Hcrtr1 (hypocretin receptor 1) - Rat Genome Database

Name: Hcrtr1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Hcrtr1 (hypocretin receptor 1) Rattus norvegicus

Analyze

Symbol:

Hcrtr1

Name:

hypocretin receptor 1

RGD ID:

2787

Description:

Enables orexin receptor activity and peptide hormone binding activity. Involved in neuropeptide signaling pathway. Predicted to be located in plasma membrane. Orthologous to human HCRTR1 (hypocretin receptor 1); PARTICIPATES IN G protein mediated signaling pathway via Galphaq family; orexin/hypocretin signaling pathway via orexin/hypocretin receptor 1; orexin/hypocretin signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Hctr1; hypocretin (orexin) receptor 1; hypocretin receptor type 1; orexin receptor type 1; orexin/Hypocretin receptor type 1; ox-1-R; ox1-R; ox1r

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	HCRTR1 (hypocretin receptor 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Hcrtr1 (hypocretin (orexin) receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Hcrtr1 (hypocretin receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	HCRTR1 (hypocretin receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	HCRTR1 (hypocretin receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Hcrtr1 (hypocretin receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	HCRTR1 (hypocretin receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	HCRTR1 (hypocretin receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Hcrtr1 (hypocretin receptor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	OR52E5 (olfactory receptor family 52 subfamily E member 5)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	HCRTR1 (hypocretin receptor 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Hcrtr1 (hypocretin (orexin) receptor 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	npr-14	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	142,477,214 - 142,486,674 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	142,477,214 - 142,486,674 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	145,177,816 - 145,187,460 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	146,947,628 - 146,957,270 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	146,945,402 - 146,954,867 (-)	NCBI	Rnor_WKY
Rnor_6.0	5	148,346,029 - 148,355,404 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	148,346,031 - 148,355,406 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	152,064,507 - 152,073,882 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	149,160,739 - 149,170,736 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	149,170,777 - 149,180,775 (-)	NCBI
Celera	5	140,944,936 - 140,954,306 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Cocaine-Related Disorders (ISO)

genetic disease (ISO)

withdrawal disorder (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

amphetamine (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cannabidiol (ISO)

cetrorelix (EXP)

chlorpyrifos (ISO)

choline (ISO)

Cuprizon (EXP)

diarsenic trioxide (ISO)

dioxygen (EXP)

dopamine (EXP)

doxorubicin (ISO)

fenvalerate (EXP)

folic acid (ISO)

fonofos (ISO)

L-methionine (ISO)

milnacipran (ISO)

morphine (EXP)

parathion (ISO)

paroxetine (ISO)

PCB138 (ISO)

pentobarbital (EXP)

perfluorooctane-1-sulfonic acid (EXP)

pirinixic acid (ISO)

resveratrol (ISO)

terbufos (ISO)

trichloroethene (EXP)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular response to hormone stimulus (IBA)

feeding behavior (IEA)

G protein-coupled receptor signaling pathway (IDA)

neuropeptide signaling pathway (IBA,IDA,ISO)

positive regulation of ERK1 and ERK2 cascade (ISO)

regulation of cytosolic calcium ion concentration (ISO,ISS)

Cellular Component

plasma membrane (ISO,ISS)

Molecular Function

orexin receptor activity (IDA,ISO,TAS)

peptide binding (IBA)

peptide hormone binding (IDA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

G protein mediated signaling pathway via Galphaq family (IDA)

orexin/hypocretin signaling pathway (TAS)

orexin/hypocretin signaling pathway via orexin/hypocretin receptor 1 (IDA)

