Cryba1 (crystallin, beta A1) - Rat Genome Database

Name: Cryba1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Cryba1 (crystallin, beta A1) Rattus norvegicus

Analyze

Symbol:

Cryba1

Name:

crystallin, beta A1

RGD ID:

2415

Description:

Predicted to enable identical protein binding activity. Predicted to be a structural constituent of eye lens. Involved in several processes, including lens development in camera-type eye; negative regulation of intracellular signal transduction; and positive regulation of anoikis. Used to study cataract; microphthalmia; and retinal detachment. Biomarker of ocular hypertension. Human ortholog(s) of this gene implicated in cataract and cataract 10 multiple types. Orthologous to human CRYBA1 (crystallin beta A1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; acetamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

BA3A1C; beta-A3; beta-A3 crystallin; beta-crystallin A3

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CRYBA1 (crystallin beta A1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cryba1 (crystallin, beta A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cryba1 (crystallin beta A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CRYBA1 (crystallin beta A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CRYBA1 (crystallin beta A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cryba1 (crystallin beta A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CRYBA1 (crystallin beta A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CRYBA1 (crystallin beta A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cryba1 (crystallin beta A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CRYBA4 (crystallin beta A4)	HGNC	OrthoDB
Homo sapiens (human):	SNX4 (sorting nexin 4)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CRYBA1 (crystallin beta A1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cryba1 (crystallin, beta A1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cryba1b (crystallin, beta A1b)	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	cryba1a (crystallin, beta A1a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cryba1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Allele / Splice:

Cryba1^Hiser Cryba1^Nuc1Dbsa

Genetic Models:

SD-Cryba1^Nuc1Dbsa HHSE/Hat

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	62,608,373 - 62,614,726 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	62,608,383 - 62,614,726 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	67,240,414 - 67,246,766 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	10	66,745,921 - 66,752,273 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	10	62,215,925 - 62,222,276 (-)	NCBI	Rnor_WKY
Rnor_6.0	10	65,160,777 - 65,167,504 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	65,161,152 - 65,167,494 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	66,458,061 - 66,480,390 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	63,758,929 - 63,765,451 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	63,772,566 - 63,776,395 (-)	NCBI
Celera	10	61,589,011 - 61,595,363 (-)	NCBI		Celera
Cytogenetic Map	10	q25	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

cataract (IMP,ISO)

cataract 10 multiple types (ISO)

Cataract, Autosomal Dominant Nuclear (ISO)

genetic disease (ISO)

microphthalmia (IMP)

neurofibromatosis 1 (ISO)

ocular hypertension (IEP)

Reticular Dystrophy of Retinal Pigment Epithelium (IMP)

retinal detachment (IAGP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

benzo[a]pyrene (ISO)

bisphenol A (ISO)

bisphenol F (ISO)

CGP 52608 (ISO)

decabromodiphenyl ether (EXP)

dorsomorphin (ISO)

fenvalerate (EXP)

flutamide (EXP)

lead diacetate (ISO)

Licochalcone B (ISO)

methotrexate (ISO)

methylmercury chloride (ISO)

panobinostat (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctanoic acid (ISO)

potassium dichromate (ISO)

rac-lactic acid (ISO)

rotenone (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium dichromate (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

camera-type eye development (ISO)

lens development in camera-type eye (IBA,IEP)

negative regulation of cytokine production (IMP)

negative regulation of ERK1 and ERK2 cascade (IMP)

negative regulation of phosphatidylinositol 3-kinase signaling (IMP)

negative regulation of protein kinase B signaling (IMP)

negative regulation of TOR signaling (IMP)

phagocytosis (IMP)

positive regulation of anoikis (IMP)

regulation of autophagy (IMP)

visual perception (IBA)

Molecular Function

identical protein binding (ISO)

protein binding (ISO)

structural constituent of eye lens (IBA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal astrocyte morphology (IMP)

abnormal autophagy (IMP)

abnormal ciliary body morphology (IAGP)

abnormal lens morphology (IAGP)

abnormal retina ganglion layer morphology (IAGP,IMP)

abnormal retina inner nuclear layer thickness (IMP)

abnormal retina inner plexiform layer morphology (IMP)

abnormal retina outer nuclear layer thickness (IMP)

abnormal retina vasculature morphology (IMP)

abnormal vascular development (IAGP)

decreased retina apoptosis (IMP)

lipofuscinosis (IMP)

small lens (IMP)

