of TNFRSF1B mRNA CTD PMID:25808816 Tnfrsf1b Rat ketoconazole increases expression EXP 6480464 Ketoconazole results in increased expression of TNFRSF1B mRNA CTD PMID:25808816 Tnfrsf1b Rat lead diacetate multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of TNFRSF1B mRNA CTD PMID:12634122 Tnfrsf1b Rat lead diacetate increases expression ISO Tnfrsf1b (Mus musculus) 6480464 lead acetate results in increased expression of TNFRSF1B mRNA CTD PMID:21829687 Tnfrsf1b Rat lead nitrate multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 lead nitrate affects the reaction [TNFRSF1B affects the expression of MT1 mRNA] and lead nitrate affects the reaction [TNFRSF1B affects the expression of MT2 mRNA] CTD PMID:11891201 Tnfrsf1b Rat lead(0) increases expression ISO TNFRSF1B (Homo sapiens) 6480464 Lead results in increased expression of TNFRSF1B protein CTD PMID:22142875 Tnfrsf1b Rat lenalidomide decreases expression ISO TNFRSF1B (Homo sapiens) 6480464 lenalidomide results in decreased expression of TNFRSF1B mRNA CTD PMID:15618473 Tnfrsf1b Rat lipopolysaccharide increases expression ISO TNFRSF1B (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of TNFRSF1B protein CTD PMID:10072544 Tnfrsf1b Rat lipopolysaccharide decreases expression ISO Tnfrsf1b (Mus musculus) 6480464 Lipopolysaccharides results in decreased expression of TNFRSF1B protein CTD PMID:37177863 Tnfrsf1b Rat lipopolysaccharide increases expression ISO Tnfrsf1b (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of TNFRSF1B mRNA and Lipopolysaccharides results in increased expression of TNFRSF1B protein CTD PMID:10975854 more ... Tnfrsf1b Rat lipopolysaccharide multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 (+)-JQ1 compound inhibits the reaction [Lipopolysaccharides results in increased expression of TNFRSF1B mRNA] more ... CTD PMID:19133137 more ... Tnfrsf1b Rat lipopolysaccharide multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in increased expression of TNFRSF1B mRNA and NFKBIA protein inhibits the reaction [Lipopolysaccharides results in increased expression of TNFRSF1B protein] CTD PMID:10072544 and PMID:31059760 Tnfrsf1b Rat melatonin increases response to substance ISO Tnfrsf1b (Mus musculus) 6480464 TNFRSF1B protein results in increased susceptibility to Melatonin CTD PMID:21342247 Tnfrsf1b Rat methyl methanesulfonate decreases expression ISO TNFRSF1B (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of TNFRSF1B mRNA CTD PMID:23649840 Tnfrsf1b Rat Mitotane increases expression EXP 6480464 Mitotane analog results in increased expression of TNFRSF1B mRNA and Mitotane results in increased expression of TNFRSF1B mRNA CTD PMID:23485034 Tnfrsf1b Rat monosodium L-glutamate multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 Plant Extracts inhibits the reaction [Sodium Glutamate results in increased secretion of TNFRSF1B protein] CTD PMID:27918843 Tnfrsf1b Rat monosodium L-glutamate increases secretion ISO Tnfrsf1b (Mus musculus) 6480464 Sodium Glutamate results in increased secretion of TNFRSF1B protein CTD PMID:27918843 Tnfrsf1b Rat mycophenolic acid increases expression ISO Tnfrsf1b (Mus musculus) 6480464 Mycophenolic Acid results in increased expression of TNFRSF1B mRNA CTD PMID:19818335 Tnfrsf1b Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of TNFRSF1B mRNA CTD PMID:22129741 Tnfrsf1b Rat N-methyl-4-phenylpyridinium increases expression ISO TNFRSF1B (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of TNFRSF1B mRNA CTD PMID:24810058 Tnfrsf1b Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of TNFRSF1B mRNA CTD PMID:22129741 Tnfrsf1b Rat nevirapine increases expression ISO Tnfrsf1b (Mus musculus) 6480464 Nevirapine results in increased expression of TNFRSF1B mRNA CTD PMID:38636494 Tnfrsf1b Rat nickel atom decreases expression ISO TNFRSF1B (Homo sapiens) 6480464 Nickel results in decreased expression of TNFRSF1B mRNA CTD PMID:23195993 Tnfrsf1b Rat nickel atom increases expression ISO TNFRSF1B (Homo sapiens) 6480464 Nickel results in increased expression of TNFRSF1B mRNA CTD PMID:24768652 and PMID:25583101 Tnfrsf1b Rat nickel sulfate increases expression ISO TNFRSF1B (Homo sapiens) 6480464 nickel sulfate results in increased expression of TNFRSF1B mRNA CTD PMID:16780908 Tnfrsf1b Rat nitrogen dioxide increases expression ISO TNFRSF1B (Homo sapiens) 6480464 Nitrogen Dioxide results in increased expression of TNFRSF1B protein modified form CTD PMID:18629312 Tnfrsf1b Rat obeticholic acid increases expression ISO TNFRSF1B (Homo sapiens) 6480464 obeticholic acid results in increased expression of TNFRSF1B mRNA CTD PMID:27939613 Tnfrsf1b Rat octreotide increases expression EXP 6480464 Octreotide results in increased expression of TNFRSF1B mRNA and Octreotide results in increased expression of TNFRSF1B protein CTD PMID:21692635 Tnfrsf1b Rat oleanolic acid increases expression ISO Tnfrsf1b (Mus musculus) 6480464 Oleanolic Acid results in increased expression of TNFRSF1B mRNA CTD PMID:18706400 Tnfrsf1b Rat osthole increases expression ISO TNFRSF1B (Homo sapiens) 6480464 osthol results in increased expression of TNFRSF1B protein CTD PMID:29319219 Tnfrsf1b Rat oxidopamine decreases response to substance ISO TNFRSF1B (Homo sapiens) 6480464 TNFRSF1B protein results in decreased susceptibility to Oxidopamine CTD PMID:22110694 Tnfrsf1b Rat ozone multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of TNFRSF1B mRNA more ... CTD PMID:11159038 more ... Tnfrsf1b Rat ozone multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of TNFRSF1B mRNA CTD PMID:31476115 Tnfrsf1b Rat ozone increases expression ISO TNFRSF1B (Homo sapiens) 6480464 Ozone results in increased expression of TNFRSF1B mRNA CTD PMID:31476115 Tnfrsf1b Rat ozone increases expression ISO Tnfrsf1b (Mus musculus) 6480464 Ozone results in increased expression of TNFRSF1B protein CTD PMID:15516495 and PMID:16002559 Tnfrsf1b Rat ozone affects expression ISO Tnfrsf1b (Mus musculus) 6480464 Ozone affects the expression of TNFRSF1B mRNA CTD PMID:11159038 Tnfrsf1b Rat p-menthan-3-ol increases expression ISO TNFRSF1B (Homo sapiens) 6480464 Menthol results in increased expression of TNFRSF1B mRNA CTD PMID:26760959 Tnfrsf1b Rat paracetamol affects expression ISO Tnfrsf1b (Mus musculus) 6480464 Acetaminophen affects the expression of TNFRSF1B mRNA CTD PMID:17562736 Tnfrsf1b Rat paracetamol multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in increased expression of TNFRSF1B mRNA CTD PMID:31059760 Tnfrsf1b Rat paracetamol increases expression ISO TNFRSF1B (Homo sapiens) 6480464 Acetaminophen results in increased expression of TNFRSF1B mRNA CTD PMID:26690555 