References

References - curated

#	Reference Title	Reference Citation
1.	Orexin receptor-1 (OX-R1) immunoreactivity in chemically identified neurons of the hypothalamus: focus on orexin targets involved in control of food and water intake.	Backberg M, etal., Eur J Neurosci 2002 Jan;15(2):315-28.
2.	Localization of orexins and their receptors in the rat olfactory system: possible modulation of olfactory perception by a neuropeptide synthetized centrally or locally.	Caillol M, etal., Brain Res 2003 Jan 17;960(1-2):48-61.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	The neural circuit of orexin (hypocretin): maintaining sleep and wakefulness.	Sakurai T Nat Rev Neurosci. 2007 Mar;8(3):171-81. Epub 2007 Feb 14.
9.	Orexins and orexin receptors: a family of hypothalamic neuropeptides and G protein-coupled receptors that regulate feeding behavior.	Sakurai T, etal., Cell 1998 Feb 20;92(4):573-85.
10.	Evidence implicating a role for orexin-1 receptor modulation of paradoxical sleep in the rat.	Smith MI, etal., Neurosci Lett 2003 May 8;341(3):256-8.
11.	Orexin-1 receptor immunoreactivity in chemically identified target neurons in the rat hypothalamus.	Suzuki R, etal., Neurosci Lett 2002 May 10;324(1):5-8.
12.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
13.	The SK-N-MC cell line expresses an orexin binding site different from recombinant orexin 1-type receptor.	Wieland HA, etal., Eur J Biochem 2002 Feb;269(4):1128-35.
14.	Orexin receptor type-1 couples exclusively to pertussis toxin-insensitive G-proteins, while orexin receptor type-2 couples to both pertussis toxin-sensitive and -insensitive G-proteins.	Zhu Y, etal., J Pharmacol Sci. 2003 Jul;92(3):259-66.

Additional References at PubMed

PMID:11283317	PMID:11340621	PMID:12639903	PMID:12639939	PMID:12816759	PMID:14764632	PMID:15350698	PMID:15453542	PMID:15870901	PMID:15893599	PMID:15976062	PMID:16157481
PMID:16763079	PMID:16815564	PMID:16930690	PMID:17276508	PMID:17292491	PMID:17585016	PMID:17638707	PMID:17982683	PMID:18223663	PMID:19033203	PMID:19118115	PMID:19207823
PMID:19261974	PMID:19271123	PMID:19328827	PMID:19409203	PMID:19427365	PMID:19656173	PMID:19699765	PMID:19741128	PMID:19889100	PMID:20062799	PMID:20177882	PMID:20667500
PMID:20728473	PMID:21089218	PMID:21418915	PMID:21596094	PMID:21957165	PMID:22028875	PMID:22186370	PMID:22356621	PMID:22450910	PMID:22569505	PMID:22588980	PMID:23744436
PMID:23978908	PMID:24637063	PMID:24807827	PMID:25036612	PMID:25223979	PMID:25239810	PMID:25371350	PMID:25446454	PMID:25817882	PMID:25899624	PMID:25948277	PMID:26059340
PMID:26096126	PMID:26277341	PMID:26287582	PMID:26943473	PMID:26950369	PMID:26987804	PMID:27575948	PMID:27771284	PMID:27837432	PMID:28549933	PMID:28667055	PMID:28866050
PMID:28888954	PMID:28889006	PMID:29258865	PMID:29269074	PMID:30144975	PMID:30336854	PMID:30406600	PMID:30458283	PMID:31002819	PMID:31213116	PMID:32044404	PMID:32061874
PMID:32207079	PMID:32474210	PMID:32668268	PMID:32745488	PMID:33212156	PMID:34718063	PMID:34730554	PMID:35338110	PMID:36284025	PMID:36470538	PMID:36539163

Genomics

Comparative Map Data

Hcrtr1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	142,477,214 - 142,486,674 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	142,477,214 - 142,486,674 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	145,177,816 - 145,187,460 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	146,947,628 - 146,957,270 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	146,945,402 - 146,954,867 (-)	NCBI	Rnor_WKY
Rnor_6.0	5	148,346,029 - 148,355,404 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	148,346,031 - 148,355,406 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	152,064,507 - 152,073,882 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	149,160,739 - 149,170,736 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	149,170,777 - 149,180,775 (-)	NCBI
Celera	5	140,944,936 - 140,954,306 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