References

References - curated

#	Reference Title	Reference Citation
1.	Crystallin gene expression during rat lens development.	Aarts HJ, etal., Eur J Biochem 1989 Jul 15;183(1):31-6.
2.	Different evolution rates within the lens-specific beta-crystallin gene family.	Aarts HJ, etal., J Mol Evol 1989 Apr;28(4):313-21.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Mutation in the betaA3/A1-crystallin encoding gene Cryba1 causes a dominant cataract in the mouse.	Graw J, etal., Genomics 1999 Nov 15;62(1):67-73.
6.	A splice site mutation in CRYBA1/A3 causing autosomal dominant posterior polar cataract in a Chinese pedigree.	Gu Z, etal., Mol Vis. 2010 Feb 5;16:154-60.
7.	Autosomal dominant cerulean cataract is associated with a chain termination mutation in the human beta-crystallin gene CRYBB2.	Litt M, etal., Hum Mol Genet. 1997 May;6(5):665-8.
8.	betaA3/A1-Crystallin controls anoikis-mediated cell death in astrocytes by modulating PI3K/AKT/mTOR and ERK survival pathways through the PKD/Bit1-signaling axis.	Ma B, etal., Cell Death Dis. 2011 Oct 13;2:e217. doi: 10.1038/cddis.2011.100.
9.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
10.	Mouse Genome Database (MGD)	Mouse Genome Database (MGD)
11.	Retinal gene profiling in a hereditary rodent model of elevated intraocular pressure.	Naskar R and Thanos S, Mol Vis. 2006 Oct 18;12:1199-210.
12.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
14.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
16.	Comprehensive gene review and curation	RGD comprehensive gene curation
17.	A spontaneous mutation affects programmed cell death during development of the rat eye.	Sinha D, etal., Exp Eye Res. 2005 Mar;80(3):323-35. doi: 10.1016/j.exer.2004.09.014.
18.	betaA3/A1-crystallin in astroglial cells regulates retinal vascular remodeling during development.	Sinha D, etal., Mol Cell Neurosci. 2008 Jan;37(1):85-95. Epub 2007 Aug 31.
19.	Establishment of a recessive mutant small-eye rat with lens involution and retinal detachment associated with partial deletion and rearrangement of the Cryba1 gene.	Yamada T, etal., Biochem J. 2015 Oct 15;471(2):293-305. doi: 10.1042/BJ20150165. Epub 2015 Aug 24.
20.	A recurrent mutation in CRYBA1 is associated with an autosomal dominant congenital nuclear cataract disease in a Chinese family.	Yang G, etal., Mol Vis. 2011;17:1559-63. Epub 2011 Jun 9.
21.	A G-->T splice site mutation of CRYBA1/A3 associated with autosomal dominant suture cataracts in a Chinese family.	Yang Z, etal., Mol Vis. 2011;17:2065-71. Epub 2011 Aug 5.
22.	A novel T-->G splice site mutation of CRYBA1/A3 associated with autosomal dominant nuclear cataracts in a Chinese family.	Yang Z, etal., Mol Vis. 2012;18:1283-8. Epub 2012 May 15.
23.	Congenital polymorphic cataract associated with a G to A splice site mutation in the human beta-crystallin gene CRYbetaA3/A1.	Yu Y, etal., Mol Vis. 2012;18:2213-20. Epub 2012 Aug 8.
24.	Differential proteomics analysis of proteins from human diabetic and age-related cataractous lenses.	Zhu J, etal., J Res Med Sci. 2013 Nov;18(11):984-9.
25.	Mutation in the βA3/A1-crystallin gene impairs phagosome degradation in the retinal pigmented epithelium of the rat.	Zigler JS, etal., J Cell Sci. 2011 Feb 15;124(Pt 4):523-31. doi: 10.1242/jcs.078790. Epub 2011 Jan 25.