Tnfrsf1b Rat paracetamol multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 O(2)-vinyl-1-(pyrrolidin-1-yl)diazen-1-ium-1 and 2-diolate inhibits the reaction [Acetaminophen results in increased expression of TNFRSF1B mRNA] CTD PMID:12540782 Tnfrsf1b Rat paracetamol increases expression ISO Tnfrsf1b (Mus musculus) 6480464 Acetaminophen results in increased expression of TNFRSF1B mRNA CTD PMID:12540782 Tnfrsf1b Rat paraquat increases expression ISO TNFRSF1B (Homo sapiens) 6480464 Paraquat results in increased expression of TNFRSF1B protein CTD PMID:36108500 Tnfrsf1b Rat pentachlorophenol increases expression ISO Tnfrsf1b (Mus musculus) 6480464 Pentachlorophenol results in increased expression of TNFRSF1B mRNA CTD PMID:23892564 Tnfrsf1b Rat perfluorodecanoic acid decreases expression ISO TNFRSF1B (Homo sapiens) 6480464 perfluorodecanoic acid results in decreased expression of TNFRSF1B protein CTD PMID:32916415 Tnfrsf1b Rat perfluorononanoic acid increases expression ISO TNFRSF1B (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in increased expression of TNFRSF1B mRNA CTD PMID:32588087 Tnfrsf1b Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of TNFRSF1B mRNA more ... CTD PMID:36331819 Tnfrsf1b Rat perfluoroundecanoic acid decreases expression ISO TNFRSF1B (Homo sapiens) 6480464 perfluoroundecanoic acid results in decreased expression of TNFRSF1B protein CTD PMID:32916415 Tnfrsf1b Rat phorbol 13-acetate 12-myristate multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 [bathocuproine sulfonate co-treated with pyrrolidine dithiocarbamic acid] inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in decreased expression of TNFRSF1B mRNA] more ... CTD PMID:10072544 and PMID:15477007 Tnfrsf1b Rat phorbol 13-acetate 12-myristate increases expression ISO TNFRSF1B (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased expression of TNFRSF1B protein CTD PMID:10072544 Tnfrsf1b Rat pioglitazone increases secretion ISO Tnfrsf1b (Mus musculus) 6480464 Pioglitazone results in increased secretion of TNFRSF1B protein CTD PMID:27918843 Tnfrsf1b Rat pirinixic acid increases expression ISO Tnfrsf1b (Mus musculus) 6480464 pirinixic acid results in increased expression of TNFRSF1B mRNA CTD PMID:18445702 Tnfrsf1b Rat pirinixic acid multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of TNFRSF1B mRNA CTD PMID:19710929 Tnfrsf1b Rat pregnenolone 16alpha-carbonitrile increases expression ISO Tnfrsf1b (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of TNFRSF1B mRNA CTD PMID:28903501 Tnfrsf1b Rat prenyl diphosphate increases expression ISO TNFRSF1B (Homo sapiens) 6480464 3 and 3-dimethylallyl pyrophosphate results in increased expression of TNFRSF1B protein CTD PMID:12932289 Tnfrsf1b Rat procyanidin B3 multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 procyanidin B3 inhibits the reaction [Lipopolysaccharides results in increased expression of TNFRSF1B mRNA] CTD PMID:22169119 Tnfrsf1b Rat progesterone multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of TNFRSF1B mRNA CTD PMID:20660070 Tnfrsf1b Rat pyrrolidine dithiocarbamate multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 [bathocuproine sulfonate co-treated with pyrrolidine dithiocarbamic acid] inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in decreased expression of TNFRSF1B mRNA] CTD PMID:15477007 Tnfrsf1b Rat quercetin increases expression ISO TNFRSF1B (Homo sapiens) 6480464 Quercetin results in increased expression of TNFRSF1B mRNA CTD PMID:15309432 Tnfrsf1b Rat quercitrin decreases expression ISO TNFRSF1B (Homo sapiens) 6480464 quercitrin results in decreased expression of TNFRSF1B mRNA CTD PMID:25193878 Tnfrsf1b Rat resveratrol increases response to substance ISO Tnfrsf1b (Mus musculus) 6480464 TNFRSF1B protein results in increased susceptibility to resveratrol CTD PMID:21342247 Tnfrsf1b Rat sanguinarine multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 [sanguinarine co-treated with arsenic trioxide] results in increased expression of TNFRSF1B mRNA CTD PMID:24345465 Tnfrsf1b Rat SB 203580 multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 SB 203580 inhibits the reaction [Cisplatin results in increased expression of TNFRSF1B protein] CTD PMID:15701814 Tnfrsf1b Rat senecionine increases expression EXP 6480464 senecionine results in increased expression of TNFRSF1B mRNA CTD PMID:34185104 Tnfrsf1b Rat serpentine asbestos multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 [TNFRSF1A gene mutant form co-treated with TNFRSF1B gene mutant form] inhibits the reaction [Asbestos more ... CTD PMID:9846974 Tnfrsf1b Rat simvastatin decreases expression ISO Tnfrsf1b (Mus musculus) 6480464 Simvastatin results in decreased expression of TNFRSF1B mRNA CTD PMID:18310456 Tnfrsf1b Rat sodium arsenite multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 [sodium arsenite co-treated with Cadmium Chloride co-treated with chromic oxide co-treated with chromous chloride co-treated with lead acetate] results in decreased expression of TNFRSF1B mRNA CTD PMID:12634122 Tnfrsf1b Rat sodium arsenite decreases expression ISO TNFRSF1B (Homo sapiens) 6480464 sodium arsenite results in decreased expression of TNFRSF1B mRNA CTD PMID:29301061 Tnfrsf1b Rat sodium arsenite decreases expression ISO Tnfrsf1b (Mus musculus) 6480464 sodium arsenite results in decreased expression of TNFRSF1B mRNA CTD PMID:31532247 Tnfrsf1b Rat sodium arsenite affects methylation ISO TNFRSF1B (Homo sapiens) 6480464 sodium arsenite affects the methylation of TNFRSF1B gene CTD PMID:28589171 Tnfrsf1b Rat sodium stibogluconate decreases expression ISO TNFRSF1B (Homo sapiens) 6480464 Antimony Sodium Gluconate results in decreased expression of TNFRSF1B protein CTD PMID:7844400 Tnfrsf1b Rat streptozocin multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 TNF protein inhibits the reaction [Streptozocin results in increased expression of TNFRSF1B mRNA] CTD PMID:20446767 Tnfrsf1b Rat streptozocin increases expression ISO Tnfrsf1b (Mus musculus) 6480464 Streptozocin results in increased expression of TNFRSF1B mRNA CTD PMID:20446767 Tnfrsf1b Rat succimer multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of TNFRSF1B mRNA CTD PMID:21641980 Tnfrsf1b Rat sulfur dioxide multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Sulfur Dioxide] which results in decreased expression of TNFRSF1B mRNA CTD PMID:32248990 Tnfrsf1b Rat temozolomide decreases expression ISO TNFRSF1B (Homo sapiens) 6480464 Temozolomide results in decreased expression of TNFRSF1B mRNA CTD PMID:31758290 Tnfrsf1b Rat terameprocol multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 