HCRTR1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	31,617,689 - 31,634,492 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	1	31,617,686 - 31,632,518 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	32,083,290 - 32,093,214 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	31,857,228 - 31,865,301 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	31,753,733 - 31,761,807	NCBI
Celera	1	30,352,534 - 30,362,141 (+)	NCBI		Celera
Cytogenetic Map	1	p35.2	NCBI
HuRef	1	30,200,818 - 30,210,425 (+)	NCBI		HuRef
CHM1_1	1	32,199,098 - 32,208,715 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	31,475,343 - 31,490,165 (+)	NCBI		T2T-CHM13v2.0

Hcrtr1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	130,024,010 - 130,033,389 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	130,024,010 - 130,033,152 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	130,130,217 - 130,139,594 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	130,130,217 - 130,139,359 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	129,807,461 - 129,816,406 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	129,632,521 - 129,641,466 (-)	NCBI		MGSCv36	mm8
Celera	4	128,464,692 - 128,473,445 (-)	NCBI		Celera
Cytogenetic Map	4	D2.2	NCBI

Hcrtr1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	10,026,464 - 10,036,186 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955452	10,026,464 - 10,036,267 (+)	NCBI	ChiLan1.0	ChiLan1.0

HCRTR1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	1	194,323,439 - 194,333,994 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	30,901,772 - 30,913,633 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	31,918,650 - 31,928,290 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	31,919,980 - 31,928,290 (+)	Ensembl	panpan1.1		panPan2

HCRTR1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	69,484,776 - 69,493,956 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	69,480,199 - 69,494,005 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	66,064,201 - 66,072,739 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	70,050,261 - 70,058,799 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	70,045,316 - 70,057,436 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	66,886,002 - 66,894,539 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	67,882,448 - 67,890,972 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	68,881,857 - 68,890,396 (-)	NCBI		UU_Cfam_GSD_1.0

Hcrtr1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	48,908,833 - 48,920,670 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	14,735,638 - 14,742,854 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936474	14,735,654 - 14,744,112 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HCRTR1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	88,139,498 - 88,154,848 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	88,139,623 - 88,149,531 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	81,853,666 - 81,864,501 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HCRTR1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	101,241,742 - 101,252,841 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	101,243,586 - 101,251,349 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	15,439,702 - 15,447,823 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hcrtr1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	14,862,397 - 14,869,739 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	14,861,672 - 14,872,728 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Hcrtr1
56 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	81
Count of miRNA genes:	63
Interacting mature miRNAs:	73
Transcripts:	ENSRNOT00000018674
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	94858972	143070159	Rat
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	120740824	143608494	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	129132428	143070159	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	129132447	151006154	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium
Low	1		2		1				43	14	9
Below cutoff	2	18	17	5	15	5	6	9	17	20	26	9	6

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_013064	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109321	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF041244	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FN803424	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000018674 ⟹ ENSRNOP00000018674

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	142,477,214 - 142,486,674 (-)	Ensembl
Rnor_6.0 Ensembl	5	148,346,031 - 148,355,406 (-)	Ensembl

RefSeq Acc Id:

NM_013064 ⟹ NP_037196

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	142,477,214 - 142,486,674 (-)	NCBI
Rnor_6.0	5	148,346,029 - 148,355,404 (-)	NCBI
Rnor_5.0	5	152,064,507 - 152,073,882 (-)	NCBI
RGSC_v3.4	5	149,160,739 - 149,170,736 (-)	RGD
Celera	5	140,944,936 - 140,954,306 (-)	RGD

Sequence:

show sequence

GTCGACGTGTCGAAAGGATGCTCAGGATATGAATGAGCCAGCGGACGCGTGAATGGAGGTGGAT
GGAAGCGTGAAGTACAAGGCGGGGCTCCAGCTGGGTGACCTCGAGGCAGACAGGCCGGGGCTCC
CTCCCCTCTCCTCCCAGCCTCCCACTCCGCTCCCCTCCCCGCGGCGCGCAGACCTTCCGAGCCC
TCCCGAGCTACCGCGGGCAACAGAGACGGGACCACGCAGCCACCGAGCGGACAGCGCCTCCTCA
GGAGGGGGCTACCCCGCCGCGTCTCCAGCTCTGCCCTAAGGCGAAGTCCCGCGAGCGAGGTCCA
GGGCTCACTAGTAATGACACGGGACACTGACTGGAGGGCCGGCATCTGGGTGTACCAGGCTCTG
GGTGAAGTAGTTCCCAAATCTTAGAGCTCAATACTCCTCATCGTGACACTGAAAGGAAGTTTGT
TCTGGGACCATAAAGACCTGAGTGCAAGACCAGGGCCTTTGAAAGGAGTGGGCTGAGGGCTTGT
GGGAGTTTCTCTTCCTCCACAGAGCCCAGGATGCTCCTCAGCTGAAGTGGCTCATGGAACCCTC
AGCCACGCCTGGGGCCCAGCCCGGAGTCCCCACTAGCAGTGGGGAACCCTTCCACCTGCCTCCA
GACTATGAGGACGAGTTCCTCCGCTACCTGTGGCGCGATTATCTCTATCCGAAGCAGTACGAGT
GGGTTCTCATCGCGGCCTACGTGGCCGTGTTTCTCATAGCCTTGGTGGGCAACACTCTGGTCTG
CCTGGCTGTGTGGCGGAACCACCACATGAGGACAGTCACCAACTACTTCATTGTCAACCTGTCC
CTGGCAGATGTGCTGGTGACTGCCATCTGCCTGCCTGCCAGCCTGTTAGTGGACATCACCGAAT
CATGGCTCTTCGGCCATGCCTTGTGCAAGGTCATCCCCTATCTCCAGGCCGTGTCGGTGTCAGT
GGCAGTGCTGACTCTCAGCTTCATCGCCCTGGACCGCTGGTATGCCATCTGCCACCCTCTGCTG
TTCAAGAGCACAGCTCGCCGTGCCCGTGGCTCCATCCTGGGCATCTGGGCTGTGTCGCTGGCTG
TCATGGTGCCCCAGGCCGCTGTCATGGAATGCAGCAGTGTTCTGCCCGAGCTAGCCAATCGCAC
ACGGCTCTTCTCTGTCTGTGATGAGCGCTGGGCAGATGAACTCTACCCTAAGATCTACCACAGC
TGCTTCTTCTTTGTCACCTACCTGGCCCCGCTGGGCCTCATGGGCATGGCCTATTTCCAGATCT
TCCGCAAGCTCTGGGGCCCCCAGATCCCGGGTACCACATCGGCCTTGGTGCGGAACTGGAAGCG
ACCCTCAGAGCAACTGGAAGCTCAGCACCAGGGCCTGTGTACAGAGCCCCAACCCCGGGCCCGA
GCCTTCCTGGCCGAGGTGAAGCAGATGCGAGCTCGGAGGAAGACTGCCAAGATGCTGATGGTGG
TTCTGCTGGTTTTTGCACTCTGTTATCTGCCCATCAGTGTCCTCAATGTCCTTAAAAGAGTGTT
TGGGATGTTTCGCCAAGCCAGCGACCGGGAAGCTGTCTACGCCTGCTTCACCTTCTCCCACTGG
CTGGTGTACGCCAACAGTGCGGCCAACCCTATCATCTACAACTTCCTCAGTGGCAAATTTCGGG
AGCAGTTCAAGGCTGCATTCTCCTGCTGCCTGCCTGGTCTGGGTCCCAGCTCCTCTGCCAGACA
CAAGTCCTTGTCCTTGCAGAGCCGGTGTTCTGTCTCCAAAGTCTCTGAGCATGTTGTGCTGACC
ACAGTCACTACAGTGCTGTCCTGAGTGGGGCTGGCCAGGCTCTGGGAGGCTTGATCCTTTGCCT
GGGGCTCACCCCACCCCCACACTCATGGAAAGACTGCTGCTGCTCAGTCCGATCCCTCAACTCC
AGTCCTAGCTTTCTGCCTGAGTGACTCCGCCAGAGTCATTCCCTCTCTTGAGGTTGCATCCCCT
AAGCTGAGTTGATAGGGGCTTAAGCATGCTCAAGAGAGCAGAGAGCGTTGTAAACCGTCTAGTG
CTTGTGGACGTGGTTACTGTCCCTGTCTCGTATGGCCCTACCCTACAGTGTCACTTCACCCTAT
CAGAGCTTGGCTTTCTCCCCAAAGACCTGTCTCCTACTCAATTATAGGCCCTCCCTGGCTGGAG
TCCACTCCAAGGGTCCCCACAGGCATATCCACCTGGCCTGAAGGCCACCAGAAGTCCGGACTGC
ACATGGCCAGCTGCACCAATGTGTCCCTGTGAACTAATTTGCGTTCAGCCCTTCTCAGTGAGCT
CTGAAGCTAGGTCCACCCTCTCCAGGTGTGGACTGCACACAGCACAGGCTGGATCTCGTTGGCA
TTGTGGAGTGCTTAAACACTCTCCATGCGGCCGTTCGGCATGGAGGCCAACAGCCCGTGGCAAC
TGTAATTAAAAGCCTGGTACCGAAAAAAAAAGTCGAC