Additional References at PubMed

PMID:11773034	PMID:14717595	PMID:18587492	PMID:21203897	PMID:25736717

Genomics

Comparative Map Data

Cryba1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	10	62,608,373 - 62,614,726 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	62,608,383 - 62,614,726 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	67,240,414 - 67,246,766 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	10	66,745,921 - 66,752,273 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	10	62,215,925 - 62,222,276 (-)	NCBI	Rnor_WKY
Rnor_6.0	10	65,160,777 - 65,167,504 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	65,161,152 - 65,167,494 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	66,458,061 - 66,480,390 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	63,758,929 - 63,765,451 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	63,772,566 - 63,776,395 (-)	NCBI
Celera	10	61,589,011 - 61,595,363 (-)	NCBI		Celera
Cytogenetic Map	10	q25	NCBI

CRYBA1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	29,246,859 - 29,254,494 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	17	29,246,859 - 29,254,494 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	27,573,877 - 27,581,512 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	24,598,001 - 24,605,638 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	24,598,000 - 24,605,626	NCBI
Celera	17	24,433,393 - 24,441,030 (+)	NCBI		Celera
Cytogenetic Map	17	q11.2	NCBI
HuRef	17	23,782,531 - 23,790,168 (+)	NCBI		HuRef
CHM1_1	17	27,636,586 - 27,644,223 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	30,189,627 - 30,197,262 (+)	NCBI		T2T-CHM13v2.0

Cryba1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	77,609,440 - 77,616,119 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	77,609,441 - 77,616,109 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	77,718,614 - 77,725,293 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	77,718,615 - 77,725,283 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	77,532,234 - 77,538,795 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	77,534,927 - 77,541,488 (-)	NCBI		MGSCv36	mm8
Celera	11	85,217,233 - 85,223,794 (-)	NCBI		Celera
Cytogenetic Map	11	B5	NCBI
cM Map	11	46.74	NCBI

Cryba1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955481	3,952,988 - 3,959,764 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955481	3,952,976 - 3,986,548 (-)	NCBI	ChiLan1.0	ChiLan1.0

CRYBA1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	17	37,077,466 - 37,095,190 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	27,522,647 - 27,530,767 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	28,032,799 - 28,040,525 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	28,032,809 - 28,040,525 (-)	Ensembl	panpan1.1		panPan2

CRYBA1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	43,372,507 - 43,378,561 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	43,372,505 - 43,378,590 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	42,527,304 - 42,533,358 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	44,189,857 - 44,195,902 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	44,189,855 - 44,195,929 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	42,972,718 - 42,978,772 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	43,264,979 - 43,271,025 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	43,344,166 - 43,350,220 (+)	NCBI		UU_Cfam_GSD_1.0

Cryba1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	42,514,188 - 42,522,476 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936538	5,392,105 - 5,400,070 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936538	5,392,159 - 5,400,583 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CRYBA1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	45,466,520 - 45,473,092 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	45,466,051 - 45,473,110 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	29,178,767 - 29,181,605 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CRYBA1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	23,005,892 - 23,011,357 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	23,003,874 - 23,011,206 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666075	7,093,414 - 7,100,122 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cryba1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624786	1,771,328 - 1,777,503 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624786	1,757,272 - 1,777,735 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cryba1
11 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	34
Count of miRNA genes:	25
Interacting mature miRNAs:	30
Transcripts:	ENSRNOT00000011608
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35392267	64155584	Rat
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35392457	63642539	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	41944526	78307017	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	42876766	79813922	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47369470	92369470	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	49444551	81709989	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49444551	81709989	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	49444551	81709989	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	51770177	107211142	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
631535	Cm51	Cardiac mass QTL 51	3		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	51786282	91669536	Rat
2306787	Ean3	Experimental allergic neuritis QTL 3	3.1		nervous system integrity trait (VT:0010566)	body weight loss (CMO:0001399)	10	53797385	66979128	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	53797494	98952626	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	54809292	99809292	Rat
2312662	Slep8	Serum leptin concentration QTL 8		0.05	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	10	57134272	102134272	Rat
2312668	Scl65	Serum cholesterol level QTL 65		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	57134272	102134272	Rat
2312672	Insul15	Insulin level QTL 15		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	10	57134272	102134272	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	57576521	102576521	Rat
2293698	Bss43	Bone structure and strength QTL 43	5.33	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	10	59209888	104209888	Rat
1331839	Eae18b	Experimental allergic encephalomyelitis QTL 18b	5.8	0.03	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	61248303	67785171	Rat
70363	Bp71	Blood pressure QTL 71		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	61345276	81714865	Rat
2306970	Anxrr22	Anxiety related response QTL 22	5.95		fear/anxiety-related behavior trait (VT:1000241)	number of periods of voluntary immobility (CMO:0001045)	10	61345276	98211570	Rat
6893336	Cm75	Cardiac mass QTL 75	0.1	0.87	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	61345276	99703528	Rat
1558643	Cm44	Cardiac mass QTL 44	4.8	0.0000368	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	61345276	99703528	Rat
631526	Bp76	Blood pressure QTL 76		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	61345413	66743655	Rat
61402	Niddm3	Non-insulin dependent diabetes mellitus QTL 3	4.58		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	61345413	82564856	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat

Markers in Region

RH94650

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	62,608,396 - 62,608,498 (-)	MAPPER	mRatBN7.2
Rnor_6.0	10	65,167,379 - 65,167,480	NCBI	Rnor6.0
Rnor_5.0	10	66,458,089 - 66,458,190	UniSTS	Rnor5.0
RGSC_v3.4	10	63,758,957 - 63,759,058	UniSTS	RGSC3.4
Celera	10	61,589,035 - 61,589,136	UniSTS
Cytogenetic Map	10	q24-q25	UniSTS

Genetic Models

This gene Cryba1 is modified in the following models/strains

SD-Cryba1^Nuc1Dbsa

HHSE/Hat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium
Low	2	9	25	9	17	9	8	8	11	9	10	11	8
Below cutoff	1	2	8	8	2	8		3	2	1	8

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_013056	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017597045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF013248	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000220	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X15143	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000011608 ⟹ ENSRNOP00000011608

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	62,608,383 - 62,614,726 (-)	Ensembl
Rnor_6.0 Ensembl	10	65,161,152 - 65,167,494 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000100169 ⟹ ENSRNOP00000090008

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	62,608,383 - 62,613,363 (-)	Ensembl

RefSeq Acc Id:

NM_013056 ⟹ NP_037188

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	62,608,373 - 62,614,726 (-)	NCBI
Rnor_6.0	10	65,161,152 - 65,167,504 (+)	NCBI
Rnor_5.0	10	66,458,061 - 66,480,390 (-)	NCBI
Celera	10	61,589,011 - 61,595,363 (-)	NCBI

Sequence:

show sequence

ACCAGATGGAGACCCAGACTGTGCAGCGGGAGCTGGAAACTCTTCCAACCACCAAGATGGCTCA
GACCAACCCTATGCCAGGGTCCATGGGGCCATGGAAGATAACCATCTATGATCAGGAGAACTTC
CAGGGCAAGAGGATGGAGTTCACCAGCTCCTGCCCAAATGTCTCTGAACGTAGTTTTGATAATG
TCCGGTCACTTAAGGTGGAGTGTGGCGCCTGGATTGGTTATGAGCACACCAGCTTCTGTGGGCA
ACAGTTCATCCTGGAGAGAGGAGAATACCCTCGATGGGATGCCTGGAGTGGGAGCAATGCCTAT
CATATTGAGCGTCTCATGTCCTTCCGACCCATCTGTTCTGCTAATCATAAAGAGTCTAAGATCA
CCATCTTTGAGAAAGAGAACTTTATTGGACGCCAGTGGGAGATCTGTGATGACTACCCTTCCTT
ACAAGCCATGGGTTGGTTCAACAATGAAGTGGGTTCCATGAAGATACAGTGTGGAGCTTGGGTT
TGCTACCAGTATCCTGGATATCGTGGTTATCAGTATATCTTGGAATGTGACCATCACGGAGGAG
ACTACAAACACTGGAGAGAGTGGGGAACTCATGCTCAGACTTCTCAGATCCAATCAATTCGCCG
AATACAACAATAGTAGAGTCAAAGATTCAAAATTCCTCAAGCATGCAAACTTACTAAGCATTAT
AGAATTTTATGTTCTGCCCAGACACTGCATCCAAATGTTAGCACTAAAATCCACAATAAATGTC
ATTTAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_017597045 ⟹ XP_017452534

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	10	62,609,149 - 62,614,721 (-)	NCBI
Rnor_6.0	10	65,160,777 - 65,166,728 (+)	NCBI

Sequence:

show sequence

TGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGACACATACATATGGTCCATTTCGATGATTC
TGATGTGTTTTATAGAATCTTTCAAGACTGTCAAACAGGATAGGGCCAAGCATTCACTATAGAA
CACTTCTGTCCTTAGTTCCCAGCCGCTCTGAGAAGATCTCCCTAGGCAGCCAGCCCTGCCCAAC
AGAAGGGCCTCTGCACTTCTGGAACCCTAAACAAAGCTCTGAGGGACACCTCCCCCCAGTAGGC
TGAGCCACTAAAGCTCTGGGGATCAGGAGAAACAAAGAGAGAGGGGGAAAGAGAGTGCTGACAG
AGCTGCTGGCCATACTCTGCAGGACTATAAAGAGGGGATCCGGAGAGGAAGCTGCACCAGATGG
AGACCCAGACTGTGCAGCGGGAGCTGGAAACTCTTCCAACCACCAAGATGGCTCAGACCAACCC
TATGCCAGGGTCCATGGGGCCATGGAAGATAACCATCTATGATCAGGAGAACTTCCAGGGCAAG
AGGATGGAGTTCACCAGCTCCTGCCCAAATGTCTCTGAACGTAGTTTTGATAATGTCCGGTCAC
TTAAGGTGGAGTGTGGCGCAATCATAAAGAGTCTAAGATCACCATCTTTGAGAAAGAGAACTTT
ATTGGACGCCAGTGGGAGATCTGTGATGACTACCCTTCCTTACAAGCCATGGGTTGGTTCAACA
ATGAAGTGGGTTCCATGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_037188	(Get FASTA)	NCBI Sequence Viewer
	XP_017452534	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB67118	(Get FASTA)	NCBI Sequence Viewer
	CAA33241	(Get FASTA)	NCBI Sequence Viewer
	EDM05295	(Get FASTA)	NCBI Sequence Viewer
	P14881	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_037188 ⟸ NM_013056

- UniProtKB:

O35237 (UniProtKB/Swiss-Prot), P14881 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

METQTVQRELETLPTTKMAQTNPMPGSMGPWKITIYDQENFQGKRMEFTSSCPNVSERSFDNVR
SLKVECGAWIGYEHTSFCGQQFILERGEYPRWDAWSGSNAYHIERLMSFRPICSANHKESKITI
FEKENFIGRQWEICDDYPSLQAMGWFNNEVGSMKIQCGAWVCYQYPGYRGYQYILECDHHGGDY
KHWREWGTHAQTSQIQSIRRIQQ

hide sequence

RefSeq Acc Id:	XP_017452534 ⟸ XM_017597045
- Peptide Label:	isoform X1
- Sequence:	show sequence METQTVQRELETLPTTKMAQTNPMPGSMGPWKITIYDQENFQGKRMEFTSSCPNVSERSFDNVR SLKVECGAIIKSLRSPSLRKRTLLDASGRSVMTTLPYKPWVGSTMKWVP hide sequence

RefSeq Acc Id:

ENSRNOP00000011608 ⟸ ENSRNOT00000011608

RefSeq Acc Id:

ENSRNOP00000090008 ⟸ ENSRNOT00000100169

Protein Domains

Beta/gamma crystallin 'Greek key'

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P14881-F1-model_v2	AlphaFold	P14881	1-215	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697461

Promoter ID:

EPDNEW_R7986

Type:

single initiation site

Name:

Cryba1_1

Description:

crystallin, beta A1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	65,161,152 - 65,161,212	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2415	AgrOrtholog
BioCyc Gene	G2FUF-24116	BioCyc
Ensembl Genes	ENSRNOG00000008700	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000011608	ENTREZGENE
	ENSRNOP00000011608.4	UniProtKB/Swiss-Prot
	ENSRNOP00000090008.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000011608	ENTREZGENE
	ENSRNOT00000011608.7	UniProtKB/Swiss-Prot
	ENSRNOT00000100169.1	UniProtKB/TrEMBL
Gene3D-CATH	Crystallins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Beta/gamma_crystallin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_crystallin-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25583	UniProtKB/Swiss-Prot
NCBI Gene	25583	ENTREZGENE
PANTHER	BETA-CRYSTALLIN A3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	BETA/GAMMA CRYSTALLIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Crystall	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Cryba1	PhenoGen
PRINTS	BGCRYSTALLIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	CRYSTALLIN_BETA_GAMMA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	XTALbg	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF49695	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6GIJ4_RAT	UniProtKB/TrEMBL
	CRBA1_RAT	UniProtKB/Swiss-Prot
	O35237	ENTREZGENE
	P14881	ENTREZGENE
UniProt Secondary	O35237	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Cryba1	Crystallin, beta A1			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains two globular domains	727776

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Mammalian Phenotype