terameprocol inhibits the reaction [Lipopolysaccharides results in increased expression of TNFRSF1B protein] CTD PMID:19133137 Tnfrsf1b Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of TNFRSF1B mRNA CTD PMID:32741896 Tnfrsf1b Rat tetrachloromethane affects expression ISO Tnfrsf1b (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of TNFRSF1B mRNA CTD PMID:17484886 Tnfrsf1b Rat tetrachloromethane increases expression ISO Tnfrsf1b (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of TNFRSF1B protein CTD PMID:29987408 Tnfrsf1b Rat tetrachloromethane multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 PANX1 protein affects the reaction [Carbon Tetrachloride results in increased expression of TNFRSF1B protein] CTD PMID:29987408 Tnfrsf1b Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of TNFRSF1B protein CTD PMID:24389507 Tnfrsf1b Rat tetrachloromethane decreases response to substance ISO Tnfrsf1b (Mus musculus) 6480464 TNFRSF1B gene mutant form results in decreased susceptibility to Carbon Tetrachloride CTD PMID:15760680 Tnfrsf1b Rat thalidomide decreases expression ISO TNFRSF1B (Homo sapiens) 6480464 Thalidomide results in decreased expression of TNFRSF1B mRNA CTD PMID:15618473 Tnfrsf1b Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of TNFRSF1B mRNA CTD PMID:34492290 Tnfrsf1b Rat titanium dioxide increases expression ISO Tnfrsf1b (Mus musculus) 6480464 titanium dioxide results in increased expression of TNFRSF1B mRNA CTD PMID:23557971 Tnfrsf1b Rat titanium dioxide decreases methylation ISO Tnfrsf1b (Mus musculus) 6480464 titanium dioxide results in decreased methylation of TNFRSF1B gene CTD PMID:35295148 Tnfrsf1b Rat TMC-120A decreases expression ISO Tnfrsf1b (Mus musculus) 6480464 TMC 120A results in decreased expression of TNFRSF1B mRNA CTD PMID:19818335 Tnfrsf1b Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of TNFRSF1B mRNA CTD PMID:33387578 Tnfrsf1b Rat trichloroethene multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 [Trichloroethylene co-treated with GNLY protein] results in increased expression of TNFRSF1B protein CTD PMID:38485042 Tnfrsf1b Rat triphenyl phosphate affects expression ISO TNFRSF1B (Homo sapiens) 6480464 triphenyl phosphate affects the expression of TNFRSF1B mRNA CTD PMID:37042841 Tnfrsf1b Rat uranium atom affects expression ISO TNFRSF1B (Homo sapiens) 6480464 Uranium affects the expression of TNFRSF1B mRNA CTD PMID:15672453 Tnfrsf1b Rat valproic acid affects expression ISO TNFRSF1B (Homo sapiens) 6480464 Valproic Acid affects the expression of TNFRSF1B mRNA CTD PMID:25979313 Tnfrsf1b Rat valproic acid increases expression ISO TNFRSF1B (Homo sapiens) 6480464 Valproic Acid results in increased expression of TNFRSF1B mRNA CTD PMID:28001369 and PMID:29154799 Tnfrsf1b Rat vemurafenib multiple interactions ISO TNFRSF1B (Homo sapiens) 6480464 [(+)-JQ1 compound co-treated with vemurafenib] results in increased expression of TNFRSF1B protein CTD PMID:27169980 Tnfrsf1b Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of TNFRSF1B mRNA CTD PMID:18629315 Tnfrsf1b Rat WR-1065 multiple interactions ISO Tnfrsf1b (Mus musculus) 6480464 [TNFRSF1A protein co-treated with TNFRSF1B protein] affects the reaction [N-(2-mercaptoethyl)-1 and 3-diaminopropane results in increased activity of SOD2] CTD PMID:21945096 Tnfrsf1b Rat zoledronic acid increases expression ISO TNFRSF1B (Homo sapiens) 6480464 zoledronic acid results in increased expression of TNFRSF1B mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP) 1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2-amino-2-deoxy-D-glucopyranose (ISO) 2-butoxyethanol (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 4-tert-butylphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) aflatoxin B1 (ISO) Aflatoxin G1 (ISO) aldehydo-D-glucosamine (ISO) alfacalcidol (ISO) Aloe emodin (ISO) alpha-naphthoflavone (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) aripiprazole (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (EXP,ISO) asbestos (ISO) bathocuproine disulfonic acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzoates (ISO) beta-D-glucosamine (ISO) beta-lapachone (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bleomycin A2 (EXP,ISO) Brevianamide A (ISO) cadmium atom (ISO) cadmium dichloride (ISO) carbon monoxide (ISO) carbon nanotube (ISO) chloroquine (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) cocaine (ISO) Cuprizon (EXP) curcumin (ISO) DDE (EXP) dexamethasone (ISO) dextran (ISO) dextran sulfate (ISO) diarsenic trioxide (EXP,ISO) dichromium trioxide (ISO) doxorubicin (EXP,ISO) epoxiconazole (ISO) ethanol (ISO) ethylparaben (ISO) fluoranthene (ISO) furosemide (EXP) Fusarenone X (ISO) gefitinib (ISO) glyphosate (EXP) Heliotrine (EXP) hopane (ISO) hydrogen peroxide (ISO) hydroquinone (ISO) indole-3-methanol (EXP) inulin (ISO) ionomycin (ISO) ketoconazole (EXP,ISO) lead diacetate (ISO) lead nitrate (ISO) lead(0) (ISO) lenalidomide (ISO) lipopolysaccharide (ISO) melatonin (ISO) methyl methanesulfonate (ISO) Mitotane (EXP) monosodium L-glutamate (ISO) mycophenolic acid (ISO) N-acetyl-L-cysteine (EXP) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) nevirapine (ISO) nickel atom (ISO) nickel sulfate (ISO) nitrogen dioxide (ISO) obeticholic acid (ISO) octreotide (EXP) oleanolic acid (ISO) osthole (ISO) oxidopamine (ISO) ozone (ISO) p-menthan-3-ol (ISO) paracetamol (ISO) paraquat (ISO) pentachlorophenol (ISO) perfluorodecanoic acid (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluoroundecanoic acid (ISO) phorbol 13-acetate 12-myristate (ISO) pioglitazone (ISO) pirinixic acid (ISO) pregnenolone 16alpha-carbonitrile (ISO) prenyl diphosphate (ISO) procyanidin B3 (ISO) progesterone (ISO) pyrrolidine dithiocarbamate (ISO) quercetin (ISO) quercitrin (ISO) resveratrol (ISO) sanguinarine (ISO) SB 203580 (ISO) senecionine (EXP) serpentine asbestos (ISO) simvastatin (ISO) sodium arsenite (ISO) sodium stibogluconate (ISO) streptozocin (ISO) succimer (ISO) sulfur dioxide (ISO) temozolomide (ISO) terameprocol (ISO) testosterone (EXP) tetrachloromethane (EXP,ISO) thalidomide (ISO) thioacetamide (EXP) titanium dioxide (ISO) TMC-120A (ISO) trichloroethene (EXP,ISO) triphenyl phosphate (ISO) uranium atom (ISO) valproic acid (ISO) vemurafenib (ISO) vinclozolin (EXP) WR-1065 (ISO) zoledronic acid (ISO)
1.
Correlation between serum levels of soluble tumor necrosis factor receptor and disease activity in systemic lupus erythematosus.
Aderka D, etal., Arthritis Rheum. 1993 Aug;36(8):1111-20.
2.
Increased serum levels of soluble receptors for tumor necrosis factor in cancer patients.