hide sequence

RefSeq Acc Id:

XM_039109321 ⟹ XP_038965249

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	142,477,214 - 142,485,538 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_037196	(Get FASTA)	NCBI Sequence Viewer
	XP_038965249	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC40041	(Get FASTA)	NCBI Sequence Viewer
	EDL80583	(Get FASTA)	NCBI Sequence Viewer
	P56718	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_037196 ⟸ NM_013064

- UniProtKB:

P56718 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MEPSATPGAQPGVPTSSGEPFHLPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFLIALVGN
TLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAV
SVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAVMVPQAAVMECSSVLPEL
ANRTRLFSVCDERWADELYPKIYHSCFFFVTYLAPLGLMGMAYFQIFRKLWGPQIPGTTSALVR
NWKRPSEQLEAQHQGLCTEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVL
KRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPSS
SARHKSLSLQSRCSVSKVSEHVVLTTVTTVLS

hide sequence

RefSeq Acc Id:

ENSRNOP00000018674 ⟸ ENSRNOT00000018674

RefSeq Acc Id:	XP_038965249 ⟸ XM_039109321
- Peptide Label:	isoform X1
- UniProtKB:	P56718 (UniProtKB/Swiss-Prot)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P56718-F1-model_v2	AlphaFold	P56718	1-416	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2787	AgrOrtholog
BIND	128267
	130459
	133988
BioCyc Gene	G2FUF-39763	BioCyc
Ensembl Genes	ENSRNOG00000013838	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000018674	ENTREZGENE
	ENSRNOP00000018674.3	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000018674	ENTREZGENE
	ENSRNOT00000018674.7	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	Orexin_rcpt	UniProtKB/Swiss-Prot
	Orexin_rcpt_1	UniProtKB/Swiss-Prot
KEGG Report	rno:25593	UniProtKB/Swiss-Prot
NCBI Gene	25593	ENTREZGENE
PANTHER	G PROTEIN-COUPLED RECEPTOR 15-LIKE	UniProtKB/Swiss-Prot
	LEUCOKININ RECEPTOR-RELATED	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PhenoGen	Hcrtr1	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot
	OREXIN1R	UniProtKB/Swiss-Prot
	OREXINR	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
TIGR	TC234778
UniProt	OX1R_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-03	Hcrtr1	hypocretin receptor 1	Hcrtr1	hypocretin (orexin) receptor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Hcrtr1	hypocretin (orexin) receptor 1		hypocretin receptor 1	Name updated	1299863	APPROVED
2002-11-06	Hcrtr1	hypocretin receptor 1		Hypocretin (orexin) receptor 1	Name updated	625702	APPROVED
2002-06-10	Hcrtr1	Hypocretin (orexin) receptor 1			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_domains	C-terminus is amidated and also contains two intramolecular disulphide bonds that connect cysteine residues	625512
gene_drugs	Modafinil, an anti-narcoleptic drug, might act through the orexin pathway	625512
gene_function	G-protein-coupled receptor	625512
gene_physical_interaction	binds the ligands Orexin A and Orexin B	625512
gene_process	plays an important role in food intake, sleep/wake cycle and neuroendocrine functions	625512

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations