Symbol:
Pabpc1
Name:
poly(A) binding protein, cytoplasmic 1
RGD ID:
619838
Description:
Enables mRNA binding activity. Predicted to be involved in positive regulation of viral genome replication and regulation of gene expression. Located in dendrite. Part of protein-containing complex. Orthologous to several human genes including PABPC1 (poly(A) binding protein cytoplasmic 1); PARTICIPATES IN microRNA pathway; translation initiation pathway; mRNA decay pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MGC91496; Pabp; PABP 1; PABP-1; Pabp1; poly(A)-binding protein 1; polyadenylate-binding protein 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PABPC1 (poly(A) binding protein cytoplasmic 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Pabpc1 (poly(A) binding protein, cytoplasmic 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pabpc1 (poly(A) binding protein cytoplasmic 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PABPC1 (poly(A) binding protein cytoplasmic 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PABPC1 (poly(A) binding protein cytoplasmic 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pabpc1 (poly(A) binding protein cytoplasmic 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PABPC1 (poly(A) binding protein cytoplasmic 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PABPC1 (poly(A) binding protein cytoplasmic 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pabpc1 (poly(A) binding protein cytoplasmic 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PABPC3 (poly(A) binding protein cytoplasmic 3) HGNC
OrthoDB, Panther, Treefam
Alliance orthologs 3
Homo sapiens (human):
PABPC3 (poly(A) binding protein cytoplasmic 3)
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Homo sapiens (human):
PABPC1 (poly(A) binding protein cytoplasmic 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Mus musculus (house mouse):
Pabpc1 (poly(A) binding protein, cytoplasmic 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pabpc1a (poly(A) binding protein, cytoplasmic 1a)
Alliance
DIOPT (InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pabpc1b (poly A binding protein, cytoplasmic 1 b)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoInspector|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PAB1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG4612
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
pAbp
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
pab-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
pab-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
pabpc1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Related Pseudogenes:
Pabpc1-ps1
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 69,662,513 - 69,674,806 (-) NCBI GRCr8 mRatBN7.2 7 67,777,438 - 67,789,731 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 67,777,381 - 67,789,744 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 69,665,830 - 69,678,123 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 71,868,434 - 71,880,727 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 71,736,315 - 71,748,608 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 75,409,581 - 75,421,874 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 75,409,581 - 75,422,268 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 75,557,634 - 75,569,927 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 72,116,140 - 72,128,433 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 72,136,510 - 72,149,407 (-) NCBI Celera 7 64,857,404 - 64,869,695 (-) NCBI Celera Cytogenetic Map 7 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pabpc1 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:1349848 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of PABPC1 mRNA CTD PMID:22079256 Pabpc1 Rat (-)-epigallocatechin 3-gallate increases expression ISO RGD:1349848 6480464 epigallocatechin gallate results in increased expression of PABPC1 protein CTD PMID:31195006 Pabpc1 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1552448 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PABPC1 mRNA CTD PMID:36331819 Pabpc1 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO RGD:1552448 6480464 o,p'-DDT results in increased expression of PABPC1 mRNA CTD PMID:24096037 Pabpc1 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression EXP 6480464 o,p'-DDT results in increased expression of PABPC1 mRNA CTD PMID:24096037 Pabpc1 Rat 1,2-dimethylhydrazine increases expression ISO RGD:1552448 6480464 1,2-Dimethylhydrazine results in increased expression of PABPC1 mRNA CTD PMID:22206623 Pabpc1 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1552448 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of PABPC1 mRNA] CTD PMID:22206623 Pabpc1 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:1552448 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PABPC1 mRNA CTD PMID:17942748 Pabpc1 Rat 17alpha-ethynylestradiol increases expression ISO RGD:1552448 6480464 Ethinyl Estradiol results in increased expression of PABPC1 mRNA CTD PMID:17942748|PMID:24096037 Pabpc1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of