Aderka D, etal., Cancer Res. 1991 Oct 15;51(20):5602-7.
3.
Tumor necrosis factor receptor expression and signaling in renal cell carcinoma.
Al-Lamki RS, etal., Am J Pathol. 2010 Aug;177(2):943-54. doi: 10.2353/ajpath.2010.091218. Epub 2010 Jun 21.
4.
The thalidomide analgesic effect is associated with differential TNF-alpha receptor expression in the dorsal horn of the spinal cord as studied in a rat model of neuropathic pain.
Andrade P, etal., Brain Res. 2012 Apr 23;1450:24-32. doi: 10.1016/j.brainres.2012.02.033. Epub 2012 Feb 22.
5.
Tumor necrosis factor-alpha modulates the expression of its p60 receptor and several cytokines in rat tracheal epithelial cells.
Bader T and Nettesheim P, J Immunol 1996 Oct 1;157(7):3089-96.
6.
Anti-tumor necrosis factor alpha treatment of interferon-alpha-induced murine lupus nephritis reduces the renal macrophage response but does not alter glomerular immune complex formation.
Bethunaickan R, etal., Arthritis Rheum. 2012 Oct;64(10):3399-408. doi: 10.1002/art.34553.
7.
Fatigue and proinflammatory cytokine activity in breast cancer survivors.
Bower JE, etal., Psychosom Med. 2002 Jul-Aug;64(4):604-11.
8.
TNFR2 interposes the proliferative and NF-kappaB-mediated inflammatory response by podocytes to TNF-alpha.
Bruggeman LA, etal., Lab Invest. 2011 Mar;91(3):413-25. doi: 10.1038/labinvest.2010.199. Epub 2011 Jan 10.
9.
The levels of nitric oxide and asymmetric dimethylarginine in the rat endometriosis model.
Cayci T, etal., J Obstet Gynaecol Res. 2011 Apr 12. doi: 10.1111/j.1447-0756.2010.01482.x.
10.
Expression of tumour necrosis factor receptors by bronchoalveolar cells in hypersensitivity pneumonitis.
Chen B, etal., Eur Respir J. 2005 Jun;25(6):1039-43.
11.
The effect of intra-articular injection of different concentrations of ozone on the level of TNF-alpha, TNF-R1, and TNF-R2 in rats with rheumatoid arthritis.
Chen H, etal., Rheumatol Int. 2013 May;33(5):1223-7. doi: 10.1007/s00296-012-2529-7. Epub 2012 Oct 2.
12.
Tumor Necrosis Factor-Alpha Antagonist Reduces Apoptosis of Neurons and Oligodendroglia in Rat Spinal Cord Injury.
Chen KB, etal., Spine (Phila Pa 1976). 2011 Jan 8.
13.
Differential activation of tumor necrosis factor receptors distinguishes between brains from Alzheimer's disease and non-demented patients.
Cheng X, etal., J Alzheimers Dis. 2010;19(2):621-30. doi: 10.3233/JAD-2010-1253.
14.
Ozone-induced lung inflammation and hyperreactivity are mediated via tumor necrosis factor-alpha receptors.
Cho HY, etal., Am J Physiol Lung Cell Mol Physiol. 2001 Mar;280(3):L537-46.
15.
Endogenous tumor necrosis factor alpha (TNFalpha) requires TNF receptor type 2 to generate heat hyperalgesia in a mouse cancer model.
Constantin CE, etal., J Neurosci. 2008 May 7;28(19):5072-81.
16.
Circulating levels of TNF-alpha and its soluble receptors in the plasma of patients with epithelial ovarian cancer.
Dobrzycka B, etal., Eur Cytokine Netw. 2009 Sep;20(3):131-4.
17.
Sources of alveolar soluble TNF receptors during acute lung injury of different etiologies.
Dorr AD, etal., J Appl Physiol. 2011 Apr 21.
18.
Efficacy of etanercept on rheumatic signs and pulmonary function tests in advanced ankylosing spondylitis: results of a randomised double-blind placebo-controlled study (SPINE).
Dougados M, etal., Ann Rheum Dis. 2011 May;70(5):799-804. Epub 2011 Feb 13.
19.
Bronchospasm associated with anti-TNF treatment.
Dubey S, etal., Clin Rheumatol. 2009 Aug;28(8):989-92. Epub 2009 Apr 2.
20.
Lipopolysaccharide signaling in the carotid chemoreceptor pathway of rats with sepsis syndrome.
Fernandez R, etal., Respir Physiol Neurobiol. 2011 Mar 15;175(3):336-48. Epub 2010 Dec 30.
21.
TNF receptor 1 and 2 contribute in different ways to resistance to Legionella pneumophila-induced mortality in mice.
Fujita M, etal., Cytokine. 2008 Nov;44(2):298-303. Epub 2008 Oct 5.
22.
Serum levels of soluble receptors for tumor necrosis factor (p55 and p75 sTNFr) in endometrial cancer.
Gadducci A, etal., Anticancer Res. 1996 Sep-Oct;16(5B):3125-8.
23.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
24.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
25.
Circulating TNF receptors 1 and 2 predict stage 3 CKD in type 1 diabetes.
Gohda T, etal., J Am Soc Nephrol. 2012 Mar;23(3):516-24. doi: 10.1681/ASN.2011060628. Epub 2012 Jan 19.
26.
Circulating TNF-alpha and its soluble receptors during experimental acute pancreatitis.
Granell S, etal., Cytokine. 2004 Feb 21;25(4):187-91.
27.
Role of TNFR1 and TNFR2 receptors in tubulointerstitial fibrosis of obstructive nephropathy.
Guo G, etal., Am J Physiol. 1999 Nov;277(5 Pt 2):F766-72.
28.
Early subcutaneous administration of etanercept (Enbrel) prevents from hyperoxia-induced lung injury.
Guthmann F, etal., Exp Lung Res. 2009 Nov;35(9):770-80.
29.
Changes in cardiac structure in hypertension produced by placental ischemia in pregnant rats: effect of tumor necrosis factor blockade.
Gutkowska J, etal., J Hypertens. 2011 Apr 17.
30.
Methamphetamine-induced dopamine transporter complex formation and dopaminergic deficits: the role of D2 receptor activation.
Hadlock GC, etal., J Pharmacol Exp Ther. 2010 Oct;335(1):207-12. Epub 2010 Jul 9.
31.
The role of TNFalpha in the periaqueductal gray during naloxone-precipitated morphine withdrawal in rats.
Hao S, etal., Neuropsychopharmacology. 2011 Feb;36(3):664-76. Epub 2010 Nov 10.
32.
Expression of tumor necrosis factor receptors on granulocytes in patients with myeloperoxidase anti-neutrophil cytoplasmic autoantibody-associated vasculitis.
Hasegawa M, etal., Nephron Clin Pract. 2009;113(3):c222-33. doi: 10.1159/000235242. Epub 2009 Aug 18.
33.
Genetic variants in inflammation-related genes are associated with radiation-induced toxicity following treatment for non-small cell lung cancer.
Hildebrandt MA, etal., PLoS One. 2010 Aug 25;5(8):e12402.
34.
Upregulation of TNF receptor type 2 in human and experimental renal allograft rejection.
Hoffmann U, etal., Am J Transplant. 2009 Apr;9(4):675-86. doi: 10.1111/j.1600-6143.2008.02536.x. Epub 2008 Mar 2.
35.
Direct application of the tumor necrosis factor-alpha inhibitor, etanercept, into a punctured intervertebral disc decreases calcitonin gene-related peptide expression in rat dorsal root ganglion neurons.
Horii M, etal., Spine (Phila Pa 1976). 2011 Jan 15;36(2):E80-5.
36.
Vesicular monoamine transporter 2 and dopamine transporter are molecular targets of Pitx3 in the ventral midbrain dopamine neurons.
Hwang DY, etal., J Neurochem. 2009 Dec;111(5):1202-12. Epub 2009 Sep 24.
37.
Elevated serum levels of the type I and type II receptors for tumor necrosis factor-alpha as predictive factors for ARF in patients with septic shock.
Iglesias J, etal., Am J Kidney Dis. 2003 Jan;41(1):62-75.
38.
Tumor necrosis factor alpha pathways develops liver apoptosis in type 1 diabetes mellitus.
Ingaramo PI, etal., Mol Immunol. 2011 Apr 8.
39.
Differences between tumor necrosis factor-alpha receptors types 1 and 2 in the modulation of spinal glial cell activation and mechanical allodynia in a rat sciatic nerve injury model.
Ishikawa T, etal., Spine (Phila Pa 1976). 2013 Jan 1;38(1):11-6. doi: 10.1097/BRS.0b013e3182610fa9.
40.
Regression of endometrial autografts in a rat model of endometriosis treated with etanercept.
Islimye M, etal., Eur J Obstet Gynecol Reprod Biol. 2011 Nov;159(1):184-9. doi: 10.1016/j.ejogrb.2011.06.029. Epub 2011 Jul 7.
41.
Elevated CSF levels of TACE activity and soluble TNF receptors in subjects with mild cognitive impairment and patients with Alzheimer's disease.
Jiang H, etal., Mol Neurodegener. 2011 Oct 6;6:69. doi: 10.1186/1750-1326-6-69.
42.
TNF-alpha in hypothalamic paraventricular nucleus contributes to sympathoexcitation in heart failure by modulating AT1 receptor and neurotransmitters.
Kang YM, etal., Tohoku J Exp Med. 2010;222(4):251-63.
43.
Serum cytokine profile in patients with active lupus nephritis.
Koenig KF, etal., Cytokine. 2012 Nov;60(2):410-6. doi: 10.1016/j.cyto.2012.07.004. Epub 2012 Jul 28.
44.
Roles of TNF-alpha and its receptors in the beneficial effects of vagal stimulation after myocardial infarction in rats.
Kong SS, etal., Clin Exp Pharmacol Physiol. 2011 Mar 1. doi: 10.1111/j.1440-1681.2011.05505.x.
45.
The association of serum lipids and inflammatory biomarkers with renal function in men with type II diabetes mellitus.
Lin J, etal., Kidney Int. 2006 Jan;69(2):336-42.
46.
Predictive and pathogenetic value of plasma biomarkers for acute kidney injury in patients with acute lung injury.
Liu KD, etal., Crit Care Med. 2007 Dec;35(12):2755-61.
47.
Inflammatory profile and response to anti-TNF therapy in patients with chronic pulmonary sarcoidosis.
Loza MJ, etal., Clin Vaccine Immunol. 2011 Apr 20.
48.
Treatment of experimental adjuvant arthritis with a novel folate receptor-targeted folic acid-aminopterin conjugate.
Lu Y, etal., Arthritis Res Ther. 2011 Apr 4;13(2):R56.
49.
Induction of tumor necrosis factor receptor type 2 gene expression by tumor necrosis factor-alpha in rat primary astrocytes.
Lung HL, etal., Life Sci. 2001 Mar 23;68(18):2081-91.
50.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
51.
Decrease in tumor necrosis factor-alpha receptor-associated death domain results from ubiquitin-dependent degradation in obstructive renal injury in rats.
Misaki T, etal., Am J Pathol. 2009 Jul;175(1):74-83. doi: 10.2353/ajpath.2009.080884. Epub 2009 Jun 18.
52.
A functional haplotype in the 3'untranslated region of TNFRSF1B is associated with tuberculosis in two African populations.
Moller M, etal., Am J Respir Crit Care Med. 2010 Feb 15;181(4):388-93. Epub 2009 Dec 10.
53.
Tumor necrosis factor-alpha mediates photoreceptor death in a rodent model of retinal detachment.
Nakazawa T, etal., Invest Ophthalmol Vis Sci. 2011 Mar 14;52(3):1384-91. Print 2011 Mar.
54.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
55.
Lack of soluble tumor necrosis factor alpha receptor 1 and 2 and interleukin-1beta compartmentalization in lungs of mice after a single intratracheal inoculation with live Porphyromonas gingivalis.
Nemec A, etal., Exp Lung Res. 2009 Sep;35(7):605-20.
56.
Serum concentrations of markers of TNFalpha and Fas-mediated pathways and renal function in nonproteinuric patients with type 1 diabetes.
Niewczas MA, etal., Clin J Am Soc Nephrol. 2009 Jan;4(1):62-70. Epub 2008 Dec 10.
57.
Circulating TNF receptors 1 and 2 predict ESRD in type 2 diabetes.
Niewczas MA, etal., J Am Soc Nephrol. 2012 Mar;23(3):507-15. doi: 10.1681/ASN.2011060627. Epub 2012 Jan 19.
58.
Effect of endotoxin on expression of TNF receptors and transport of TNF-alpha at the blood-brain barrier of the rat.
Osburg B, etal., Am J Physiol Endocrinol Metab 2002 Nov;283(5):E899-908.
59.
Mechanisms of immune complex-mediated experimental glomerulonephritis: possible role of the balance between endogenous TNF and soluble TNF receptor type 2.
Pfeifer E, etal., Eur Cytokine Netw. 2012 Mar 1;23(1):15-20. doi: 10.1684/ecn.2012.0299.
60.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
61.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
62.
MicroRNA Expression in Induced Sputum of Smokers and Patients with Chronic Obstructive Pulmonary Disease.
Pottelberge GR, etal., Am J Respir Crit Care Med. 2011 Apr 1;183(7):898-906. Epub 2010 Oct 29.
63.
TNFR2-mediated apoptosis and necrosis in cisplatin-induced acute renal failure.
Ramesh G and Reeves WB, Am J Physiol Renal Physiol. 2003 Oct;285(4):F610-8. Epub 2003 Jul 15.
64.
Spontaneous pregnancy loss mediated by abnormal maternal inflammation in rats is linked to deficient uteroplacental perfusion.
Renaud SJ, etal., J Immunol. 2011 Feb 1;186(3):1799-808. Epub 2010 Dec 27.
65.
GOA pipeline
RGD automated data pipeline
66.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
67.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
68.
Enzymatic-nonenzymatic cellular antioxidant defense systems response and immunohistochemical detection of MDMA, VMAT2, HSP70, and apoptosis as biomarkers for MDMA (Ecstasy) neurotoxicity.
Riezzo I, etal., J Neurosci Res. 2010 Mar;88(4):905-16.
69.
Quantification of the mRNA encoding Tumor Necrosis Factor alpha (TNFalpha) and its receptors in human nasal polyps.
Rostkowska-Nadolska B, etal., Adv Med Sci. 2008;53(2):263-9.
70.
Imbalances in serum proinflammatory cytokines and their soluble receptors: a putative role in the progression of idiopathic IgA nephropathy (IgAN) and Henoch-Schonlein purpura nephritis, and a potential target of immunoglobulin therapy?
Rostoker G, etal., Clin Exp Immunol. 1998 Dec;114(3):468-76.
71.
Plasma concentrations of TNF-alpha and its soluble receptors sTNFR1 and sTNFR2 in patients with coronary artery disease.
Safranow K, etal., Tissue Antigens. 2009 Nov;74(5):386-92.
72.
Inhibition of soluble tumor necrosis factor ameliorates synaptic alterations and Ca2+ dysregulation in aged rats.
Sama DM, etal., PLoS One. 2012;7(5):e38170. doi: 10.1371/journal.pone.0038170. Epub 2012 May 29.
73.
Etanercept restores the antinociceptive effect of morphine and suppresses spinal neuroinflammation in morphine-tolerant rats.
Shen CH, etal., Anesth Analg. 2011 Feb;112(2):454-9. Epub 2010 Nov 16.
74.
Moxibustion treatment restoring the intestinal epithelium barrier in rats with Crohn's disease by down-regulating tumor necrosis factor alpha, tumor necrosis factor receptor 1, and tumor necrosis factor receptor 2.
Shi Y, etal., Chin J Integr Med. 2011 Mar;17(3):212-7. Epub 2011 Feb 27.
75.
Elevation of serum soluble tumour necrosis factor receptors in patients with polymyositis and dermatomyositis.
Shimizu T, etal., Clin Rheumatol. 2000;19(5):352-9.
76.
Axonal transport of TNF-alpha in painful neuropathy: distribution of ligand tracer and TNF receptors.
Shubayev VI and Myers RR, J Neuroimmunol. 2001 Mar 1;114(1-2):48-56.
77.
TNF-alpha type 2 receptor mediates renal inflammatory response to chronic angiotensin II administration with high salt intake in mice.
Singh P, etal., Am J Physiol Renal Physiol. 2013 Apr 1;304(7):F991-9. doi: 10.1152/ajprenal.00525.2012. Epub 2013 Feb 6.
78.
Increased expression of tumor necrosis factor-alpha receptors in the brains of patients with AIDS.
Sippy BD, etal., J Acquir Immune Defic Syndr Hum Retrovirol. 1995 Dec 15;10(5):511-21.
79.
[Interleukin-6, tumor necrosis factor alpha and their soluble receptors in Bence-Jones nephropathy. Possible role in pathogenesis andthe importance in the determination of prognosis in renal insufficiency].
Spicka I, etal., Cas Lek Cesk. 1998 May 4;137(9):267-70.
80.
Requirement for tumor necrosis factor receptor 2 expression on vascular cells to induce experimental cerebral malaria.
Stoelcker B, etal., Infect Immun. 2002 Oct;70(10):5857-9.
81.
Role of TNFR1 in lung injury and altered lung function induced by the model sulfur mustard vesicant, 2-chloroethyl ethyl sulfide.
Sunil VR, etal., Toxicol Appl Pharmacol. 2011 Feb 1;250(3):245-55. Epub 2010 Nov 9.
82.
Association study of tumor necrosis factor receptor type 2 M196R and toll-like receptor 2 Arg753Gln polymorphisms with acne vulgaris in a Chinese Han ethnic group.
Tian LM, etal., Dermatology. 2010;221(3):276-84. doi: 10.1159/000319851.
83.
Analysis of the association of HLA-DRB1, TNFalpha promoter and TNFR2 (TNFRSF1B) polymorphisms with SLE using transmission disequilibrium test.
Tsuchiya N, etal., Genes Immun. 2001 Oct;2(6):317-22.
84.
Segregation of the classical transmitters norepinephrine and acetylcholine and the neuropeptide Y in sympathetic neurons: modulation by ciliary neurotrophic factor or prolonged growth in culture.
Vega A, etal., Dev Neurobiol. 2010 Dec;70(14):913-28. doi: 10.1002/dneu.20834.
85.
Renal cell-expressed TNF receptor 2, not receptor 1, is essential for the development of glomerulonephritis.
Vielhauer V, etal., J Clin Invest. 2005 May;115(5):1199-209. Epub 2005 Apr 1.
86.
Tumor necrosis factor signaling.
Wajant H, etal., Cell Death Differ. 2003 Jan;10(1):45-65.
87.
Opposing actions of hippocampus TNFalpha receptors on limbic seizure susceptibility.
Weinberg MS, etal., Exp Neurol. 2013 Jan 16. pii: S0014-4886(13)00024-1. doi: 10.1016/j.expneurol.2013.01.011.
88.
Robust and comprehensive analysis of 20 osteoporosis candidate genes by very high-density single-nucleotide polymorphism screen among 405 white nuclear families identified significant association and gene-gene interaction.
Xiong DH, etal., J Bone Miner Res. 2006 Nov;21(11):1678-95.
89.
Expression of the type 1 and type 2 receptors for tumor necrosis factor after traumatic spinal cord injury in adult rats.
Yan P, etal., Exp Neurol 2003 Oct;183(2):286-97.
90.
The impact of soluble tumor necrosis factor receptor etanercept on the treatment of idiopathic pneumonia syndrome after allogeneic hematopoietic stem cell transplantation.
Yanik GA, etal., Blood. 2008 Oct 15;112(8):3073-81. Epub 2008 Jul 29.
91.
Increased expression of tumor necrosis factor receptors in cryptogenic organizing pneumonia.
Ye Q, etal., Respir Med. 2011 Feb;105(2):292-7. Epub 2010 Dec 8.
92.
[Effect of intra-articular ozone injection on serum and synovial TNF-alpha, TNFR I, and TNFR II contents in rats with rheumatoid arthritis].
Yu B, etal., Nan Fang Yi Ke Da Xue Xue Bao. 2011 Jun;31(6):1055-8.
93.
Tumor necrosis factor-alpha induces sensitization of meningeal nociceptors mediated via local COX and p38 MAP kinase actions.
Zhang XC, etal., Pain. 2011 Jan;152(1):140-9. Epub 2010 Oct 30.
94.
Neuroprotection with a brain-penetrating biologic tumor necrosis factor inhibitor.
Zhou QH, etal., J Pharmacol Exp Ther. 2011 Nov;339(2):618-23. doi: 10.1124/jpet.111.185876. Epub 2011 Aug 10.
95.
Predictive value of conjointly examined IL-1ra, TNF-R I, TNF-R II, and RANTES in patients with primary glomerulonephritis.
Zwiech R J Korean Med Sci. 2013 Feb;28(2):261-7. doi: 10.3346/jkms.2013.28.2.261. Epub 2013 Jan 29.
96.
[Prognostic values of serum concentration and urinary excretion of interleukin-1 receptor antagonist and tumor necrosis factor receptors type I and II in patients with IGA nephropathy].
Zwiech R, etal., Pol Arch Med Wewn. 2005 Apr;113(4):326-33.
Tnfrsf1b (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 162,356,250 - 162,387,411 (-) NCBI GRCr8 mRatBN7.2 5 157,070,642 - 157,104,216 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 157,070,642 - 157,104,206 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 159,775,748 - 159,806,642 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 161,549,033 - 161,579,923 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 161,505,389 - 161,536,279 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 163,136,390 - 163,167,299 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 163,136,390 - 163,167,299 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 166,815,372 - 166,845,910 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 163,666,541 - 163,697,484 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 163,674,328 - 163,707,672 (-) NCBI Celera 5 155,362,574 - 155,393,443 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
TNFRSF1B (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 12,166,991 - 12,209,220 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 12,166,991 - 12,209,228 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 12,227,048 - 12,269,277 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 12,149,647 - 12,191,864 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 12,161,325 - 12,203,542 NCBI Celera 1 11,340,352 - 11,382,470 (+) NCBI Celera Cytogenetic Map 1 p36.22 NCBI HuRef 1 11,380,310 - 11,422,542 (+) NCBI HuRef CHM1_1 1 12,214,947 - 12,257,256 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 11,711,114 - 11,753,352 (+) NCBI T2T-CHM13v2.0
Tnfrsf1b (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 144,938,938 - 144,973,453 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 144,940,033 - 144,973,440 (-) Ensembl GRCm39 Ensembl GRCm38 4 145,212,368 - 145,246,870 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 145,213,463 - 145,246,870 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 144,802,271 - 144,836,773 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 144,479,055 - 144,513,557 (-) NCBI MGSCv36 mm8 Celera 4 146,801,795 - 146,837,140 (-) NCBI Celera Cytogenetic Map 4 E1 NCBI cM Map 4 78.17 NCBI
Tnfrsf1b (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955486 1,792,115 - 1,818,362 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955486 1,790,531 - 1,817,986 (-) NCBI ChiLan1.0 ChiLan1.0
TNFRSF1B (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 216,028,254 - 216,070,267 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 214,675,232 - 214,717,231 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 10,915,743 - 10,957,765 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 12,130,663 - 12,172,646 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 12,130,663 - 12,172,646 (+) Ensembl panpan1.1 panPan2
TNFRSF1B (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 84,140,179 - 84,151,219 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 84,141,911 - 84,157,191 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 80,674,178 - 80,701,012 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 84,802,376 - 84,828,308 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 84,801,328 - 84,828,324 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 81,551,315 - 81,578,384 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 82,551,181 - 82,578,413 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 83,616,667 - 83,643,630 (-) NCBI UU_Cfam_GSD_1.0
Tnfrsf1b (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
TNFRSF1B (Sus scrofa - pig)
TNFRSF1B (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 119,590,621 - 119,633,562 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 119,590,325 - 119,633,497 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 23,447,248 - 23,490,475 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tnfrsf1b (Heterocephalus glaber - naked mole-rat)
.
Assembly: mRatBN7.2
Assembly: RGSC_v3.4
Assembly: Rnor_5.0
Assembly: Rnor_6.0
Predicted Target Of
Count of predictions: 530 Count of miRNA genes: 258 Interacting mature miRNAs: 340 Transcripts: ENSRNOT00000022478 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 2302369 Scl60 Serum cholesterol level QTL 60 3.13 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 143608201 161165651 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 1300119 Bp180 Blood pressure QTL 180 3.82 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 144358090 157869054 Rat 1549904 Neuinf1 Neuroinflammation QTL 1 3 0 nervous system integrity trait (VT:0010566) blood T lymphocyte count (CMO:0000110) 5 154828214 166875058 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 1354631 Swd2 Spike wave discharge measurement QTL 2 3.64 0.0002 brain electrophysiology trait (VT:0010557) brain total spike-and-wave discharge duration (CMO:0001740) 5 151113452 164465185 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631263 Cm24 Cardiac mass QTL 24 3.5 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 5 143799107 158428037 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat 631272 Lanf1 Left ventricular atrial natriuretic factor QTL 1 12 heart left ventricle natriuretic peptide A amount (VT:0010596) heart left ventricle natriuretic peptide A level (CMO:0002165) 5 151113452 166875058 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 2313096 Bmd78 Bone mineral density QTL 78 3.1 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 5 144377876 161317411 Rat 1298090 Bp155 Blood pressure QTL 155 3.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 151006154 161165494 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat
AU048745
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 5 q32 UniSTS Cytogenetic Map 13 q24 UniSTS Cytogenetic Map 6 q32 UniSTS Cytogenetic Map 17 p12 UniSTS Cytogenetic Map 16 p14 UniSTS Cytogenetic Map 13 q26 UniSTS Cytogenetic Map 10 q22 UniSTS Cytogenetic Map 7 q11 UniSTS Cytogenetic Map 8 q24 UniSTS Cytogenetic Map 5 q21 UniSTS Cytogenetic Map 4 q24 UniSTS Cytogenetic Map 2 q11 UniSTS Cytogenetic Map 1 q54 UniSTS Cytogenetic Map 1 q36 UniSTS Cytogenetic Map 18 p11 UniSTS Cytogenetic Map 13 q13 UniSTS Cytogenetic Map 10 q24 UniSTS Cytogenetic Map 8 q31 UniSTS Cytogenetic Map 3 q21 UniSTS Cytogenetic Map 13 p13 UniSTS Cytogenetic Map 1 q21 UniSTS Cytogenetic Map 11 q23 UniSTS Cytogenetic Map 10 q31 UniSTS Cytogenetic Map 16 q12.2 UniSTS Cytogenetic Map 3 q24 UniSTS Cytogenetic Map 5 q36 UniSTS Cytogenetic Map 3 p13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000022478 ⟹ ENSRNOP00000022478
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 157,070,642 - 157,104,206 (-) Ensembl Rnor_6.0 Ensembl 5 163,136,390 - 163,167,299 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103500 ⟹ ENSRNOP00000094197
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 157,070,642 - 157,087,912 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000119924 ⟹ ENSRNOP00000078858
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 157,070,642 - 157,104,206 (-) Ensembl
RefSeq Acc Id:
NM_130426 ⟹ NP_569110
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 162,356,250 - 162,387,411 (-) NCBI mRatBN7.2 5 157,073,045 - 157,104,206 (-) NCBI Rnor_6.0 5 163,136,390 - 163,167,299 (-) NCBI Rnor_5.0 5 166,815,372 - 166,845,910 (-) NCBI RGSC_v3.4 5 163,666,541 - 163,697,484 (-) RGD Celera 5 155,362,574 - 155,393,443 (-) RGD
Sequence:
AGTCACCAGCTAGAGCGCAGCAGAGGCACGAGAGCTCCAGGCGCAAGAGCGGGAGCTACCGCCGCCCCTATGGCGCCCGCCGCCCTCTGGGTCGCGCTGGTCGTCGAACTGCAGCTGTGGGCCACCGG GCACACAGTGCCCGCCAAGGTTGTCTTGACACCCTACAAGCCAGAACCTGGGAACCAGTGCCAGATCTCACAGGAGTACTATGACAAGAAGGCTCAGATGTGCTGTGCTAAGTGTCCCCCTGGCCAGT ATGCAAAACACTTCTGCAACAAGACTTCAGACACCGTGTGTGCGGACTGTGCGGCAGGCATGTTTACCCAGGTCTGGAACCATCTGCATACATGCCTGAGCTGCAGTTCTTCCTGTAGTGATGACCAG GTGGAGACCCACAACTGCACTAAAAAACAGAACCGAGTGTGTGCTTGCAACGCTGACAGTTACTGTGCCTTGAAATTGCATTCTGGGAACTGTCGACAGTGCATGAAGCTGAGCAAGTGTGGCCCTGG CTTCGGAGTGGCCCGTTCAAGAACCTCAAATGGAAACGTGATATGCAGTGCCTGTGCCCCAGGGACGTTCTCTGACACCACATCATCCACAGATGTGTGCAGGCCCCACCGCATTTGTAGCATCCTGG CTATTCCTGGAAATGCAAGCACAGATGCAGTCTGTGCATCCGAGTCCCCAACTCCAAGCGCTGTTCCAAGGACAATCTACGTATCTCAGCCAGAGCCCACAAGATCCCAGCCCATGGATCAAGAGCCA GGGCCTAGCCAAACTCCACACATCCCTGTGTCCTTGGGTTCAACCCCCATCATTGAACCAAGCATCACGGGTGGCATCTCTCTTCCAATTGGTCTGATCGTTGGACTGACAACTCTGGGTCTGCTGAT GTTAGGACTGGCGAACTGCTTCATCCTGGTGCAGAGGAAAAAGAAGCCCTCCTGCCTACAACGAGAAACCATGGTGCCTCATCTGCCTGATGACAAATCCCAGGATGCAATAGGCCTTGAACAGCAGC ACCTATTGACCACAGCACCCAGTTCCAGCAGCAGCTCCCTGGAGAGCTCAGCCAGCGCTGGGGACAGGAGAGCGCCCCCTGGGGGTCATCCCCAAGCAAGAGTCACAGCGGAGGCCCAAGGGTCTCAG GAAGCCTGTGCCGGCTCCAGGAGTTCAGATTCTTCCCATGGCAGCCACGGGACCCATGTCAACGTCACCTGCATCGTGAACGTCTGTAGCAGCTCTGACCACAGCTCTCAGTGTTCTTCCCAAGCCAG CACCACGGTGGGAGACCCAGATGCTAACCCTTCAGGGTCTCCAAAGGATGAGCAGGTCCCCTTTTCCCAGGAGGAGTGTCCCTCTCAGTCCCAGTGGGAGACCACAGAGACACTGCAGAACCATGACA AGCCCTTTCCCCTTGGTGTGCCTGATGTGGGTATGAAGCCCAACCAACCAGGCTGGTATGACCAGATTGCTGTCAAAGTGCCTTGACCCATGACAGGGGCAACACCCTGTAAAGGGACCCCCCTAGGC CCTGAACCCATGGAACTTCATGACTTTTTCTGAGCCCGTTTCCTTTAGTGGCCTCTACAGTTCCAGTTGCAGGTCAACTGAGGGCTGAGGCAGCTAGAGTGGTCAAAAACAGCCTTGGTGTTTCATGG GGGCAGTCCCAGGAAGCCCTTGTTCTTCTGTGACCCTCTGGATCTCCTGGGTGCTCTGGCTGATTCTTGTTTCTGAAAGGCCCCAGAATTTTCCCTTCTAAGGAGTTAACATCCTCTTCCATATGCTT TGAGAAAGGATAGCACAGCTCTTCAGCGTGAATGCTGACACTGCAGGGCAGTGTCTGAGGTAAGTAGGAGGAAGTAGTCCCCTGGTAGGGCACAGAGGCCCTTCAGATTAGTGCAAGACTCTTAGGAA GAACCCTCTCCCAACACACTGAAATCCTGATGCCCCAACAGGCAGGATTGCTCTGTTGTAGGGTGCTGGGGCTGGGGCTCAGTAGTCCAGTGTGCTTTTTGCCCTGGGTTTGATCCGCAGTACTCAAA AAGTACACAGACAGTAGACAGAGACAGCACAGGCTACCCCCCCTGTGTGGATTTTATCCTCTGCCTTTGACTTTTACTCCAGTGGGCACACAGAAGCCTGGAGCTCCTTCTCCTGGCCTTCTCATGAA CAGTTCCAAGGCCATACCTTCCTTCAGGGAATCTCAGGGACTGTAGAGTTCCCAGGCCCCTGCAGCCACCTGTCTCGTCCTACCTCAGCCTGGAGCACTCTGTCTAATTCCCCAACCACTTGGTACTG TACTCGCTGTGACCCAAGTGCATGTCCGGGTTATGCACTGTGAGTTGGAACAGCCAATGGCGTCAGTTGAAGGGCCCACGCAGAAACAGCTGAAGCCAGCTATTTTGCCAAAGGATTCATGCTTATTT TCTAATCGACCTGCTCCCCTAGCGTGCCTGGAGGGGAAGAGTTCAGGAGACTTCTGAAGACAGAAGAAGTTGAGCCTCAGGTGCTTGGATGCCATGCTCACAGATTCCACAGGATATGAACTTGTTAG AGGAGCCCAGTTGTTACCATGGAGACTTAAAAAGCTCAGCCCTCTGGAATCAAGATATTGGACACTTGGGACAGACTTGTTAGGTCTCTGTAGCATCGGACTGGAGAAGCGAAGGGACACGTCTGCCC CCTGGTGGCCAGTCCTGGGATGGCCTCGGGCCGCCTAGGCAACAAAAAGAATGAATTGGAAAAGACTGCTTCTGGGTGCGGCCTCAGCTCCTGTGCTTGTGTGGATCCCTACATGGTGTGTGTGTGCG TGCTAAGGAGTATTTGTCCTGTATGCTGGACAGAATTCCTGCTTATAAATGCTTTTCGTTGCTGTTTTGCACACTGATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NP_569110 ⟸ NM_130426
- Peptide Label:
precursor
- UniProtKB:
Q5YLP0 (UniProtKB/Swiss-Prot), Q80WY6 (UniProtKB/Swiss-Prot), A6IU15 (UniProtKB/TrEMBL), A0A8I5ZLM8 (UniProtKB/TrEMBL)
- Sequence:
MAPAALWVALVVELQLWATGHTVPAKVVLTPYKPEPGNQCQISQEYYDKKAQMCCAKCPPGQYAKHFCNKTSDTVCADCAAGMFTQVWNHLHTCLSCSSSCSDDQVETHNCTKKQNRVCACNADSYCA LKLHSGNCRQCMKLSKCGPGFGVARSRTSNGNVICSACAPGTFSDTTSSTDVCRPHRICSILAIPGNASTDAVCASESPTPSAVPRTIYVSQPEPTRSQPMDQEPGPSQTPHIPVSLGSTPIIEPSIT GGISLPIGLIVGLTTLGLLMLGLANCFILVQRKKKPSCLQRETMVPHLPDDKSQDAIGLEQQHLLTTAPSSSSSSLESSASAGDRRAPPGGHPQARVTAEAQGSQEACAGSRSSDSSHGSHGTHVNVT CIVNVCSSSDHSSQCSSQASTTVGDPDANPSGSPKDEQVPFSQEECPSQSQWETTETLQNHDKPFPLGVPDVGMKPNQPGWYDQIAVKVP
hide sequence
Ensembl Acc Id:
ENSRNOP00000022478 ⟸ ENSRNOT00000022478
Ensembl Acc Id:
ENSRNOP00000078858 ⟸ ENSRNOT00000119924
Ensembl Acc Id:
ENSRNOP00000094197 ⟸ ENSRNOT00000103500
RGD ID: 13694248
Promoter ID: EPDNEW_R4773
Type: multiple initiation site
Name: Tnfrsf1b_1
Description: TNF receptor superfamily member 1B
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 163,167,299 - 163,167,359 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-07-05
Tnfrsf1b
TNF receptor superfamily member 1B
Tnfrsf1b
tumor necrosis factor receptor superfamily, member 1b
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2004-09-10
Tnfrsf1b
tumor necrosis factor receptor superfamily, member 1b
Symbol and Name status set to approved
1299863
APPROVED
2002-08-07
Tnfrsf1b
tumor necrosis factor receptor superfamily, member 1b
Symbol and Name status set to provisional
70820
PROVISIONAL
Note Type
Note
Reference
gene_function
binds to tumor necrosis factor (TNF)-alpha
628388