PABPC1 mRNA CTD PMID:17108234|PMID:24096037 Pabpc1 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one multiple interactions ISO RGD:1349848 6480464 Metribolone promotes the reaction [NDRG1 protein binds to PABPC1 protein] CTD PMID:17220478 Pabpc1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1552448 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PABPC1 mRNA CTD PMID:17942748 Pabpc1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PABPC1 mRNA CTD PMID:34747641 Pabpc1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1552448 6480464 Tetrachlorodibenzodioxin affects the expression of PABPC1 mRNA CTD PMID:21570461|PMID:26377647 Pabpc1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1552448 6480464 Tetrachlorodibenzodioxin results in increased expression of PABPC1 mRNA CTD PMID:18796159 Pabpc1 Rat 2,4,6-tribromophenol decreases expression ISO RGD:1349848 6480464 2,4,6-tribromophenol results in decreased expression of PABPC1 mRNA CTD PMID:31675489 Pabpc1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of PABPC1 mRNA CTD PMID:21346803 Pabpc1 Rat 2-bromohexadecanoic acid multiple interactions ISO RGD:1349848 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 Pabpc1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO RGD:1552448 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of PABPC1 mRNA CTD PMID:20188158 Pabpc1 Rat 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of PABPC1 mRNA CTD PMID:30071829 Pabpc1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin analog results in increased expression of PABPC1 protein CTD PMID:26072098 Pabpc1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1349848 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Pabpc1 Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1349848 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Pabpc1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1349848 6480464 bisphenol S results in increased expression of PABPC1 protein CTD PMID:34186270 Pabpc1 Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:1552448 6480464 Fenretinide results in increased expression of PABPC1 mRNA CTD PMID:28973697 Pabpc1 Rat 4-vinylcyclohexene dioxide affects expression ISO RGD:1552448 6480464 4-vinyl-1-cyclohexene dioxide affects the expression of PABPC1 mRNA CTD PMID:20829426 Pabpc1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PABPC1 mRNA CTD PMID:30047161 Pabpc1 Rat 7,12-dimethyltetraphene affects expression ISO RGD:1552448 6480464 9,10-Dimethyl-1,2-benzanthracene affects the expression of PABPC1 mRNA CTD PMID:21785161 Pabpc1 Rat 7,12-dimethyltetraphene multiple interactions EXP 6480464 [9,10-Dimethyl-1,2-benzanthracene co-treated with Isoflavones] results in increased expression of PABPC1 protein CTD PMID:22248470 Pabpc1 Rat aconitine decreases expression EXP 6480464 Aconitine results in decreased expression of PABPC1 protein CTD PMID:33236894 Pabpc1 Rat acrolein multiple interactions ISO RGD:1349848 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268|PMID:32845096 Pabpc1 Rat alpha-pinene multiple interactions ISO RGD:1349848 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Pabpc1 Rat amino acid decreases expression ISO RGD:1349848 6480464 Amino Acids deficiency results in decreased expression of PABPC1 protein CTD PMID:25940091 Pabpc1 Rat amino acid multiple interactions ISO RGD:1552448 6480464 [EIF2AK4 gene mutant form affects the susceptibility to Amino Acids deficiency] which results in increased more ... CTD PMID:29449374 Pabpc1 Rat amino acid multiple interactions ISO RGD:1349848 6480464 Amino Acids deficiency promotes the reaction [PABPC1 protein binds to LARP1 protein] CTD PMID:25940091 Pabpc1 Rat aristolochic acid A multiple interactions EXP 6480464 [aristolochic acid I co-treated with aristolochic acid II] results in decreased expression of PABPC1 mRNA CTD PMID:23912714 Pabpc1 Rat aristolochic acid A decreases expression ISO RGD:1349848 6480464 aristolochic acid I results in decreased expression of PABPC1 mRNA CTD PMID:33212167 Pabpc1 Rat Aroclor 1254 decreases expression ISO RGD:1552448 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of PABPC1 mRNA CTD PMID:23650126 Pabpc1 Rat arsane affects methylation ISO RGD:1349848 6480464 Arsenic affects the methylation of PABPC1 gene CTD PMID:25304211 Pabpc1 Rat arsenic atom affects methylation ISO RGD:1349848 6480464 Arsenic affects the methylation of PABPC1 gene CTD PMID:25304211 Pabpc1 Rat benzo[a]pyrene decreases expression ISO RGD:1552448 6480464 Benzo(a)pyrene results in decreased expression of PABPC1 mRNA CTD PMID:20504355|PMID:22228805 Pabpc1 Rat benzo[a]pyrene affects expression ISO RGD:1552448 6480464 Benzo(a)pyrene affects the expression of PABPC1 mRNA CTD PMID:22342234 Pabpc1 Rat benzo[a]pyrene increases expression ISO RGD:1552448 6480464 Benzo(a)pyrene results in increased expression of PABPC1 mRNA CTD PMID:22228805 Pabpc1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PABPC1 mRNA CTD PMID:25181051 Pabpc1 Rat bisphenol A decreases expression ISO RGD:1349848 6480464 bisphenol A results in decreased expression of PABPC1 protein CTD PMID:34186270 Pabpc1 Rat bisphenol A decreases expression ISO RGD:1552448 6480464 bisphenol A results in decreased expression of PABPC1 mRNA CTD PMID:33221593 Pabpc1 Rat bisphenol A affects expression ISO RGD:1349848 6480464 bisphenol A affects the expression of PABPC1 mRNA CTD PMID:30903817 Pabpc1 Rat bisphenol A multiple interactions ISO RGD:1349848 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Pabpc1 Rat Bisphenol B increases expression ISO RGD:1349848 6480464 bisphenol B results in increased expression of PABPC1 protein CTD PMID:34186270 Pabpc1 Rat bisphenol F multiple interactions ISO RGD:1349848 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Pabpc1 Rat bisphenol F increases expression ISO RGD:1349848 6480464 bisphenol F results in increased expression of PABPC1 protein CTD PMID:34186270 Pabpc1 Rat bleomycin A2 increases expression EXP 6480464 Bleomycin results in increased expression of PABPC1 protein CTD PMID:25933445 Pabpc1 Rat cadmium atom multiple interactions ISO RGD:1349848 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 Pabpc1 Rat cadmium dichloride multiple interactions ISO RGD:1349848 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 Pabpc1 Rat caffeine decreases phosphorylation ISO RGD:1349848 6480464 Caffeine results in decreased phosphorylation of PABPC1 protein CTD PMID:35688186 Pabpc1 Rat carbon nanotube increases expression ISO RGD:1552448 6480464 Nanotubes, Carbon results in increased expression of PABPC1 mRNA CTD PMID:25620056 Pabpc1 Rat CGP 52608 multiple interactions ISO RGD:1349848 6480464 CGP 52608 promotes the reaction [RORA protein binds to PABPC1 gene] CTD PMID:28238834 Pabpc1 Rat chlordecone increases expression ISO RGD:1552448 6480464 Chlordecone results in increased expression of PABPC1 mRNA CTD PMID:33711761 Pabpc1 Rat chlormequat chloride increases expression EXP 6480464 Chlormequat results in increased expression of PABPC1 protein CTD PMID:34958886 Pabpc1 Rat chloropicrin decreases expression ISO RGD:1349848 6480464 chloropicrin results in decreased expression of PABPC1 mRNA CTD PMID:26352163 Pabpc1 Rat chloroprene decreases expression ISO RGD:1552448 6480464 Chloroprene results in decreased expression of PABPC1 mRNA CTD PMID:23125180 Pabpc1 Rat chlorpyrifos decreases expression ISO RGD:1552448 6480464 Chlorpyrifos results in decreased expression of PABPC1 mRNA CTD PMID:37019170 Pabpc1 Rat choline multiple interactions ISO RGD:1552448 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Pabpc1 Rat cisplatin increases response to substance ISO RGD:1349848 6480464 PABPC1 protein results in increased susceptibility to Cisplatin CTD PMID:21466612 Pabpc1 Rat cisplatin decreases expression ISO RGD:1552448 6480464 Cisplatin results in decreased expression of PABPC1 protein CTD PMID:29733421 Pabpc1 Rat cisplatin decreases expression ISO RGD:1349848 6480464 Cisplatin results in decreased expression of PABPC1 mRNA CTD PMID:27594783 Pabpc1 Rat clobetasol decreases expression ISO RGD:1552448 6480464 Clobetasol results in decreased expression of PABPC1 mRNA CTD PMID:27462272 Pabpc1 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of PABPC1 mRNA CTD PMID:17602206 Pabpc1 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of PABPC1 mRNA CTD PMID:20187946 Pabpc1 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of PABPC1 mRNA CTD PMID:27523638 Pabpc1 Rat cyclosporin A increases expression ISO RGD:1552448 6480464 Cyclosporine results in increased expression of PABPC1 mRNA CTD PMID:19770486 Pabpc1 Rat dexamethasone multiple interactions ISO RGD:1349848 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Pabpc1 Rat Dibutyl phosphate affects expression ISO RGD:1349848 6480464 di-n-butylphosphoric acid affects the expression of PABPC1 mRNA CTD PMID:37042841 Pabpc1 Rat dibutyl phthalate increases expression ISO RGD:1552448 6480464 Dibutyl Phthalate results in increased expression of PABPC1 mRNA CTD PMID:21266533 Pabpc1 Rat dibutyl phthalate affects expression EXP 6480464 Dibutyl Phthalate affects the expression of PABPC1 mRNA CTD PMID:30934153 Pabpc1 Rat dicyclanil increases expression ISO RGD:1552448 6480464 dicyclanil results in increased expression of PABPC1 mRNA CTD PMID:15664270 Pabpc1 Rat disodium selenite increases expression ISO RGD:1349848 6480464 Sodium Selenite results in increased expression of PABPC1 mRNA CTD PMID:18175754 Pabpc1 Rat doxorubicin increases expression ISO RGD:1349848 6480464 Doxorubicin results in increased expression of PABPC1 mRNA CTD PMID:29803840 Pabpc1 Rat enzyme inhibitor multiple interactions ISO RGD:1349848 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Pabpc1 Rat ethanol affects splicing ISO RGD:1552448 6480464 Ethanol affects the splicing of PABPC1 mRNA CTD PMID:30319688 Pabpc1 Rat etoposide decreases expression ISO RGD:1552448 6480464 Etoposide results in decreased expression of PABPC1 protein CTD PMID:29733421 Pabpc1 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of PABPC1 mRNA CTD PMID:18035473 Pabpc1 Rat folic acid multiple interactions ISO RGD:1552448 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992|PMID:22206623 Pabpc1 Rat folic acid decreases expression ISO RGD:1552448 6480464 Folic Acid results in decreased expression of PABPC1 mRNA CTD PMID:25629700 Pabpc1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PABPC1 mRNA CTD PMID:22061828 Pabpc1 Rat glyphosate increases expression ISO RGD:1552448 6480464 Glyphosate results in increased expression of PABPC1 protein CTD PMID:36173347|PMID:37208198 Pabpc1 Rat GSK-J4 increases expression ISO RGD:1349848 6480464 GSK-J4 results in increased expression of PABPC1 mRNA CTD PMID:29301935 Pabpc1 Rat indometacin multiple interactions ISO RGD:1349848 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Pabpc1 Rat isoflavones multiple interactions EXP 6480464 [9,10-Dimethyl-1,2-benzanthracene co-treated with Isoflavones] results in increased expression of PABPC1 protein; [ENNG co-treated with Isoflavones] more ... CTD PMID:22248470 Pabpc1 Rat ivermectin decreases expression ISO RGD:1349848 6480464 Ivermectin results in decreased expression of PABPC1 protein CTD PMID:32959892 Pabpc1 Rat L-methionine multiple interactions ISO RGD:1552448 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Pabpc1 Rat lead(0) affects expression ISO RGD:1349848 6480464 Lead affects the expression of PABPC1 mRNA CTD PMID:28903495 Pabpc1 Rat menadione affects expression ISO RGD:1349848 6480464 Vitamin K 3 affects the expression of PABPC1 mRNA CTD PMID:20044591 Pabpc1 Rat methidathion decreases expression ISO RGD:1552448 6480464 methidathion results in decreased expression of PABPC1 mRNA CTD PMID:34813904 Pabpc1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of PABPC1 mRNA CTD PMID:30047161 Pabpc1 Rat methoxychlor affects expression ISO RGD:1552448 6480464 Methoxychlor affects the expression of PABPC1 mRNA CTD PMID:20829426 Pabpc1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of PABPC1 mRNA CTD PMID:17602206 Pabpc1 Rat ozone multiple interactions ISO RGD:1349848 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268|PMID:32845096 Pabpc1 Rat paracetamol affects expression ISO RGD:1552448 6480464 Acetaminophen affects the expression of PABPC1 mRNA CTD PMID:17562736 Pabpc1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PABPC1 mRNA CTD PMID:33387578 Pabpc1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1552448 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PABPC1 mRNA CTD PMID:36331819 Pabpc1 Rat perfluorooctanoic acid decreases expression ISO RGD:1552448 6480464 perfluorooctanoic acid results in decreased expression of PABPC1 protein CTD PMID:32320774 Pabpc1 Rat potassium chromate increases expression ISO RGD:1349848 6480464 potassium chromate(VI) results in increased expression of PABPC1 mRNA CTD PMID:22079256 Pabpc1 Rat potassium chromate multiple interactions ISO RGD:1349848 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of PABPC1 mRNA CTD PMID:22079256 Pabpc1 Rat pregnenolone 16alpha-carbonitrile increases expression ISO RGD:1552448 6480464 Pregnenolone Carbonitrile results in increased expression of PABPC1 mRNA CTD PMID:28903501 Pabpc1 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of PABPC1 protein CTD PMID:35544339 Pabpc1 Rat senecionine decreases expression ISO RGD:1552448 6480464 senecionine results in decreased expression of PABPC1 protein CTD PMID:35357534 Pabpc1 Rat silicon dioxide decreases expression ISO RGD:1552448 6480464 Silicon Dioxide results in decreased expression of PABPC1 mRNA CTD PMID:19073995 Pabpc1 Rat sirolimus multiple interactions ISO RGD:1349848 6480464 Sirolimus inhibits the reaction [EIF4G1 protein binds to PABPC1 mRNA]; Sirolimus promotes the reaction [LARP1 more ... CTD PMID:25940091 Pabpc1 Rat sirolimus decreases expression ISO RGD:1349848 6480464 Sirolimus results in decreased expression of PABPC1 protein CTD PMID:25940091 Pabpc1 Rat sodium arsenate increases expression ISO RGD:1552448 6480464 sodium arsenate results in increased expression of PABPC1 mRNA CTD PMID:21795629 Pabpc1 Rat sodium arsenite affects localization ISO RGD:1349848 6480464 sodium arsenite affects the localization of PABPC1 protein CTD PMID:16951406 Pabpc1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of PABPC1 mRNA CTD PMID:19281266 Pabpc1 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of PABPC1 mRNA CTD PMID:30047161 Pabpc1 Rat sunitinib increases expression ISO RGD:1349848 6480464 Sunitinib results in increased expression of PABPC1 mRNA CTD PMID:31533062 Pabpc1 Rat tetrachloromethane increases expression ISO RGD:1552448 6480464 Carbon Tetrachloride results in increased expression of PABPC1 mRNA CTD PMID:27339419 Pabpc1 Rat titanium dioxide decreases methylation ISO RGD:1552448 6480464 titanium dioxide results in decreased methylation of PABPC1 gene CTD PMID:35295148 Pabpc1 Rat titanium dioxide increases methylation ISO RGD:1552448 6480464 titanium dioxide results in increased methylation of PABPC1 promoter CTD PMID:35295148 Pabpc1 Rat torin 1 decreases expression ISO RGD:1349848 6480464 1-(4-(4-propionylpiperazin-1-yl)-3-(trifluoromethyl)phenyl)-9-(quinolin-3-yl)benzo(h)(1,6)naphthyridin-2(1H)-one results in decreased expression of PABPC1 protein CTD PMID:25940091 Pabpc1 Rat torin 1 multiple interactions ISO RGD:1349848 6480464 1-(4-(4-propionylpiperazin-1-yl)-3-(trifluoromethyl)phenyl)-9-(quinolin-3-yl)benzo(h)(1,6)naphthyridin-2(1H)-one inhibits the reaction [EIF4G1 protein binds to PABPC1 mRNA]; 1-(4-(4-propionylpiperazin-1-yl)-3-(trifluoromethyl)phenyl)-9-(quinolin-3-yl)benzo(h)(1,6)naphthyridin-2(1H)-one promotes the reaction [LARP1 more ... CTD PMID:25940091 Pabpc1 Rat triadimefon decreases expression EXP 6480464 triadimefon results in decreased expression of PABPC1 mRNA CTD PMID:30047161 Pabpc1 Rat triphenyl phosphate affects expression ISO RGD:1349848 6480464 triphenyl phosphate affects the expression of PABPC1 mRNA CTD PMID:37042841 Pabpc1 Rat tungsten decreases expression ISO RGD:1552448 6480464 Tungsten results in decreased expression of PABPC1 mRNA CTD PMID:30912803 Pabpc1 Rat valproic acid affects expression ISO RGD:1552448 6480464 Valproic Acid affects the expression of PABPC1 mRNA CTD PMID:17292431 Pabpc1 Rat valproic acid decreases expression ISO RGD:1552448 6480464 Valproic Acid results in decreased expression of PABPC1 mRNA CTD PMID:20546886 Pabpc1 Rat valproic acid increases methylation ISO RGD:1349848 6480464 Valproic Acid results in increased methylation of PABPC1 gene CTD PMID:29154799 Pabpc1 Rat vitamin E decreases expression ISO RGD:1349848 6480464 Vitamin E results in decreased expression of PABPC1 mRNA CTD PMID:19244175
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Pabpc1 Rat mRNA 3'-UTR binding enables ISO RGD:1349848 1624291 PMID:16126846 RGD PMID:16126846 Pabpc1 Rat mRNA 3'-UTR binding enables IBA FB:FBgn0264270|FB:FBgn0265297|MGI:2444477|PANTHER:PTN000610044|UniProtKB:P11940|UniProtKB:Q6XE24|WB:WBGene00006331 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Pabpc1 Rat mRNA binding IDA 633375 RGD Pabpc1 Rat mRNA binding enables ISO RGD:1349848 1624291 PMID:23041282 RGD PMID:23041282 Pabpc1 Rat nucleic acid binding enables IEA InterPro:IPR003954|InterPro:IPR035979 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Pabpc1 Rat poly(A) binding enables ISO RGD:1349848 1624291 PMID:16804161, PMID:21984414 RGD PMID:16804161|PMID:21984414 Pabpc1 Rat poly(A) binding enables IBA FB:FBgn0265297|PANTHER:PTN000610044|PomBase:SPAC1610.03c|PomBase:SPAC57A7.04c|SGD:S000000967|TAIR:locus:2013011|UniProtKB:A0A1L8FTJ1|UniProtKB:A0A8J1LXZ9|UniProtKB:P11940|UniProtKB:Q13310|UniProtKB:Q6XE24|UniProtKB:Q9H361 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Pabpc1 Rat poly(A) binding enables ISS UniProtKB:Q9H361 1600115 GO_REF:0000024 UniProt GO_REF:0000024 Pabpc1 Rat poly(U) RNA binding enables ISO RGD:1349848 1624291 PMID:21984414 RGD PMID:21984414 Pabpc1 Rat poly(U) RNA binding enables IBA FB:FBgn0264270|PANTHER:PTN000610044|UniProtKB:P11940|UniProtKB:Q13310|UniProtKB:Q6XE24 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Pabpc1 Rat protein binding enables IPI UniProtKB:P35570 8554563 PMID:23770097 IntAct Pabpc1 Rat protein binding enables ISO RGD:1349848,UniProtKB:P11940-1 1624291 UniProtKB:P10527 PMID:30209168 RGD PMID:30209168 Pabpc1 Rat protein binding enables ISO RGD:1552448 1624291 PR:Q640Q5|PR:Q91YI6|UniProtKB:P86049 PMID:17927953, PMID:18625844, PMID:36001654 RGD PMID:17927953|PMID:18625844|PMID:36001654 Pabpc1 Rat protein binding enables ISO RGD:1349848 1624291 UniProtKB:O00571|UniProtKB:O55778|UniProtKB:O60293|UniProtKB:P05067|UniProtKB:P06730|UniProtKB:P0DTC9|UniProtKB:P14240|UniProtKB:P15130|UniProtKB:P15170|UniProtKB:P15170-2|UniProtKB:P17844|UniProtKB:P19338|UniProtKB:P19712-PRO_0000038050|UniProtKB:P22893|UniProtKB:P26651|UniProtKB:P35568|UniProtKB:P50616|UniProtKB:P62258|UniProtKB:Q04637|UniProtKB:Q09161|UniProtKB:Q13283|UniProtKB:Q14103-4|UniProtKB:Q14106|UniProtKB:Q2Q1W2|UniProtKB:Q58A45|UniProtKB:Q5VWP2|UniProtKB:Q6PKG0|UniProtKB:Q6Y7W6|UniProtKB:Q71RC2|UniProtKB:Q7Z333|UniProtKB:Q86U42|UniProtKB:Q8IYD1|UniProtKB:Q8N8Q3|UniProtKB:Q8NDV7|UniProtKB:Q92615|UniProtKB:Q92900|UniProtKB:Q96Q15|UniProtKB:Q99700|UniProtKB:Q99700-5|UniProtKB:Q9BPZ3|UniProtKB:Q9H074|UniProtKB:Q9HCJ0|UniProtKB:Q9HCJ0-1|UniProtKB:Q9J0X9|UniProtKB:Q9NUL5|UniProtKB:Q9NZI8|UniProtKB:Q9UKV8|UniProtKB:Q9UL18|UniProtKB:Q9ULR5|UniProtKB:Q9UN86|UniProtKB:Q9UPQ9|UniProtKB:Q9Y446 PMID:11051545, PMID:11172725, PMID:11997512, PMID:12086624, PMID:12489690, PMID:14685257, PMID:15567442, PMID:15663938, PMID:16452507, PMID:16556936, PMID:16601676, PMID:16772376, PMID:16804161, more ... RGD PMID:11051545|PMID:11172725|PMID:11997512|PMID:12086624|PMID:12489690|PMID:14685257|PMID:15567442|PMID:15663938|PMID:16452507|PMID:16556936|PMID:16601676|PMID:16772376|PMID:16804161|PMID:17289661|PMID:17392519|PMID:17595167|PMID:17932509|PMID:18256688|PMID:18447585|PMID:18596238|PMID:19515850|PMID:19716330|PMID:20098421|PMID:20181956|PMID:20221403|PMID:20418951|PMID:20430826|PMID:20595389|PMID:20595394|PMID:20696395|PMID:21063388|PMID:21098120|PMID:21883093|PMID:21981923|PMID:22872150|PMID:23125361|PMID:23279204|PMID:23340509|PMID:23665581|PMID:23770097|PMID:23788676|PMID:24396066|PMID:24532714|PMID:24965446|PMID:25220460|PMID:25225333|PMID:26184334|PMID:26735137|PMID:27573237|PMID:27871484|PMID:28733330|PMID:28877994|PMID:28931820|PMID:29261807|PMID:32353859|PMID:32814053|PMID:32960270|PMID:33060197|PMID:33876849|PMID:33961781|PMID:34029587|PMID:34232536|PMID:35044719|PMID:35271311|PMID:35511136|PMID:36217030|PMID:36931259|PMID:37100772 Pabpc1 Rat RNA binding enables IEA UniRule:UR000414619 1600115 GO_REF:0000104 UniProt GO_REF:0000104 Pabpc1 Rat RNA binding enables IEA InterPro:IPR000504|InterPro:IPR006515 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Pabpc1 Rat RNA binding enables IEA InterPro:IPR000504|InterPro:IPR002004|InterPro:IPR036053 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Pabpc1 Rat RNA binding enables ISO RGD:1349848 1624291 RNAcentral:URS000080E35F_32630 PMID:23041282, PMID:25225333 RGD PMID:23041282|PMID:25225333 Pabpc1 Rat RNA binding enables IEA UniProtKB-KW:KW-0694 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Pabpc1 Rat RNA binding enables IEA InterPro:IPR000504|InterPro:IPR002004|InterPro:IPR006515|InterPro:IPR036053 1600115 GO_REF:0000002 InterPro GO_REF:0000002
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP,ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 2-bromohexadecanoic acid (ISO) 3,4-methylenedioxymethamphetamine (EXP,ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 4-vinylcyclohexene dioxide (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (EXP,ISO) aconitine (EXP) acrolein (ISO) alpha-pinene (ISO) amino acid (ISO) aristolochic acid A (EXP,ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (ISO) bleomycin A2 (EXP) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlordecone (ISO) chlormequat chloride (EXP) chloropicrin (ISO) chloroprene (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (ISO) clobetasol (ISO) clofibric acid (EXP) cocaine (EXP) Cuprizon (EXP) cyclosporin A (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dicyclanil (ISO) disodium selenite (ISO) doxorubicin (ISO) enzyme inhibitor (ISO) ethanol (ISO) etoposide (ISO) flavonoids (EXP) folic acid (ISO) gentamycin (EXP) glyphosate (ISO) GSK-J4 (ISO) indometacin (ISO) isoflavones (EXP) ivermectin (ISO) L-methionine (ISO) lead(0) (ISO) menadione (ISO) methidathion (ISO) methimazole (EXP) methoxychlor (ISO) N-nitrosodiethylamine (EXP) ozone (ISO) paracetamol (EXP,ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (ISO) rotenone (EXP) senecionine (ISO) silicon dioxide (ISO) sirolimus (ISO) sodium arsenate (ISO) sodium arsenite (ISO) Soman (EXP) sulfadimethoxine (EXP) sunitinib (ISO) tetrachloromethane (ISO) titanium dioxide (ISO) torin 1 (ISO) triadimefon (EXP) triphenyl phosphate (ISO) tungsten (ISO) valproic acid (ISO) vitamin E (ISO)
Biological Process
biological_process (ND) CRD-mediated mRNA stabilization (ISO) mRNA processing (IEA) negative regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay (ISO) negative regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay (ISO,ISS) nuclear-transcribed mRNA catabolic process, nonsense-mediated decay (IEA) positive regulation of cytoplasmic translation (ISO) positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay (IEA,ISO,ISS) positive regulation of nuclear-transcribed mRNA poly(A) tail shortening (IEA,ISO,ISS) positive regulation of viral genome replication (ISO) regulatory ncRNA-mediated gene silencing (IEA,ISO,ISS) RNA splicing (IEA)
Cellular Component
catalytic step 2 spliceosome (ISO) cell leading edge (ISO,ISS) cell projection (IEA) cytoplasm (IEA,ISO,ISS) cytoplasmic ribonucleoprotein granule (ISO) cytoplasmic stress granule (IBA,IEA,ISO,ISS) cytosol (IBA,ISO) dendrite (IDA) lamellipodium (IEA) mCRD-mediated mRNA stability complex (ISO) nucleus (IBA,IEA,ISO) protein-containing complex (IDA) ribonucleoprotein complex (IBA,ISO,ISS) spliceosomal complex (IEA) synapse (IEA,ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
The mechanism of eukaryotic translation initiation: new insights and challenges.
Hinnebusch AG and Lorsch JR, Cold Spring Harb Perspect Biol. 2012 Oct 1;4(10). pii: a011544. doi: 10.1101/cshperspect.a011544.
4.
The scanning mechanism of eukaryotic translation initiation.
Hinnebusch AG Annu Rev Biochem. 2014;83:779-812. doi: 10.1146/annurev-biochem-060713-035802. Epub 2014 Jan 29.
5.
Molecular composition of staufen2-containing ribonucleoproteins in embryonic rat brain.
Maher-Laporte M, etal., PLoS One. 2010 Jun 28;5(6):e11350. doi: 10.1371/journal.pone.0011350.
6.
Vasopressin mRNA localization in nerve cells: characterization of cis-acting elements and trans-acting factors.
Mohr E, etal., Proc Natl Acad Sci U S A 2001 Jun 19;98(13):7072-9.
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
Insulin receptor substrate-1 (IRS-1) forms a ribonucleoprotein complex associated with polysomes.
Ozoe A, etal., FEBS Lett. 2013 Aug 2;587(15):2319-24. doi: 10.1016/j.febslet.2013.05.066. Epub 2013 Jun 13.
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
GOA pipeline
RGD automated data pipeline
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Comprehensive gene review and curation
RGD comprehensive gene curation
14.
RNA decay machines: deadenylation by the Ccr4-not and Pan2-Pan3 complexes.
Wahle E and Winkler GS, Biochim Biophys Acta. 2013 Jun-Jul;1829(6-7):561-70. doi: 10.1016/j.bbagrm.2013.01.003. Epub 2013 Jan 19.
Pabpc1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 69,662,513 - 69,674,806 (-) NCBI GRCr8 mRatBN7.2 7 67,777,438 - 67,789,731 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 67,777,381 - 67,789,744 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 69,665,830 - 69,678,123 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 71,868,434 - 71,880,727 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 71,736,315 - 71,748,608 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 75,409,581 - 75,421,874 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 75,409,581 - 75,422,268 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 75,557,634 - 75,569,927 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 72,116,140 - 72,128,433 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 72,136,510 - 72,149,407 (-) NCBI Celera 7 64,857,404 - 64,869,695 (-) NCBI Celera Cytogenetic Map 7 q22 NCBI
PABPC1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 100,702,916 - 100,722,088 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 100,685,816 - 100,722,809 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 101,715,144 - 101,734,316 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 101,784,320 - 101,803,491 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 101,784,319 - 101,803,491 NCBI Celera 8 97,900,528 - 97,919,706 (-) NCBI Celera Cytogenetic Map 8 q22.3 NCBI HuRef 8 96,913,861 - 96,933,038 (-) NCBI HuRef CHM1_1 8 101,755,929 - 101,775,103 (-) NCBI CHM1_1 T2T-CHM13v2.0 8 101,828,977 - 101,848,145 (-) NCBI T2T-CHM13v2.0
Pabpc1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 36,595,902 - 36,609,825 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 36,595,905 - 36,609,912 (-) Ensembl GRCm39 Ensembl GRCm38 15 36,595,658 - 36,609,581 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 36,595,661 - 36,609,668 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 36,525,413 - 36,538,728 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 36,540,252 - 36,553,551 (-) NCBI MGSCv36 mm8 Celera 15 37,216,852 - 37,230,173 (-) NCBI Celera Cytogenetic Map 15 B3.1 NCBI cM Map 15 14.51 NCBI
Pabpc1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955417 15,868,934 - 15,885,247 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955417 15,872,906 - 15,885,246 (-) NCBI ChiLan1.0 ChiLan1.0
PABPC1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 118,056,637 - 118,076,633 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 93,592,669 - 93,612,674 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 97,346,433 - 97,365,628 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 99,518,347 - 99,534,284 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 99,518,347 - 99,537,614 (-) Ensembl panpan1.1 panPan2
PABPC1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 2,563,698 - 2,580,610 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 2,564,065 - 2,580,368 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 2,560,662 - 2,577,627 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 2,717,070 - 2,734,072 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 2,687,294 - 2,837,742 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 2,561,235 - 2,578,211 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 2,672,912 - 2,689,894 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 2,690,335 - 2,707,304 (-) NCBI UU_Cfam_GSD_1.0
Pabpc1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 35,202,647 - 35,244,212 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936470 42,628,667 - 42,643,347 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936470 42,628,890 - 42,670,311 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PABPC1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 36,209,164 - 36,228,073 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 36,137,644 - 36,228,075 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 39,133,409 - 39,152,542 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PABPC1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 95,560,551 - 95,578,627 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 95,561,930 - 95,578,633 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666039 45,104,972 - 45,123,828 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pabpc1
.
Assembly: RGSC_v3.4 Assembly: Rnor_5.0
Predicted Target Of
Count of predictions: 36 Count of miRNA genes: 29 Interacting mature miRNAs: 34 Transcripts: ENSRNOT00000012775 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 2293667 Bss42 Bone structure and strength QTL 42 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 7 47651439 92651439 Rat 10053722 Scort27 Serum corticosterone level QTL 27 2.41 0.0083 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 43228750 88228750 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 2317035 Aia16 Adjuvant induced arthritis QTL 16 2.71 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 59238038 104238038 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 2293678 Bss24 Bone structure and strength QTL 24 6.71 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 7 47651439 92651439 Rat 1358361 Sradr5 Stress Responsive Adrenal Weight QTL 5 5.55 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 7 43747012 108555253 Rat 631513 Scl7 Serum cholesterol level QTL 7 4.1 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 37960569 82960569 Rat 2293685 Bmd21 Bone mineral density QTL 21 4.2 0.0003 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 7 47651439 92651439 Rat 10755453 Coatc12 Coat color QTL 12 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 31112832 76112832 Rat 631504 Cm27 Cardiac mass QTL 27 3.45 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 7 44421311 118198041 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 634326 Hc3 Hypercalciuria QTL 3 2.1 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 7 42787314 87787314 Rat 2293696 Bmd32 Bone mineral density QTL 32 5.1 0.0001 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 7 47651439 92651439 Rat 7411605 Foco14 Food consumption QTL 14 24.1 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 7 34293282 79293282 Rat 1300151 Bp181 Blood pressure QTL 181 3.36 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 7 53612714 103945643 Rat 1559283 Emca4 Estrogen-induced mammary cancer QTL 4 3.7 mammary gland integrity trait (VT:0010552) percentage of study population developing mammary tumors during a period of time (CMO:0000948) 7 62004452 101773158 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 738030 Anxrr8 Anxiety related response QTL 8 4.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 46590070 91590070 Rat 1300149 Cm6 Cardiac mass QTL 6 4.09 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 7 43747099 102228765 Rat 631534 Lnnr1 Liver neoplastic nodule remodeling QTL 1 3.85 0.001 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705) 7 34293282 79293282 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 2293707 Bss32 Bone structure and strength QTL 32 7.64 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 47651439 92651439 Rat 61357 Bp38 Blood pressure QTL 38 1.6 0.052 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 41333674 119109060 Rat 2293644 Bmd29 Bone mineral density QTL 29 5.4 0.0001 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 7 47651439 92651439 Rat 2300178 Bmd54 Bone mineral density QTL 54 5.3 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 7 47651439 92651439 Rat 1298528 Bp169 Blood pressure QTL 169 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 61074194 106074194 Rat 61428 Scl3 Serum cholesterol level QTL 3 3.2 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 7 44867533 89867533 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 1576303 Ept7 Estrogen-induced pituitary tumorigenesis QTL 7 3.7 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 7 62004452 101773158 Rat 10402855 Bp379 Blood pressure QTL 379 0.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 29409683 74409683 Rat
Pabpc1
Rat Assembly Chr Position (strand) Source JBrowse RGSC_v3.4 18 32,757,052 - 32,758,183 UniSTS RGSC3.4 RGSC_v3.4 18 32,757,257 - 32,757,659 UniSTS RGSC3.4 RGSC_v3.4 7 72,119,416 - 72,121,074 UniSTS RGSC3.4 Celera 18 31,285,479 - 31,285,881 UniSTS Celera 7 64,860,680 - 64,862,338 UniSTS Celera 18 31,285,274 - 31,286,405 UniSTS
AW535519
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 7 69,662,722 - 69,662,923 (+) Marker Load Pipeline mRatBN7.2 7 67,777,647 - 67,777,848 (+) MAPPER mRatBN7.2 Rnor_6.0 7 75,409,791 - 75,409,991 NCBI Rnor6.0 Rnor_5.0 7 75,557,844 - 75,558,044 UniSTS Rnor5.0 RGSC_v3.4 7 72,116,350 - 72,116,550 UniSTS RGSC3.4 Celera 7 64,857,614 - 64,857,814 UniSTS RH 3.4 Map 7 638.4 UniSTS Cytogenetic Map 7 q22 UniSTS
Pabpc1
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 7 75,560,910 - 75,562,568 UniSTS Rnor5.0 Rnor_5.0 18 32,642,609 - 32,643,011 UniSTS Rnor5.0 RGSC_v3.4 18 32,757,257 - 32,757,659 UniSTS RGSC3.4 RGSC_v3.4 7 72,119,416 - 72,121,074 UniSTS RGSC3.4 Celera 18 31,285,479 - 31,285,881 UniSTS Celera 7 64,860,680 - 64,862,338 UniSTS Cytogenetic Map 7 q22 UniSTS Cytogenetic Map 18 p11 UniSTS
Pabpc1
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 18 32,642,404 - 32,643,535 UniSTS Rnor5.0 RGSC_v3.4 18 32,757,052 - 32,758,183 UniSTS RGSC3.4 Celera 18 31,285,274 - 31,286,405 UniSTS Cytogenetic Map 7 q22 UniSTS Cytogenetic Map 18 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012775 ⟹ ENSRNOP00000012775
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 67,777,575 - 67,789,744 (-) Ensembl Rnor_6.0 Ensembl 7 75,409,581 - 75,421,874 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000080218 ⟹ ENSRNOP00000071159
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 67,777,575 - 67,789,744 (-) Ensembl Rnor_6.0 Ensembl 7 75,411,311 - 75,422,268 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000104653 ⟹ ENSRNOP00000080094
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 67,777,575 - 67,789,744 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000116510 ⟹ ENSRNOP00000095971
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 67,777,381 - 67,789,744 (-) Ensembl
RefSeq Acc Id:
NM_134353 ⟹ NP_599180
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 69,662,513 - 69,674,806 (-) NCBI mRatBN7.2 7 67,777,438 - 67,789,731 (-) NCBI Rnor_6.0 7 75,409,581 - 75,421,874 (-) NCBI Rnor_5.0 7 75,557,634 - 75,569,927 (-) NCBI RGSC_v3.4 7 72,116,140 - 72,128,433 (-) RGD Celera 7 64,857,404 - 64,869,695 (-) RGD
Sequence:
CTGCCGCCCGGACCCAGCACCGCCAGCCTCGCTCCCCCGGTTCCACGGCCGTTGAGTACGCGTCGATTCCGGTTGAATTTTGTCCCTCTGCGCTCGCCCCCGCTCCCCTCCCCCCGGCTCCGTCCCCC
hide sequence
RefSeq Acc Id:
NP_599180 ⟸ NM_134353
- UniProtKB:
Q9EPH8 (UniProtKB/Swiss-Prot), A6HR30 (UniProtKB/TrEMBL), A0A0G2JZS2 (UniProtKB/TrEMBL)
- Sequence:
MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFSAFGNILSC
hide sequence
Ensembl Acc Id:
ENSRNOP00000071159 ⟸ ENSRNOT00000080218
Ensembl Acc Id:
ENSRNOP00000012775 ⟸ ENSRNOT00000012775
Ensembl Acc Id:
ENSRNOP00000080094 ⟸ ENSRNOT00000104653
Ensembl Acc Id:
ENSRNOP00000095971 ⟸ ENSRNOT00000116510
RGD ID: 13695293 Promoter ID: EPDNEW_R5818 Type: multiple initiation site Name: Pabpc1_1 Description: poly binding protein, cytoplasmic 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 75,422,139 - 75,422,199 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-01-20
Pabpc1
poly(A) binding protein, cytoplasmic 1
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Pabpc1
poly(A) binding protein, cytoplasmic 1
Symbol and Name status set to provisional
70820 PROVISIONAL
