Symbol:
CSGALNACT1
Name:
chondroitin sulfate N-acetylgalactosaminyltransferase 1
RGD ID:
1601858
HGNC Page
HGNC:24290
Description:
Enables hexosyltransferase activity. Involved in chondroitin sulfate proteoglycan biosynthetic process and nucleotide-sugar metabolic process. Predicted to be located in Golgi membrane. Predicted to be active in Golgi apparatus.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
beta4GalNAcT; beta4GalNAcT-1; ChGn; ChGn-1; chondroitin beta-1,4-N-acetylgalactosaminyltransferase 1; chondroitin beta1,4 N-acetylgalactosaminyltransferase; CSGalNAcT-1; FLJ11264; FLJ13760; glucuronylgalactosylproteoglycan 4-beta-N- acetylgalactosaminyltransferase; SDJLABA
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Csgalnact1 (chondroitin sulfate N-acetylgalactosaminyltransferase 1) HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Csgalnact1 (chondroitin sulfate N-acetylgalactosaminyltransferase 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Csgalnact1 (chondroitin sulfate N-acetylgalactosaminyltransferase 1) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
CSGALNACT1 (chondroitin sulfate N-acetylgalactosaminyltransferase 1) NCBI
Ortholog
Canis lupus familiaris (dog):
CSGALNACT1 (chondroitin sulfate N-acetylgalactosaminyltransferase 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Csgalnact1 (chondroitin sulfate N-acetylgalactosaminyltransferase 1) NCBI
Ortholog
Sus scrofa (pig):
CSGALNACT1 (chondroitin sulfate N-acetylgalactosaminyltransferase 1) HGNC
Ensembl, Inparanoid, NCBI, OrthoDB, Panther
Chlorocebus sabaeus (green monkey):
CSGALNACT1 (chondroitin sulfate N-acetylgalactosaminyltransferase 1) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Csgalnact1 (chondroitin sulfate N-acetylgalactosaminyltransferase 1) NCBI
Ortholog
Other homologs 2
Sus scrofa (pig):
LOC100517735 (chondroitin sulfate N-acetylgalactosaminyltransferase 1) HGNC
EggNOG, Panther, Treefam
Mus musculus (house mouse):
Csgalnact2 (chondroitin sulfate N-acetylgalactosaminyltransferase 2) HGNC
OrthoMCL
Rattus norvegicus (Norway rat):
Lrif1 (ligand dependent nuclear receptor interacting factor 1) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Csgalnact1 (chondroitin sulfate N-acetylgalactosaminyltransferase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Csgalnact1 (chondroitin sulfate N-acetylgalactosaminyltransferase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
csgalnact1a (chondroitin sulfate N-acetylgalactosaminyltransferase 1a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
csgalnact1b (chondroitin sulfate N-acetylgalactosaminyltransferase 1b)
Alliance
DIOPT (Ensembl Compara|PANTHER|PhylomeDB|ZFIN)
Drosophila melanogaster (fruit fly):
CG12913
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
csgalnact1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
csgalnact1.L
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
csgalnact1.S
Alliance
DIOPT (Xenbase)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 19,404,161 - 19,757,908 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 19,404,161 - 19,758,029 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 19,261,672 - 19,615,419 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 19,305,952 - 19,584,374 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 8 18,225,010 - 18,503,692 (-) NCBI Celera Cytogenetic Map 8 p21.3 NCBI HuRef 8 17,801,989 - 18,080,455 (-) NCBI HuRef CHM1_1 8 19,463,117 - 19,741,804 (-) NCBI CHM1_1 T2T-CHM13v2.0 8 19,669,045 - 20,022,919 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
CSGALNACT1 Human genetic disease IAGP (Homo sapiens) 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:25741868 and PMID:28492532 CSGALNACT1 Human genetic disease IAGP (Homo sapiens) more ... 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar CSGALNACT1 Human genetic disease IAGP (Homo sapiens) more ... 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:28492532 CSGALNACT1 Human hereditary spastic paraplegia 53 IAGP (Homo sapiens) 8554872 ClinVar Annotator: match by term: Hereditary spastic paraplegia 53 ClinVar PMID:28492532 CSGALNACT1 Human SKELETAL DYSPLASIA, MILD, WITH JOINT LAXITY AND ADVANCED BONE AGE IAGP (Homo sapiens) and (Homo sapiens) 8554872 ClinVar Annotator: match by term: Skeletal dysplasia more ... ClinVar PMID:25741868 CSGALNACT1 Human SKELETAL DYSPLASIA, MILD, WITH JOINT LAXITY AND ADVANCED BONE AGE IAGP (Homo sapiens) and (Homo sapiens) 8554872 ClinVar Annotator: match by term: Skeletal dysplasia more ... ClinVar PMID:25741868 and PMID:31705726 CSGALNACT1 Human SKELETAL DYSPLASIA, MILD, WITH JOINT LAXITY AND ADVANCED BONE AGE IAGP (Homo sapiens) more ... 8554872 ClinVar Annotator: match by term: CSGALNACT1-related condition ClinVar PMID:28492532 CSGALNACT1 Human SKELETAL DYSPLASIA, MILD, WITH JOINT LAXITY AND ADVANCED BONE AGE IAGP (Homo sapiens) and (Homo sapiens) 8554872 ClinVar more ... ClinVar CSGALNACT1 Human SKELETAL DYSPLASIA, MILD, WITH JOINT LAXITY AND ADVANCED BONE AGE IAGP (Homo sapiens) more ... 8554872 ClinVar more ... ClinVar PMID:25741868 and PMID:28492532 CSGALNACT1 Human SKELETAL DYSPLASIA, MILD, WITH JOINT LAXITY AND ADVANCED BONE AGE IAGP (Homo sapiens) 8554872 ClinVar Annotator: match by term: Skeletal dysplasia more ... ClinVar PMID:25741868 more ... CSGALNACT1 Human SKELETAL DYSPLASIA, MILD, WITH JOINT LAXITY AND ADVANCED BONE AGE IAGP (Homo sapiens) 8554872 ClinVar Annotator: match by term: Skeletal dysplasia more ... ClinVar PMID:27599773 and PMID:31705726 CSGALNACT1 Human SKELETAL DYSPLASIA, MILD, WITH JOINT LAXITY AND ADVANCED BONE AGE IAGP (Homo sapiens) 8554872 ClinVar Annotator: match by term: Skeletal dysplasia more ... ClinVar PMID:31325655
Only show annotations with direct experimental evidence (0 objects hidden)
CSGALNACT1 Human 17beta-estradiol multiple interactions EXP 6480464 EGF protein inhibits the reaction [Estradiol results in decreased expression of CSGALNACT1 mRNA] CTD PMID:24758408 CSGALNACT1 Human 17beta-estradiol multiple interactions ISO Csgalnact1 (Rattus norvegicus) 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of CSGALNACT1 mRNA CTD PMID:32741896 CSGALNACT1 Human 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of CSGALNACT1 mRNA CTD PMID:24758408 CSGALNACT1 Human 17beta-estradiol 3-benzoate multiple interactions ISO Csgalnact1 (Rattus norvegicus) 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of CSGALNACT1 mRNA CTD PMID:32741896 CSGALNACT1 Human 17beta-hydroxy-5alpha-androstan-3-one increases expression EXP 6480464 Dihydrotestosterone results in increased expression of CSGALNACT1 mRNA CTD PMID:29581250 CSGALNACT1 Human 2,2',5,5'-tetrachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:36804509 CSGALNACT1 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Csgalnact1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CSGALNACT1 mRNA CTD PMID:34747641 CSGALNACT1 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Csgalnact1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of CSGALNACT1 mRNA CTD PMID:33387578 CSGALNACT1 Human 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Csgalnact1 (Rattus norvegicus) 6480464 tetrabromobisphenol A results in decreased expression of CSGALNACT1 mRNA CTD PMID:28300664 CSGALNACT1 Human 4,4'-sulfonyldiphenol increases expression ISO Csgalnact1 (Mus musculus) 6480464 bisphenol S results in increased expression of CSGALNACT1 mRNA CTD PMID:30951980 CSGALNACT1 Human 4-hydroxyphenyl retinamide increases expression ISO Csgalnact1 (Mus musculus) 6480464 Fenretinide results in increased expression of CSGALNACT1 mRNA CTD PMID:28973697 CSGALNACT1 Human acetamide increases expression ISO Csgalnact1 (Rattus norvegicus) 6480464 acetamide results in increased expression of CSGALNACT1 mRNA CTD PMID:31881176 CSGALNACT1 Human aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of CSGALNACT1 mRNA CTD PMID:21632981 CSGALNACT1 Human aflatoxin B1 decreases expression ISO Csgalnact1 (Rattus norvegicus) 6480464 Aflatoxin B1 results in decreased expression of CSGALNACT1 mRNA CTD PMID:33354967 CSGALNACT1 Human aflatoxin B1 decreases methylation EXP 6480464 Aflatoxin B1 results in decreased methylation of CSGALNACT1 intron CTD PMID:30157460 CSGALNACT1 Human aflatoxin B1 increases methylation EXP 6480464 Aflatoxin B1 results in increased methylation of CSGALNACT1 gene CTD PMID:27153756 CSGALNACT1 Human all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of CSGALNACT1 mRNA CTD PMID:21934132 and PMID:33167477 CSGALNACT1 Human alpha-Zearalanol multiple interactions ISO Csgalnact1 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CSGALNACT1 mRNA CTD PMID:35163327 CSGALNACT1 Human antirheumatic drug decreases expression EXP 6480464 Antirheumatic Agents results in decreased expression of CSGALNACT1 mRNA CTD PMID:24449571 CSGALNACT1 Human arsenous acid increases expression EXP 6480464 Arsenic Trioxide results in increased expression of CSGALNACT1 mRNA CTD PMID:20458559 CSGALNACT1 Human atrazine affects methylation ISO Csgalnact1 (Rattus norvegicus) 6480464 Atrazine affects the methylation of CSGALNACT1 gene CTD PMID:35440735 CSGALNACT1 Human benzo[a]pyrene decreases expression ISO Csgalnact1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of CSGALNACT1 mRNA CTD PMID:21569818 CSGALNACT1 Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of CSGALNACT1 5' UTR and Benzo(a)pyrene affects the methylation of CSGALNACT1 promoter CTD PMID:27901495 CSGALNACT1 Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of CSGALNACT1 exon CTD PMID:27901495 CSGALNACT1 Human benzo[a]pyrene increases expression ISO Csgalnact1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of CSGALNACT1 mRNA CTD PMID:22228805 and PMID:22610609 CSGALNACT1 Human benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of CSGALNACT1 mRNA CTD PMID:20106945 and PMID:21632981 CSGALNACT1 Human benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of CSGALNACT1 mRNA CTD PMID:22316170 CSGALNACT1 Human benzo[a]pyrene decreases expression ISO Csgalnact1 (Rattus norvegicus) 6480464 Benzo(a)pyrene results in decreased expression of CSGALNACT1 mRNA CTD PMID:21839799 CSGALNACT1 Human benzo[a]pyrene diol epoxide I affects expression EXP 6480464 7 more ... CTD PMID:20382639 CSGALNACT1 Human benzo[a]pyrene diol epoxide I decreases expression EXP 6480464 7 more ... CTD PMID:19150397 CSGALNACT1 Human bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of CSGALNACT1 mRNA CTD PMID:31163220 CSGALNACT1 Human bisphenol A decreases expression ISO Csgalnact1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of CSGALNACT1 mRNA CTD PMID:25181051 more ... CSGALNACT1 Human bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of CSGALNACT1 gene CTD PMID:31601247 CSGALNACT1 Human bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of CSGALNACT1 gene CTD PMID:31601247 CSGALNACT1 Human bisphenol A increases expression ISO Csgalnact1 (Mus musculus) 6480464 bisphenol A results in increased expression of CSGALNACT1 mRNA CTD PMID:30951980 and PMID:35479511 CSGALNACT1 Human bisphenol A increases methylation ISO Csgalnact1 (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of CSGALNACT1 gene CTD PMID:28505145 CSGALNACT1 Human bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CSGALNACT1 mRNA CTD PMID:27685785 CSGALNACT1 Human bisphenol F increases expression ISO Csgalnact1 (Mus musculus) 6480464 bisphenol F results in increased expression of CSGALNACT1 mRNA CTD PMID:30951980 CSGALNACT1 Human butanal decreases expression EXP 6480464 butyraldehyde results in decreased expression of CSGALNACT1 mRNA CTD PMID:26079696 CSGALNACT1 Human cadmium atom multiple interactions ISO Csgalnact1 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of CSGALNACT1 mRNA CTD PMID:37325564 CSGALNACT1 Human cadmium dichloride multiple interactions ISO Csgalnact1 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of CSGALNACT1 mRNA CTD PMID:37325564 CSGALNACT1 Human calcitriol increases expression EXP 6480464 Calcitriol results in increased expression of CSGALNACT1 mRNA CTD PMID:21592394 CSGALNACT1 Human calcitriol multiple interactions EXP 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of CSGALNACT1 mRNA CTD PMID:21592394 CSGALNACT1 Human carbamazepine affects expression EXP 6480464 Carbamazepine affects the expression of CSGALNACT1 mRNA CTD PMID:25979313 CSGALNACT1 Human carmustine affects response to substance EXP 6480464 CSGALNACT1 mRNA affects the susceptibility to Carmustine CTD PMID:16365179 CSGALNACT1 Human cisplatin multiple interactions EXP 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of CSGALNACT1 mRNA CTD PMID:27392435 CSGALNACT1 Human cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of CSGALNACT1 mRNA CTD PMID:19376846 CSGALNACT1 Human copper(II) sulfate decreases expression EXP 6480464 Copper Sulfate results in decreased expression of CSGALNACT1 mRNA CTD PMID:19549813 CSGALNACT1 Human cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of CSGALNACT1 mRNA CTD PMID:27989131 CSGALNACT1 Human cylindrospermopsin increases expression EXP 6480464 cylindrospermopsin results in increased expression of CSGALNACT1 mRNA CTD PMID:24921660 CSGALNACT1 Human diarsenic trioxide increases expression EXP 6480464 Arsenic Trioxide results in increased expression of CSGALNACT1 mRNA CTD PMID:20458559 CSGALNACT1 Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of CSGALNACT1 mRNA CTD PMID:37042841 CSGALNACT1 Human diethylstilbestrol increases expression ISO Csgalnact1 (Rattus norvegicus) 6480464 Diethylstilbestrol results in increased expression of CSGALNACT1 mRNA CTD PMID:17005392 CSGALNACT1 Human dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of CSGALNACT1 mRNA CTD PMID:26516004 CSGALNACT1 Human diquat decreases expression ISO Csgalnact1 (Mus musculus) 6480464 Diquat results in decreased expression of CSGALNACT1 mRNA CTD PMID:36851058 CSGALNACT1 Human diuron decreases expression ISO Csgalnact1 (Rattus norvegicus) 6480464 Diuron results in decreased expression of CSGALNACT1 mRNA CTD PMID:25152437 CSGALNACT1 Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 CSGALNACT1 Human endosulfan decreases expression ISO Csgalnact1 (Rattus norvegicus) 6480464 Endosulfan results in decreased expression of CSGALNACT1 mRNA CTD PMID:29391264 CSGALNACT1 Human enzalutamide decreases expression EXP 6480464 enzalutamide results in decreased expression of CSGALNACT1 mRNA CTD PMID:29581250 CSGALNACT1 Human ethanol affects expression ISO Csgalnact1 (Mus musculus) 6480464 Ethanol affects the expression of CSGALNACT1 mRNA CTD PMID:30319688 CSGALNACT1 Human etoposide affects response to substance EXP 6480464 CSGALNACT1 protein affects the susceptibility to Etoposide CTD PMID:16217747 CSGALNACT1 Human fulvestrant multiple interactions EXP 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of CSGALNACT1 gene CTD PMID:31601247 CSGALNACT1 Human gentamycin increases expression ISO Csgalnact1 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of CSGALNACT1 mRNA CTD PMID:33387578 CSGALNACT1 Human hydrogen peroxide affects expression EXP 6480464 Hydrogen Peroxide affects the expression of CSGALNACT1 mRNA CTD PMID:20044591 CSGALNACT1 Human hydroquinone increases expression EXP 6480464 hydroquinone results in increased expression of CSGALNACT1 mRNA CTD PMID:31256213 CSGALNACT1 Human lead(0) affects expression EXP 6480464 Lead affects the expression of CSGALNACT1 mRNA CTD PMID:28903495 CSGALNACT1 Human lipopolysaccharide multiple interactions EXP 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CSGALNACT1 mRNA CTD PMID:35811015 CSGALNACT1 Human MeIQx decreases expression EXP 6480464 2-amino-3 more ... CTD PMID:20816883 CSGALNACT1 Human niclosamide multiple interactions EXP 6480464 Niclosamide inhibits the reaction [PIK3CA protein modified form results in decreased expression of CSGALNACT1 mRNA] CTD PMID:27542212 CSGALNACT1 Human oxaliplatin multiple interactions ISO Csgalnact1 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CSGALNACT1 mRNA CTD PMID:25729387 CSGALNACT1 Human ozone multiple interactions ISO Csgalnact1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of CSGALNACT1 mRNA CTD PMID:34911549 CSGALNACT1 Human paracetamol increases expression ISO Csgalnact1 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of CSGALNACT1 mRNA CTD PMID:33387578 CSGALNACT1 Human perfluorooctanoic acid multiple interactions ISO Csgalnact1 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CSGALNACT1 mRNA CTD PMID:35163327 CSGALNACT1 Human phenylmercury acetate increases expression EXP 6480464 Phenylmercuric Acetate results in increased expression of CSGALNACT1 mRNA CTD PMID:26272509 CSGALNACT1 Human phenylmercury acetate multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CSGALNACT1 mRNA CTD PMID:27188386 CSGALNACT1 Human pyrvinium multiple interactions EXP 6480464 pyrvinium inhibits the reaction [PIK3CA protein modified form results in decreased expression of CSGALNACT1 mRNA] CTD PMID:27542212 CSGALNACT1 Human quercetin increases expression EXP 6480464 Quercetin results in increased expression of CSGALNACT1 mRNA CTD PMID:21632981 CSGALNACT1 Human resveratrol multiple interactions EXP 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of CSGALNACT1 mRNA CTD PMID:23557933 CSGALNACT1 Human S-(1,2-dichlorovinyl)-L-cysteine multiple interactions EXP 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CSGALNACT1 mRNA CTD PMID:35811015 CSGALNACT1 Human SB 431542 multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 CSGALNACT1 Human silicon dioxide increases expression EXP 6480464 Silicon Dioxide analog results in increased expression of CSGALNACT1 mRNA CTD PMID:23806026 CSGALNACT1 Human silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of CSGALNACT1 mRNA CTD PMID:34973136 CSGALNACT1 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of CSGALNACT1 mRNA CTD PMID:29301061 and PMID:38568856 CSGALNACT1 Human Soman decreases expression ISO Csgalnact1 (Rattus norvegicus) 6480464 Soman results in decreased expression of CSGALNACT1 mRNA CTD PMID:19281266 CSGALNACT1 Human succimer multiple interactions EXP 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of CSGALNACT1 mRNA CTD PMID:26378955 CSGALNACT1 Human temozolomide affects response to substance EXP 6480464 CSGALNACT1 mRNA affects the susceptibility to temozolomide CTD PMID:16365179 CSGALNACT1 Human testosterone multiple interactions EXP 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of CSGALNACT1 mRNA CTD PMID:21592394 CSGALNACT1 Human testosterone multiple interactions ISO Csgalnact1 (Rattus norvegicus) 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of CSGALNACT1 mRNA CTD PMID:32741896 CSGALNACT1 Human testosterone increases expression EXP 6480464 Testosterone results in increased expression of CSGALNACT1 mRNA CTD PMID:21592394 CSGALNACT1 Human titanium dioxide decreases methylation ISO Csgalnact1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CSGALNACT1 gene CTD PMID:35295148 CSGALNACT1 Human topotecan multiple interactions ISO Csgalnact1 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CSGALNACT1 mRNA CTD PMID:25729387 CSGALNACT1 Human trimellitic anhydride decreases expression ISO Csgalnact1 (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of CSGALNACT1 mRNA CTD PMID:19042947 CSGALNACT1 Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of CSGALNACT1 mRNA CTD PMID:37042841 CSGALNACT1 Human valproic acid decreases methylation EXP 6480464 Valproic Acid results in decreased methylation of CSGALNACT1 gene CTD PMID:29154799 CSGALNACT1 Human valproic acid multiple interactions EXP 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CSGALNACT1 mRNA CTD PMID:27188386 CSGALNACT1 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of CSGALNACT1 mRNA CTD PMID:23179753 more ... CSGALNACT1 Human zidovudine multiple interactions EXP 6480464 [Zidovudine co-treated with IFNA1 protein] results in increased expression of CSGALNACT1 mRNA CTD PMID:20370541
Imported Annotations - KEGG (archival)
17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (ISO) 17beta-hydroxy-5alpha-androstan-3-one (EXP) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) acetamide (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (EXP) alpha-Zearalanol (ISO) antirheumatic drug (EXP) arsenous acid (EXP) atrazine (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (EXP) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (EXP) cadmium atom (ISO) cadmium dichloride (ISO) calcitriol (EXP) carbamazepine (EXP) carmustine (EXP) cisplatin (EXP) cobalt dichloride (EXP) copper(II) sulfate (EXP) cyclosporin A (EXP) cylindrospermopsin (EXP) diarsenic trioxide (EXP) Dibutyl phosphate (EXP) diethylstilbestrol (ISO) dioxygen (EXP) diquat (ISO) diuron (ISO) dorsomorphin (EXP) endosulfan (ISO) enzalutamide (EXP) ethanol (ISO) etoposide (EXP) fulvestrant (EXP) gentamycin (ISO) hydrogen peroxide (EXP) hydroquinone (EXP) lead(0) (EXP) lipopolysaccharide (EXP) MeIQx (EXP) niclosamide (EXP) oxaliplatin (ISO) ozone (ISO) paracetamol (ISO) perfluorooctanoic acid (ISO) phenylmercury acetate (EXP) pyrvinium (EXP) quercetin (EXP) resveratrol (EXP) S-(1,2-dichlorovinyl)-L-cysteine (EXP) SB 431542 (EXP) silicon dioxide (EXP) sodium arsenite (EXP) Soman (ISO) succimer (EXP) temozolomide (EXP) testosterone (EXP,ISO) titanium dioxide (ISO) topotecan (ISO) trimellitic anhydride (ISO) triphenyl phosphate (EXP) valproic acid (EXP) zidovudine (EXP)
CSGALNACT1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 19,404,161 - 19,757,908 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 19,404,161 - 19,758,029 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 19,261,672 - 19,615,419 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 19,305,952 - 19,584,374 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 8 18,225,010 - 18,503,692 (-) NCBI Celera Cytogenetic Map 8 p21.3 NCBI HuRef 8 17,801,989 - 18,080,455 (-) NCBI HuRef CHM1_1 8 19,463,117 - 19,741,804 (-) NCBI CHM1_1 T2T-CHM13v2.0 8 19,669,045 - 20,022,919 (-) NCBI T2T-CHM13v2.0
Csgalnact1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 68,809,433 - 69,188,270 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 68,809,433 - 69,187,798 (-) Ensembl GRCm39 Ensembl GRCm38 8 68,356,781 - 68,735,621 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 68,356,781 - 68,735,146 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 70,880,682 - 71,259,041 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 71,285,783 - 71,664,123 (-) NCBI MGSCv36 mm8 Celera 8 70,901,764 - 71,270,170 (-) NCBI Celera Cytogenetic Map 8 B3.3 NCBI cM Map 8 33.88 NCBI
Csgalnact1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 25,761,946 - 26,097,306 (+) NCBI GRCr8 mRatBN7.2 16 20,995,210 - 21,330,586 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 21,235,784 - 21,330,319 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 24,611,968 - 24,709,528 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 28,042,972 - 28,141,568 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 23,977,291 - 24,074,861 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 22,704,318 - 23,075,071 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 22,979,444 - 23,074,798 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 22,733,680 - 22,963,531 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 22,852,516 - 22,947,139 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 22,852,484 - 22,946,543 (+) NCBI Celera 16 21,395,359 - 21,488,688 (+) NCBI Celera Cytogenetic Map 16 p14 NCBI
Csgalnact1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955403 43,178,520 - 43,478,885 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955403 43,178,520 - 43,347,121 (-) NCBI ChiLan1.0 ChiLan1.0
CSGALNACT1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 37,883,225 - 38,236,716 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 13,608,924 - 13,962,206 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 18,626,998 - 18,980,416 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 15,576,416 - 15,929,342 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 15,576,416 - 15,904,123 (-) Ensembl panpan1.1 panPan2
CSGALNACT1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 16 22,219,324 - 22,546,501 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 16 22,219,861 - 22,392,937 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 16 22,724,714 - 23,051,863 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 16 23,960,246 - 24,287,450 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 16 23,961,632 - 24,286,927 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 16 22,317,927 - 22,427,544 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 16 22,903,836 - 23,231,159 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 16 22,955,384 - 23,282,687 (-) NCBI UU_Cfam_GSD_1.0
Csgalnact1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404943 14,762,965 - 14,931,054 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936555 3,637,630 - 3,807,488 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936555 3,639,459 - 3,807,483 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CSGALNACT1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 12,428,893 - 12,498,585 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 12,145,141 - 12,498,777 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 10,059,885 - 10,154,331 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CSGALNACT1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 17,494,312 - 17,851,497 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 17,494,187 - 17,695,037 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666052 24,650,059 - 24,756,656 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Csgalnact1
.
GRCh38/hg38 8p23.1-11.21(chr8:12609975-42085703)x3 copy number gain
See cases [RCV000050294 ]
Chr8:12609975..42085703 [GRCh38]
pathogenic
GRCh38/hg38 8p23.3-21.1(chr8:2475295-27504279)x1 copy number loss
See cases [RCV000050297 ]
Chr8:2475295..27504279 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-11.1(chr8:12728904-43673207)x3 copy number gain
See cases [RCV000050912 ]
Chr8:12728904..43673207 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-12(chr8:12383584-36370018)x3 copy number gain
See cases [RCV000051145 ]
Chr8:12383584..36370018 [GRCh38]
pathogenic
GRCh38/hg38 8p23.3-q24.3(chr8:241530-145049449)x3 copy number gain
See cases [RCV000051206 ]
Chr8:241530..145049449 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-11.21(chr8:12728904-41928741)x3 copy number gain
See cases [RCV000051110 ]
Chr8:12728904..41928741 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-11.23(chr8:12609975-37892000)x3 copy number gain
See cases [RCV000053629 ]
Chr8:12609975..37892000 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-11.1(chr8:12609975-43336172)x3 copy number gain
See cases [RCV000053630 ]
Chr8:12609975..43336172 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-11.1(chr8:12609975-43255410)x3 copy number gain
Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053631 ]|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053631 ]|See cases [RCV000053631 ]
Chr8:12609975..43255410 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-11.1(chr8:12750796-43532444)x3 copy number gain
See cases [RCV000053632 ]
Chr8:12750796..43532444 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-12(chr8:12750796-29445409)x3 copy number gain
See cases [RCV000053633 ]
Chr8:12750796..29445409 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-21.3(chr8:12787272-20952389)x3 copy number gain
See cases [RCV000053634 ]
Chr8:12787272..20952389 [GRCh38]
pathogenic
GRCh38/hg38 8p22-q11.21(chr8:14940110-47929925)x3 copy number gain
See cases [RCV000053635 ]
Chr8:14940110..47929925 [GRCh38]
pathogenic
GRCh38/hg38 8p23.3-q24.3(chr8:241530-145054634)x3 copy number gain
See cases [RCV000053602 ]
Chr8:241530..145054634 [GRCh38]
pathogenic
GRCh38/hg38 8p23.3-q24.3(chr8:244417-145054775)x3 copy number gain
Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053604 ]|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053604 ]|See cases [RCV000053604 ]
Chr8:244417..145054775 [GRCh38]
pathogenic
GRCh38/hg38 8p23.3-12(chr8:96310-30614703)x3 copy number gain
See cases [RCV000053599 ]
Chr8:96310..30614703 [GRCh38]
pathogenic
NM_001130518.1(CSGALNACT1):c.-297+36834G>A single nucleotide variant
Lung cancer [RCV000107260 ]
Chr8:19554326 [GRCh38]
uncertain significance
GRCh37/hg19 8p23.3-11.1(chr8:176814-43396776) copy number gain
Abnormal fetal cardiovascular morphology [RCV001291977 ]
Chr8:176814..43396776 [GRCh37]
pathogenic
GRCh38/hg38 8p23.1-21.3(chr8:12732530-20436882)x3 copy number gain
See cases [RCV000135294 ]
Chr8:12732530..20436882 [GRCh38]
pathogenic
GRCh38/hg38 8p22-21.3(chr8:18988335-19599269)x3 copy number gain
See cases [RCV000135831 ]
Chr8:18988335..19599269 [GRCh38]
benign
GRCh38/hg38 8p23.1-11.1(chr8:12609975-43673207)x3 copy number gain
See cases [RCV000135786 ]
Chr8:12609975..43673207 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-11.1(chr8:12383584-43673207)x3 copy number gain
See cases [RCV000135566 ]
Chr8:12383584..43673207 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-11.21(chr8:12728904-40169194)x3 copy number gain
See cases [RCV000136516 ]
Chr8:12728904..40169194 [GRCh38]
pathogenic
GRCh38/hg38 8p23.3-21.3(chr8:241530-23198398)x3 copy number gain
See cases [RCV000135967 ]
Chr8:241530..23198398 [GRCh38]
pathogenic
GRCh38/hg38 8p23.3-21.2(chr8:241605-24656971)x3 copy number gain
See cases [RCV000136026 ]
Chr8:241605..24656971 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-12(chr8:12725750-30180521)x3 copy number gain
See cases [RCV000136825 ]
Chr8:12725750..30180521 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-11.1(chr8:12182421-43673207)x3 copy number gain
See cases [RCV000137249 ]
Chr8:12182421..43673207 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-12(chr8:12698495-35476082)x3 copy number gain
See cases [RCV000138058 ]
Chr8:12698495..35476082 [GRCh38]
pathogenic
GRCh38/hg38 8p23.3-11.23(chr8:226452-38021728)x3 copy number gain
See cases [RCV000137807 ]
Chr8:226452..38021728 [GRCh38]
pathogenic|likely pathogenic
GRCh38/hg38 8p23.3-12(chr8:241605-31091074)x3 copy number gain
See cases [RCV000138831 ]
Chr8:241605..31091074 [GRCh38]
pathogenic
GRCh38/hg38 8p23.3-q24.3(chr8:241605-145054781)x3 copy number gain
See cases [RCV000138643 ]
Chr8:241605..145054781 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-21.1(chr8:12382844-28625564)x3 copy number gain
See cases [RCV000138244 ]
Chr8:12382844..28625564 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-11.22(chr8:7141697-38695546)x3 copy number gain
See cases [RCV000139891 ]
Chr8:7141697..38695546 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-11.22(chr8:12729023-39235934)x3 copy number gain
See cases [RCV000139770 ]
Chr8:12729023..39235934 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-11.1(chr8:12646123-43686843)x3 copy number gain
See cases [RCV000139796 ]
Chr8:12646123..43686843 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-11.23(chr8:11851113-37216333)x3 copy number gain
See cases [RCV000139549 ]
Chr8:11851113..37216333 [GRCh38]
pathogenic
GRCh38/hg38 8p23.3-12(chr8:226452-34491890)x3 copy number gain
See cases [RCV000141410 ]
Chr8:226452..34491890 [GRCh38]
pathogenic
GRCh38/hg38 8p23.3-q24.3(chr8:208048-145070385)x3 copy number gain
See cases [RCV000141808 ]
Chr8:208048..145070385 [GRCh38]
pathogenic
GRCh38/hg38 8p23.3-q24.3(chr8:226452-145068712)x3 copy number gain
See cases [RCV000142858 ]
Chr8:226452..145068712 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-12(chr8:12383584-29033946)x1 copy number loss
See cases [RCV000142516 ]
Chr8:12383584..29033946 [GRCh38]
pathogenic
GRCh38/hg38 8p22-12(chr8:18972996-33619264)x1 copy number loss
See cases [RCV000142747 ]
Chr8:18972996..33619264 [GRCh38]
pathogenic
GRCh38/hg38 8p23.3-q24.3(chr8:241530-145054634)x3 copy number gain
See cases [RCV000148092 ]
Chr8:241530..145054634 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-11.21(chr8:12633490-40685533)x3 copy number gain
See cases [RCV000143508 ]
Chr8:12633490..40685533 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-11.1(chr8:12728904-43673207)x3 copy number gain
See cases [RCV000148237 ]
Chr8:12728904..43673207 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-11.21(chr8:12609975-42085703)x3 copy number gain
See cases [RCV000148249 ]
Chr8:12609975..42085703 [GRCh38]
pathogenic
GRCh38/hg38 8p23.2-21.1(chr8:2475295-27504279)x1 copy number loss
See cases [RCV000148252 ]
Chr8:2475295..27504279 [GRCh38]
pathogenic
GRCh37/hg19 8p23.1-11.22(chr8:12528482-39593802)x3 copy number gain
See cases [RCV000511325 ]
Chr8:12528482..39593802 [GRCh37]
pathogenic
GRCh37/hg19 8p23.1-21.2(chr8:12580132-26774307)x3 copy number gain
See cases [RCV000239945 ]
Chr8:12580132..26774307 [GRCh37]
pathogenic
GRCh37/hg19 8p23.3-12(chr8:158048-30262760)x3 copy number gain
See cases [RCV000449225 ]
Chr8:158048..30262760 [GRCh37]
pathogenic
GRCh37/hg19 8p22-21.3(chr8:15935542-19321304)x3 copy number gain
See cases [RCV000446821 ]
Chr8:15935542..19321304 [GRCh37]
uncertain significance
GRCh37/hg19 8p22-21.3(chr8:18770061-19709425)x3 copy number gain
See cases [RCV000447250 ]
Chr8:18770061..19709425 [GRCh37]
likely benign
GRCh37/hg19 8p22-21.2(chr8:13091530-24483615) copy number loss
See cases [RCV000447428 ]
Chr8:13091530..24483615 [GRCh37]
pathogenic
GRCh37/hg19 8p23.3-11.1(chr8:158048-43786723)x3 copy number gain
See cases [RCV000447909 ]
Chr8:158048..43786723 [GRCh37]
pathogenic
GRCh37/hg19 8p23.1-11.1(chr8:12580132-43388233)x3 copy number gain
See cases [RCV000447913 ]
Chr8:12580132..43388233 [GRCh37]
pathogenic
GRCh37/hg19 8p22-12(chr8:16992973-32612724)x1 copy number loss
not provided [RCV000509389 ]
Chr8:16992973..32612724 [GRCh37]
not provided
GRCh37/hg19 8p23.3-q24.3(chr8:158049-146295771) copy number gain
See cases [RCV000510234 ]
Chr8:158049..146295771 [GRCh37]
pathogenic
GRCh37/hg19 8p23.1-12(chr8:12528482-33684786)x3 copy number gain
See cases [RCV000510571 ]
Chr8:12528482..33684786 [GRCh37]
pathogenic
GRCh37/hg19 8p22-21.3(chr8:18845744-19594010)x3 copy number gain
See cases [RCV000511789 ]
Chr8:18845744..19594010 [GRCh37]
uncertain significance
GRCh37/hg19 8p21.3(chr8:19108471-19816839)x3 copy number gain
See cases [RCV000511994 ]
Chr8:19108471..19816839 [GRCh37]
likely benign
GRCh37/hg19 8p23.1-11.1(chr8:11935023-43824035)x3 copy number gain
See cases [RCV000511028 ]
Chr8:11935023..43824035 [GRCh37]
pathogenic
GRCh37/hg19 8p23.3-q24.3(chr8:158049-146295771)x3 copy number gain
See cases [RCV000511095 ]
Chr8:158049..146295771 [GRCh37]
pathogenic
GRCh37/hg19 8p23.1-21.2(chr8:12580104-25947329) copy number gain
Autism [RCV000626542 ]
Chr8:12580104..25947329 [GRCh37]
pathogenic
GRCh37/hg19 8p23.1-q24.3(chr8:12490999-146295771)x3 copy number gain
See cases [RCV000512169 ]
Chr8:12490999..146295771 [GRCh37]
pathogenic
GRCh37/hg19 8p22-21.3(chr8:18831686-19340019)x3 copy number gain
See cases [RCV000512389 ]
Chr8:18831686..19340019 [GRCh37]
uncertain significance
GRCh37/hg19 8p22-21.3(chr8:18977653-19438015)x3 copy number gain
not provided [RCV000659242 ]
Chr8:18977653..19438015 [GRCh37]
likely benign
GRCh37/hg19 8p23.1-21.2(chr8:8770948-27079636)x3 copy number gain
not provided [RCV000683041 ]
Chr8:8770948..27079636 [GRCh37]
pathogenic
GRCh37/hg19 8p23.3-21.2(chr8:1825200-24533193)x3 copy number gain
not provided [RCV000683042 ]
Chr8:1825200..24533193 [GRCh37]
pathogenic
GRCh37/hg19 8p21.3(chr8:19145799-19472435)x3 copy number gain
not provided [RCV000682971 ]
Chr8:19145799..19472435 [GRCh37]
uncertain significance
GRCh37/hg19 8p23.3-q24.3(chr8:164984-146293414)x3 copy number gain
not provided [RCV000747254 ]
Chr8:164984..146293414 [GRCh37]
pathogenic
GRCh37/hg19 8p23.3-q24.3(chr8:10213-146293414)x3 copy number gain
not provided [RCV000747248 ]
Chr8:10213..146293414 [GRCh37]
pathogenic
GRCh37/hg19 8p21.3(chr8:19326083-19389865)x1 copy number loss
not provided [RCV000747464 ]
Chr8:19326083..19389865 [GRCh37]
benign
GRCh37/hg19 8p21.3(chr8:19342285-19446147)x1 copy number loss
not provided [RCV000747465 ]
Chr8:19342285..19446147 [GRCh37]
benign
GRCh37/hg19 8p21.3(chr8:19371057-19434698)x1 copy number loss
not provided [RCV000747466 ]
Chr8:19371057..19434698 [GRCh37]
benign
GRCh37/hg19 8p21.3(chr8:19371767-19434698)x1 copy number loss
not provided [RCV000747467 ]
Chr8:19371767..19434698 [GRCh37]
benign
NM_001354483.2(CSGALNACT1):c.1133-261G>A single nucleotide variant
not provided [RCV001690548 ]
Chr8:19419011 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.1132+34C>T single nucleotide variant
not provided [RCV001669153 ]
Chr8:19420306 [GRCh38]
benign
GRCh37/hg19 8p23.1-12(chr8:12556004-34374150)x3 copy number gain
not provided [RCV000762735 ]
Chr8:12556004..34374150 [GRCh37]
likely pathogenic
NM_001354483.2(CSGALNACT1):c.244C>T (p.Leu82Phe) single nucleotide variant
Inborn genetic diseases [RCV003268848 ]
Chr8:19505591 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.-296-322T>G single nucleotide variant
not provided [RCV001680516 ]
Chr8:19506452 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.1575_1576del (p.Lys526fs) deletion
not provided [RCV000883855 ]
Chr8:19405803..19405804 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.317T>C (p.Leu106Pro) single nucleotide variant
not provided [RCV000950165 ]
Chr8:19505518 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.1151C>G (p.Pro384Arg) single nucleotide variant
Skeletal dysplasia, mild, with joint laxity and advanced bone age [RCV001090035 ]|not provided [RCV002554803 ]
Chr8:19418732 [GRCh38]
pathogenic|likely pathogenic|uncertain significance
NM_001354483.2(CSGALNACT1):c.1294G>T (p.Asp432Tyr) single nucleotide variant
Skeletal dysplasia, mild, with joint laxity and advanced bone age [RCV001090038 ]
Chr8:19408628 [GRCh38]
pathogenic|likely pathogenic
GRCh37/hg19 8p22-21.3(chr8:18367759-19510286)x3 copy number gain
See cases [RCV000790591 ]
Chr8:18367759..19510286 [GRCh37]
uncertain significance
GRCh37/hg19 8p23.3-q24.3(chr8:158048-146295771) copy number gain
Polydactyly [RCV002280629 ]
Chr8:158048..146295771 [GRCh37]
pathogenic
Single allele duplication
not provided [RCV000768452 ]
Chr8:12546855..35816855 [GRCh37]
likely pathogenic
GRCh37/hg19 8p21.3(chr8:19147165-19472940)x3 copy number gain
not provided [RCV000848136 ]
Chr8:19147165..19472940 [GRCh37]
uncertain significance
GRCh37/hg19 8p21.3(chr8:19306261-19530403)x3 copy number gain
not provided [RCV000846475 ]
Chr8:19306261..19530403 [GRCh37]
uncertain significance
GRCh37/hg19 8p21.3(chr8:19514867-19643313)x1 copy number loss
not provided [RCV000848162 ]
Chr8:19514867..19643313 [GRCh37]
uncertain significance
GRCh37/hg19 8p22-21.3(chr8:18266233-20864195)x1 copy number loss
not provided [RCV000847806 ]
Chr8:18266233..20864195 [GRCh37]
uncertain significance
GRCh37/hg19 8p21.3(chr8:19502317-19600998)x1 copy number loss
not provided [RCV001006087 ]
Chr8:19502317..19600998 [GRCh37]
uncertain significance
GRCh37/hg19 8p21.3(chr8:19514867-19643313)x1 copy number loss
not provided [RCV000848125 ]
Chr8:19514867..19643313 [GRCh37]
uncertain significance
GRCh37/hg19 8p21.3(chr8:19514867-19643313)x1 copy number loss
not provided [RCV000848128 ]
Chr8:19514867..19643313 [GRCh37]
uncertain significance
GRCh37/hg19 8p21.3(chr8:19334399-19809695)x3 copy number gain
not provided [RCV001006086 ]
Chr8:19334399..19809695 [GRCh37]
uncertain significance
GRCh37/hg19 8p21.3(chr8:19170422-19451430)x3 copy number gain
not provided [RCV001006085 ]
Chr8:19170422..19451430 [GRCh37]
uncertain significance
GRCh37/hg19 8p23.3-q24.3(chr8:158048-146295771)x3 copy number gain
not provided [RCV000848478 ]
Chr8:158048..146295771 [GRCh37]
pathogenic
NC_000008.10:g.(?_19362692)_(19363345_?)dup duplication
not provided [RCV003105484 ]
Chr8:19362692..19363345 [GRCh37]
uncertain significance
NC_000008.10:g.(?_19276147)_(19316173_?)del deletion
not provided [RCV003105483 ]
Chr8:19276147..19316173 [GRCh37]
pathogenic
NM_001354483.2(CSGALNACT1):c.702C>T (p.His234=) single nucleotide variant
Skeletal dysplasia, mild, with joint laxity and advanced bone age [RCV001661316 ]|not provided [RCV002073075 ]
Chr8:19458575 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.851+92G>A single nucleotide variant
not provided [RCV001677446 ]
Chr8:19458334 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.578G>A (p.Ser193Asn) single nucleotide variant
Skeletal dysplasia, mild, with joint laxity and advanced bone age [RCV001661317 ]|not provided [RCV001694153 ]
Chr8:19505257 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.852-140C>G single nucleotide variant
not provided [RCV001647730 ]
Chr8:19440071 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.1228-233C>T single nucleotide variant
not provided [RCV001635774 ]
Chr8:19408927 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.852-325A>G single nucleotide variant
not provided [RCV001530642 ]
Chr8:19440256 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.852-141T>C single nucleotide variant
not provided [RCV001621130 ]
Chr8:19440072 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.953+290G>A single nucleotide variant
not provided [RCV001685135 ]
Chr8:19439540 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.1133-295G>C single nucleotide variant
not provided [RCV001689138 ]
Chr8:19419045 [GRCh38]
benign
NC_000008.10:g.19340642_19425619delinsA indel
Skeletal dysplasia, mild, with joint laxity and advanced bone age [RCV001090037 ]
Chr8:19340642..19425619 [GRCh37]
pathogenic
NM_001354483.2(CSGALNACT1):c.-80G>A single nucleotide variant
not provided [RCV001612911 ]
Chr8:19505914 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.1132+116T>C single nucleotide variant
not provided [RCV001709401 ]
Chr8:19420224 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.*288C>T single nucleotide variant
not provided [RCV001685303 ]
Chr8:19405492 [GRCh38]
benign
NC_000008.11:g.19411890_19467180del deletion
Skeletal dysplasia, mild, with joint laxity and advanced bone age [RCV001090034 ]
Chr8:19411890..19467180 [GRCh38]
pathogenic
NM_001354483.2(CSGALNACT1):c.372del (p.His125fs) deletion
Skeletal dysplasia, mild, with joint laxity and advanced bone age [RCV001090036 ]
Chr8:19505463 [GRCh38]
pathogenic
NM_001354483.2(CSGALNACT1):c.1309+136_1309+144del deletion
not provided [RCV001648618 ]
Chr8:19408469..19408477 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.1449C>T (p.Asp483=) single nucleotide variant
not provided [RCV001682349 ]
Chr8:19405930 [GRCh38]
benign
GRCh37/hg19 8p21.3(chr8:19199693-19364763)x1 copy number loss
not provided [RCV001259476 ]
Chr8:19199693..19364763 [GRCh37]
uncertain significance
GRCh37/hg19 8p21.3(chr8:19109749-19511640)x3 copy number gain
not provided [RCV001259478 ]
Chr8:19109749..19511640 [GRCh37]
uncertain significance
GRCh37/hg19 8p22-21.3(chr8:18827276-19340019)x3 copy number gain
not provided [RCV001259485 ]
Chr8:18827276..19340019 [GRCh37]
likely benign
GRCh37/hg19 8p23.1-12(chr8:12528482-29886483)x3 copy number gain
not provided [RCV001260030 ]
Chr8:12528482..29886483 [GRCh37]
likely pathogenic
NM_001354483.2(CSGALNACT1):c.791A>G (p.Asn264Ser) single nucleotide variant
Skeletal dysplasia, mild, with joint laxity and advanced bone age [RCV001281093 ]
Chr8:19458486 [GRCh38]
likely pathogenic
NM_001354483.2(CSGALNACT1):c.635-112G>T single nucleotide variant
not provided [RCV001680471 ]
Chr8:19458754 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.954-8C>T single nucleotide variant
not provided [RCV003107065 ]
Chr8:19420526 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1551G>C (p.Glu517Asp) single nucleotide variant
not provided [RCV002024786 ]
Chr8:19405828 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1427G>A (p.Trp476Ter) single nucleotide variant
not provided [RCV002009282 ]
Chr8:19405952 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1419C>G (p.Phe473Leu) single nucleotide variant
not provided [RCV001910570 ]
Chr8:19405960 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.852-18A>G single nucleotide variant
not provided [RCV001896479 ]
Chr8:19439949 [GRCh38]
likely benign|uncertain significance
NM_001354483.2(CSGALNACT1):c.689G>A (p.Gly230Glu) single nucleotide variant
not provided [RCV002008453 ]
Chr8:19458588 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1106A>G (p.Asn369Ser) single nucleotide variant
not provided [RCV001863693 ]
Chr8:19420366 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.74C>G (p.Ala25Gly) single nucleotide variant
not provided [RCV001910953 ]
Chr8:19505761 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1195C>A (p.His399Asn) single nucleotide variant
not provided [RCV001968664 ]
Chr8:19418688 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1289G>C (p.Arg430Pro) single nucleotide variant
not provided [RCV001968879 ]
Chr8:19408633 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.275A>C (p.Gln92Pro) single nucleotide variant
not provided [RCV001889744 ]
Chr8:19505560 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.832C>G (p.Gln278Glu) single nucleotide variant
not provided [RCV001911920 ]
Chr8:19458445 [GRCh38]
uncertain significance
GRCh37/hg19 8p22-21.3(chr8:15935542-19321304) copy number gain
not specified [RCV002053754 ]
Chr8:15935542..19321304 [GRCh37]
uncertain significance
NM_001354483.2(CSGALNACT1):c.117C>G (p.Asp39Glu) single nucleotide variant
Inborn genetic diseases [RCV004980755 ]|not provided [RCV002044293 ]
Chr8:19505718 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.867G>C (p.Glu289Asp) single nucleotide variant
not provided [RCV002023304 ]
Chr8:19439916 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.76_77del (p.Ile26fs) deletion
not provided [RCV001912084 ]
Chr8:19505758..19505759 [GRCh38]
pathogenic
GRCh37/hg19 8p21.3(chr8:19157330-19780975)x3 copy number gain
not provided [RCV001834532 ]
Chr8:19157330..19780975 [GRCh37]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1342G>A (p.Gly448Arg) single nucleotide variant
not provided [RCV002041125 ]
Chr8:19406037 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1289G>A (p.Arg430Gln) single nucleotide variant
not provided [RCV002003393 ]
Chr8:19408633 [GRCh38]
uncertain significance
GRCh37/hg19 8p22-21.3(chr8:18444762-19535758)x3 copy number gain
not provided [RCV001832880 ]
Chr8:18444762..19535758 [GRCh37]
uncertain significance
NM_001354483.2(CSGALNACT1):c.104C>A (p.Thr35Asn) single nucleotide variant
not provided [RCV001969557 ]
Chr8:19505731 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1132+5G>A single nucleotide variant
not provided [RCV001889672 ]
Chr8:19420335 [GRCh38]
uncertain significance
NC_000008.10:g.(?_19263291)_(19297462_?)del deletion
not provided [RCV002022685 ]
Chr8:19263291..19297462 [GRCh37]
likely pathogenic
NM_001354483.2(CSGALNACT1):c.1227G>A (p.Leu409=) single nucleotide variant
not provided [RCV001887171 ]
Chr8:19418656 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.445G>A (p.Asp149Asn) single nucleotide variant
not provided [RCV002038020 ]
Chr8:19505390 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1593_1594del (p.Lys531fs) deletion
not provided [RCV001900429 ]
Chr8:19405785..19405786 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.490dup (p.Thr164fs) duplication
not provided [RCV002037646 ]
Chr8:19505344..19505345 [GRCh38]
pathogenic
NM_001354483.2(CSGALNACT1):c.131C>T (p.Ala44Val) single nucleotide variant
not provided [RCV001887685 ]
Chr8:19505704 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1324G>C (p.Asp442His) single nucleotide variant
not provided [RCV001919289 ]
Chr8:19406055 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.13C>T (p.Arg5Cys) single nucleotide variant
not provided [RCV001963493 ]
Chr8:19505822 [GRCh38]
uncertain significance
NC_000008.10:g.(?_16850399)_(20112692_?)dup duplication
Hereditary spastic paraplegia 53 [RCV003120735 ]
Chr8:16850399..20112692 [GRCh37]
uncertain significance
NC_000008.10:g.(?_19263291)_(20112692_?)dup duplication
not provided [RCV001885785 ]
Chr8:19263291..20112692 [GRCh37]
uncertain significance
NM_001354483.2(CSGALNACT1):c.634+5G>C single nucleotide variant
not provided [RCV002036240 ]
Chr8:19505196 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.40C>A (p.Arg14=) single nucleotide variant
not provided [RCV001898931 ]
Chr8:19505795 [GRCh38]
likely benign|conflicting interpretations of pathogenicity|uncertain significance
NM_001354483.2(CSGALNACT1):c.1526T>G (p.Met509Arg) single nucleotide variant
not provided [RCV001875131 ]
Chr8:19405853 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1201G>T (p.Ala401Ser) single nucleotide variant
Inborn genetic diseases [RCV004975919 ]|not provided [RCV001931565 ]
Chr8:19418682 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1420C>T (p.His474Tyr) single nucleotide variant
not provided [RCV001933020 ]
Chr8:19405959 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.583G>T (p.Ala195Ser) single nucleotide variant
not provided [RCV002028291 ]
Chr8:19505252 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1162A>G (p.Ser388Gly) single nucleotide variant
not provided [RCV001880651 ]
Chr8:19418721 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.605G>A (p.Arg202His) single nucleotide variant
Inborn genetic diseases [RCV004040586 ]|not provided [RCV001880686 ]
Chr8:19505230 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.118G>A (p.Glu40Lys) single nucleotide variant
not provided [RCV002047356 ]
Chr8:19505717 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.875G>A (p.Gly292Glu) single nucleotide variant
not provided [RCV001899665 ]
Chr8:19439908 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.304G>A (p.Asp102Asn) single nucleotide variant
not provided [RCV001925923 ]
Chr8:19505531 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.998A>G (p.Glu333Gly) single nucleotide variant
Inborn genetic diseases [RCV004038957 ]|not provided [RCV001885476 ]
Chr8:19420474 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.272_276del (p.Glu91fs) deletion
not provided [RCV001993319 ]
Chr8:19505559..19505563 [GRCh38]
pathogenic
NM_001354483.2(CSGALNACT1):c.1073A>T (p.Asp358Val) single nucleotide variant
not provided [RCV001932266 ]
Chr8:19420399 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1518G>T (p.Gln506His) single nucleotide variant
Inborn genetic diseases [RCV002675472 ]|not provided [RCV002047943 ]
Chr8:19405861 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.162G>C (p.Lys54Asn) single nucleotide variant
not provided [RCV001989635 ]
Chr8:19505673 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.407G>A (p.Gly136Asp) single nucleotide variant
not provided [RCV001905425 ]
Chr8:19505428 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1220A>G (p.Gln407Arg) single nucleotide variant
not provided [RCV001980616 ]
Chr8:19418663 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1306A>G (p.Ile436Val) single nucleotide variant
not provided [RCV001981411 ]
Chr8:19408616 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.599A>G (p.Asn200Ser) single nucleotide variant
not provided [RCV001988916 ]
Chr8:19505236 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1400C>T (p.Thr467Met) single nucleotide variant
not provided [RCV001906867 ]
Chr8:19405979 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1163G>T (p.Ser388Ile) single nucleotide variant
not provided [RCV001930314 ]
Chr8:19418720 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1174C>T (p.Pro392Ser) single nucleotide variant
not provided [RCV001931337 ]
Chr8:19418709 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.301A>C (p.Ser101Arg) single nucleotide variant
not provided [RCV001875301 ]
Chr8:19505534 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.700C>A (p.His234Asn) single nucleotide variant
not provided [RCV001991121 ]
Chr8:19458577 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.369C>A (p.Phe123Leu) single nucleotide variant
not provided [RCV001900082 ]
Chr8:19505466 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.776C>G (p.Ala259Gly) single nucleotide variant
Inborn genetic diseases [RCV002642188 ]|not provided [RCV002029082 ]
Chr8:19458501 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.701_702inv (p.His234Arg) inversion
not provided [RCV001877656 ]
Chr8:19458575..19458576 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.921T>C (p.Asn307=) single nucleotide variant
not provided [RCV002190397 ]
Chr8:19439862 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1309+15C>T single nucleotide variant
not provided [RCV002124377 ]
Chr8:19408598 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.1188C>T (p.Tyr396=) single nucleotide variant
not provided [RCV002168614 ]
Chr8:19418695 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.783G>A (p.Thr261=) single nucleotide variant
CSGALNACT1-related disorder [RCV003933612 ]|Skeletal dysplasia, mild, with joint laxity and advanced bone age [RCV002500304 ]|not provided [RCV002148749 ]
Chr8:19458494 [GRCh38]
benign|likely benign
NM_001354483.2(CSGALNACT1):c.1439G>A (p.Arg480His) single nucleotide variant
CSGALNACT1-related disorder [RCV003923675 ]|Skeletal dysplasia, mild, with joint laxity and advanced bone age [RCV002500063 ]|not provided [RCV002127391 ]
Chr8:19405940 [GRCh38]
benign|likely benign
NM_001354483.2(CSGALNACT1):c.1329C>T (p.Ile443=) single nucleotide variant
not provided [RCV002210710 ]
Chr8:19406050 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.718A>G (p.Ile240Val) single nucleotide variant
CSGALNACT1-related disorder [RCV003923752 ]|not provided [RCV002124342 ]
Chr8:19458559 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.782C>T (p.Thr261Met) single nucleotide variant
CSGALNACT1-related disorder [RCV003933575 ]|not provided [RCV002130564 ]
Chr8:19458495 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.735C>T (p.Phe245=) single nucleotide variant
not provided [RCV002209763 ]
Chr8:19458542 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.377C>T (p.Ser126Leu) single nucleotide variant
not provided [RCV002206503 ]
Chr8:19505458 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.953+11T>C single nucleotide variant
not provided [RCV002127767 ]
Chr8:19439819 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.492C>G (p.Thr164=) single nucleotide variant
not provided [RCV002186285 ]
Chr8:19505343 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.501C>T (p.Pro167=) single nucleotide variant
not provided [RCV002207360 ]
Chr8:19505334 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.932G>A (p.Gly311Glu) single nucleotide variant
Inborn genetic diseases [RCV004976224 ]|not provided [RCV002190689 ]
Chr8:19439851 [GRCh38]
likely benign|uncertain significance
NM_001354483.2(CSGALNACT1):c.1309+19T>G single nucleotide variant
not provided [RCV002147134 ]
Chr8:19408594 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.378G>A (p.Ser126=) single nucleotide variant
not provided [RCV002208206 ]
Chr8:19505457 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1227+9T>G single nucleotide variant
not provided [RCV002193292 ]
Chr8:19418647 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.663G>A (p.Gly221=) single nucleotide variant
not provided [RCV002117011 ]
Chr8:19458614 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1133-14T>C single nucleotide variant
not provided [RCV002152370 ]
Chr8:19418764 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1134G>A (p.Gly378=) single nucleotide variant
not provided [RCV002096912 ]
Chr8:19418749 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1418T>A (p.Phe473Tyr) single nucleotide variant
CSGALNACT1-related disorder [RCV003913632 ]|Skeletal dysplasia, mild, with joint laxity and advanced bone age [RCV002498303 ]|not provided [RCV002093495 ]
Chr8:19405961 [GRCh38]
benign|likely benign
NM_001354483.2(CSGALNACT1):c.1053C>T (p.Asn351=) single nucleotide variant
CSGALNACT1-related disorder [RCV003923646 ]|not provided [RCV002116120 ]
Chr8:19420419 [GRCh38]
benign|likely benign
NM_001354483.2(CSGALNACT1):c.409G>A (p.Val137Ile) single nucleotide variant
Skeletal dysplasia, mild, with joint laxity and advanced bone age [RCV002498268 ]|not provided [RCV002216015 ]
Chr8:19505426 [GRCh38]
benign|likely benign
NM_001354483.2(CSGALNACT1):c.1341C>A (p.Gly447=) single nucleotide variant
not provided [RCV002167790 ]
Chr8:19406038 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.397G>A (p.Val133Met) single nucleotide variant
CSGALNACT1-related disorder [RCV003951179 ]|Skeletal dysplasia, mild, with joint laxity and advanced bone age [RCV002494369 ]|not provided [RCV002109921 ]
Chr8:19505438 [GRCh38]
benign|likely benign
NM_001354483.2(CSGALNACT1):c.789C>A (p.Ile263=) single nucleotide variant
CSGALNACT1-related disorder [RCV003923699 ]|not provided [RCV002078897 ]
Chr8:19458488 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.909A>G (p.Lys303=) single nucleotide variant
not provided [RCV002216088 ]
Chr8:19439874 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1310-5G>A single nucleotide variant
not provided [RCV002087488 ]
Chr8:19406074 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.133C>T (p.Leu45=) single nucleotide variant
not provided [RCV002117402 ]
Chr8:19505702 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.956C>T (p.Ala319Val) single nucleotide variant
Inborn genetic diseases [RCV002553695 ]|not provided [RCV002189359 ]
Chr8:19420516 [GRCh38]
benign|uncertain significance
NM_001354483.2(CSGALNACT1):c.927C>G (p.Val309=) single nucleotide variant
not provided [RCV002096560 ]
Chr8:19439856 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.953+14G>A single nucleotide variant
not provided [RCV002150029 ]
Chr8:19439816 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.614C>T (p.Thr205Met) single nucleotide variant
not provided [RCV002107800 ]
Chr8:19505221 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.428A>G (p.Tyr143Cys) single nucleotide variant
not provided [RCV002095570 ]
Chr8:19505407 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.702C>G (p.His234Gln) single nucleotide variant
not provided [RCV002112810 ]
Chr8:19458575 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.676C>T (p.Leu226Phe) single nucleotide variant
not provided [RCV002109846 ]
Chr8:19458601 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.61C>T (p.Leu21Phe) single nucleotide variant
CSGALNACT1-related disorder [RCV003923642 ]|not provided [RCV002115958 ]
Chr8:19505774 [GRCh38]
benign|likely benign
NM_001354483.2(CSGALNACT1):c.876G>C (p.Gly292=) single nucleotide variant
not provided [RCV002093182 ]
Chr8:19439907 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1562G>C (p.Arg521Pro) single nucleotide variant
CSGALNACT1-related disorder [RCV003933459 ]|not provided [RCV002117828 ]
Chr8:19405817 [GRCh38]
benign|likely benign
NM_001354483.2(CSGALNACT1):c.582T>A (p.Pro194=) single nucleotide variant
not provided [RCV002136647 ]
Chr8:19505253 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1395A>G (p.Val465=) single nucleotide variant
not provided [RCV002102859 ]
Chr8:19405984 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.177C>T (p.Ala59=) single nucleotide variant
CSGALNACT1-related disorder [RCV003933556 ]|not provided [RCV002120789 ]
Chr8:19505658 [GRCh38]
benign|likely benign
NM_001354483.2(CSGALNACT1):c.675G>A (p.Glu225=) single nucleotide variant
not provided [RCV002154728 ]
Chr8:19458602 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.851+13G>A single nucleotide variant
not provided [RCV002176332 ]
Chr8:19458413 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.851+12C>T single nucleotide variant
not provided [RCV002140582 ]
Chr8:19458414 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1310-6C>T single nucleotide variant
not provided [RCV002140512 ]
Chr8:19406075 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.213C>T (p.Tyr71=) single nucleotide variant
not provided [RCV002135627 ]
Chr8:19505622 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1310-17G>C single nucleotide variant
not provided [RCV002122070 ]
Chr8:19406086 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.375C>T (p.His125=) single nucleotide variant
not provided [RCV002198780 ]
Chr8:19505460 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.615G>A (p.Thr205=) single nucleotide variant
not provided [RCV002204205 ]
Chr8:19505220 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.40C>T (p.Arg14Trp) single nucleotide variant
CSGALNACT1-related disorder [RCV003970968 ]|not provided [RCV002139456 ]
Chr8:19505795 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.223C>T (p.Leu75=) single nucleotide variant
not provided [RCV002203364 ]
Chr8:19505612 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.953+7A>G single nucleotide variant
not provided [RCV002178790 ]
Chr8:19439823 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.117C>T (p.Asp39=) single nucleotide variant
not provided [RCV002163222 ]
Chr8:19505718 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1413A>G (p.Gly471=) single nucleotide variant
not provided [RCV002144616 ]
Chr8:19405966 [GRCh38]
benign
NM_001354483.2(CSGALNACT1):c.635-10C>G single nucleotide variant
not provided [RCV002083137 ]
Chr8:19458652 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.632_634del (p.Glu211del) deletion
Skeletal dysplasia, mild, with joint laxity and advanced bone age [RCV003236644 ]
Chr8:19505201..19505203 [GRCh38]
likely pathogenic
Single allele complex
See cases [RCV002292428 ]
Chr8:6999114..11935023 [GRCh37]
pathogenic
Single allele complex
8p inverted duplication/deletion syndrome [RCV002280753 ]
Chr8:158048..43019304 [GRCh37]
pathogenic
GRCh37/hg19 8p23.3-12(chr8:158048-30187456)x1 copy number loss
See cases [RCV002286343 ]
Chr8:158048..30187456 [GRCh37]
pathogenic
NM_001354483.2(CSGALNACT1):c.472C>T (p.Gln158Ter) single nucleotide variant
Skeletal dysplasia, mild, with joint laxity and advanced bone age [RCV002289031 ]
Chr8:19505363 [GRCh38]
pathogenic
NM_001354483.2(CSGALNACT1):c.972C>G (p.Asn324Lys) single nucleotide variant
Inborn genetic diseases [RCV003285996 ]
Chr8:19420500 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.657C>G (p.Asp219Glu) single nucleotide variant
Skeletal dysplasia, mild, with joint laxity and advanced bone age [RCV002471583 ]|not provided [RCV002571456 ]
Chr8:19458620 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1465C>A (p.Gln489Lys) single nucleotide variant
not provided [RCV002862615 ]
Chr8:19405914 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1462G>A (p.Glu488Lys) single nucleotide variant
Inborn genetic diseases [RCV002685290 ]
Chr8:19405917 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1511A>G (p.His504Arg) single nucleotide variant
Inborn genetic diseases [RCV002684198 ]
Chr8:19405868 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.851+10T>C single nucleotide variant
not provided [RCV003011886 ]
Chr8:19458416 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1351G>A (p.Val451Met) single nucleotide variant
not provided [RCV002816053 ]
Chr8:19406028 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.884A>C (p.His295Pro) single nucleotide variant
Inborn genetic diseases [RCV002772644 ]
Chr8:19439899 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.923_925del (p.Glu308del) deletion
not provided [RCV002685735 ]
Chr8:19439858..19439860 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.418G>T (p.Ala140Ser) single nucleotide variant
not provided [RCV002862383 ]
Chr8:19505417 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.701A>T (p.His234Leu) single nucleotide variant
not provided [RCV002996187 ]
Chr8:19458576 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.876G>T (p.Gly292=) single nucleotide variant
not provided [RCV002994482 ]
Chr8:19439907 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.269G>C (p.Ser90Thr) single nucleotide variant
Inborn genetic diseases [RCV002615178 ]|not provided [RCV002599244 ]
Chr8:19505566 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.910G>A (p.Glu304Lys) single nucleotide variant
Inborn genetic diseases [RCV004614381 ]|not provided [RCV002616785 ]
Chr8:19439873 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1341C>T (p.Gly447=) single nucleotide variant
not provided [RCV002996234 ]
Chr8:19406038 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1547T>C (p.Ile516Thr) single nucleotide variant
Inborn genetic diseases [RCV003076472 ]|not provided [RCV003051246 ]
Chr8:19405832 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.873T>C (p.Asp291=) single nucleotide variant
not provided [RCV002820507 ]
Chr8:19439910 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1062C>A (p.Leu354=) single nucleotide variant
not provided [RCV002913765 ]
Chr8:19420410 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.143C>G (p.Ala48Gly) single nucleotide variant
Inborn genetic diseases [RCV002587660 ]|not provided [RCV002593029 ]
Chr8:19505692 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.229C>A (p.Arg77=) single nucleotide variant
not provided [RCV002953429 ]
Chr8:19505606 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.805C>T (p.Leu269=) single nucleotide variant
not provided [RCV002785813 ]
Chr8:19458472 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1364G>A (p.Arg455His) single nucleotide variant
Inborn genetic diseases [RCV002691668 ]
Chr8:19406015 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.230G>A (p.Arg77Gln) single nucleotide variant
Inborn genetic diseases [RCV004978506 ]|not provided [RCV003052840 ]
Chr8:19505605 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.770A>G (p.Asn257Ser) single nucleotide variant
not provided [RCV002590416 ]
Chr8:19458507 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.184C>T (p.Gln62Ter) single nucleotide variant
not provided [RCV003078526 ]
Chr8:19505651 [GRCh38]
pathogenic
NM_001354483.2(CSGALNACT1):c.817G>T (p.Val273Leu) single nucleotide variant
Inborn genetic diseases [RCV004068284 ]|not provided [RCV002975785 ]
Chr8:19458460 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1364G>C (p.Arg455Pro) single nucleotide variant
not provided [RCV002975862 ]
Chr8:19406015 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.229del (p.Arg77fs) deletion
not provided [RCV002979568 ]
Chr8:19505606 [GRCh38]
pathogenic
NM_001354483.2(CSGALNACT1):c.1228-9T>C single nucleotide variant
not provided [RCV003020922 ]
Chr8:19408703 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1241A>T (p.Glu414Val) single nucleotide variant
not provided [RCV002695379 ]
Chr8:19408681 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.635-17T>C single nucleotide variant
not provided [RCV002592688 ]
Chr8:19458659 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.229C>T (p.Arg77Trp) single nucleotide variant
not provided [RCV003055310 ]
Chr8:19505606 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1370A>G (p.Tyr457Cys) single nucleotide variant
Inborn genetic diseases [RCV003167597 ]|not provided [RCV002639951 ]
Chr8:19406009 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.575A>G (p.Asn192Ser) single nucleotide variant
Inborn genetic diseases [RCV002784987 ]
Chr8:19505260 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1199A>G (p.Asp400Gly) single nucleotide variant
Inborn genetic diseases [RCV004066964 ]|not provided [RCV002918813 ]
Chr8:19418684 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.851+16C>T single nucleotide variant
not provided [RCV002929147 ]
Chr8:19458410 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.637A>G (p.Ile213Val) single nucleotide variant
not provided [RCV002626977 ]
Chr8:19458640 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.954-14G>A single nucleotide variant
not provided [RCV002790288 ]
Chr8:19420532 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.132A>G (p.Ala44=) single nucleotide variant
not provided [RCV003024450 ]
Chr8:19505703 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.594C>T (p.Ser198=) single nucleotide variant
not provided [RCV003024021 ]
Chr8:19505241 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1366A>G (p.Lys456Glu) single nucleotide variant
Inborn genetic diseases [RCV003294491 ]|not provided [RCV003082015 ]
Chr8:19406013 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.82G>C (p.Val28Leu) single nucleotide variant
Inborn genetic diseases [RCV002665193 ]
Chr8:19505753 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.130G>A (p.Ala44Thr) single nucleotide variant
not provided [RCV003057345 ]
Chr8:19505705 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1206C>G (p.Val402=) single nucleotide variant
CSGALNACT1-related disorder [RCV003973478 ]|not provided [RCV002766473 ]
Chr8:19418677 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1309+6A>C single nucleotide variant
not provided [RCV002932543 ]
Chr8:19408607 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1558C>A (p.Leu520Ile) single nucleotide variant
not provided [RCV002574778 ]
Chr8:19405821 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.604C>T (p.Arg202Cys) single nucleotide variant
Inborn genetic diseases [RCV004069071 ]|not provided [RCV002596337 ]
Chr8:19505231 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.845A>C (p.Asn282Thr) single nucleotide variant
not provided [RCV002919199 ]
Chr8:19458432 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1512C>T (p.His504=) single nucleotide variant
not provided [RCV002701504 ]
Chr8:19405867 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1574A>T (p.Gln525Leu) single nucleotide variant
Inborn genetic diseases [RCV002645163 ]|not provided [RCV003730247 ]
Chr8:19405805 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.830G>A (p.Arg277Gln) single nucleotide variant
Inborn genetic diseases [RCV003088474 ]|not provided [RCV003085086 ]
Chr8:19458447 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.953+13C>T single nucleotide variant
not provided [RCV002572504 ]
Chr8:19439817 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.303C>T (p.Ser101=) single nucleotide variant
not provided [RCV002573760 ]
Chr8:19505532 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.937C>T (p.Leu313Phe) single nucleotide variant
not provided [RCV002594301 ]
Chr8:19439846 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1334G>C (p.Gly445Ala) single nucleotide variant
Inborn genetic diseases [RCV004065143 ]|not provided [RCV002985322 ]
Chr8:19406045 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.784C>G (p.Leu262Val) single nucleotide variant
Inborn genetic diseases [RCV002742587 ]
Chr8:19458493 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.886C>T (p.Leu296Phe) single nucleotide variant
not provided [RCV002631774 ]
Chr8:19439897 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.742A>G (p.Ile248Val) single nucleotide variant
Inborn genetic diseases [RCV003294560 ]|not provided [RCV002633024 ]
Chr8:19458535 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.634+17T>C single nucleotide variant
not provided [RCV002576862 ]
Chr8:19505184 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1445T>A (p.Met482Lys) single nucleotide variant
not provided [RCV002581424 ]
Chr8:19405934 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1417T>C (p.Phe473Leu) single nucleotide variant
not provided [RCV002599648 ]
Chr8:19405962 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.627C>T (p.Phe209=) single nucleotide variant
not provided [RCV002806021 ]
Chr8:19505208 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1133-9G>A single nucleotide variant
not provided [RCV003027822 ]
Chr8:19418759 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.632A>G (p.Glu211Gly) single nucleotide variant
not provided [RCV003011563 ]
Chr8:19505203 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1397G>A (p.Arg466Gln) single nucleotide variant
not provided [RCV003060455 ]
Chr8:19405982 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1402C>G (p.Pro468Ala) single nucleotide variant
not provided [RCV002856682 ]
Chr8:19405977 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1109C>T (p.Thr370Met) single nucleotide variant
not provided [RCV002963066 ]
Chr8:19420363 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1500C>T (p.Asn500=) single nucleotide variant
not provided [RCV002630396 ]
Chr8:19405879 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1448A>G (p.Asp483Gly) single nucleotide variant
not provided [RCV003066275 ]
Chr8:19405931 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.953+10A>G single nucleotide variant
not provided [RCV002585014 ]
Chr8:19439820 [GRCh38]
likely benign|uncertain significance
NM_001354483.2(CSGALNACT1):c.291G>T (p.Gln97His) single nucleotide variant
not provided [RCV003067365 ]
Chr8:19505544 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1054G>A (p.Val352Ile) single nucleotide variant
not provided [RCV002605698 ]
Chr8:19420418 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.713G>A (p.Arg238Gln) single nucleotide variant
not provided [RCV002586094 ]
Chr8:19458564 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1361A>T (p.Tyr454Phe) single nucleotide variant
not provided [RCV002608119 ]
Chr8:19406018 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1167G>C (p.Gln389His) single nucleotide variant
not provided [RCV002942719 ]
Chr8:19418716 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1354C>T (p.His452Tyr) single nucleotide variant
not provided [RCV002604878 ]
Chr8:19406025 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.634+17T>G single nucleotide variant
not provided [RCV002815121 ]
Chr8:19505184 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.576C>G (p.Asn192Lys) single nucleotide variant
not provided [RCV002612270 ]
Chr8:19505259 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1461C>T (p.Pro487=) single nucleotide variant
CSGALNACT1-related disorder [RCV003943632 ]|not provided [RCV002943371 ]
Chr8:19405918 [GRCh38]
likely benign
NC_000008.10:g.(?_17915043)_(20112692_?)dup duplication
not provided [RCV003154902 ]
Chr8:17915043..20112692 [GRCh37]
uncertain significance
NM_001354483.2(CSGALNACT1):c.936A>G (p.Ile312Met) single nucleotide variant
Inborn genetic diseases [RCV003218645 ]
Chr8:19439847 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1081A>G (p.Ile361Val) single nucleotide variant
Inborn genetic diseases [RCV003287083 ]
Chr8:19420391 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1459C>G (p.Pro487Ala) single nucleotide variant
Inborn genetic diseases [RCV003206265 ]
Chr8:19405920 [GRCh38]
uncertain significance
GRCh38/hg38 8p23.3-21.2(chr8:449893-23854904)x1 copy number loss
Neurodevelopmental disorder [RCV003327729 ]
Chr8:449893..23854904 [GRCh38]
pathogenic
GRCh38/hg38 8p23.1-12(chr8:12721809-30183737)x1 copy number loss
Microcephaly [RCV003327707 ]
Chr8:12721809..30183737 [GRCh38]
pathogenic
NM_001354483.2(CSGALNACT1):c.622G>T (p.Asp208Tyr) single nucleotide variant
Inborn genetic diseases [RCV003361569 ]
Chr8:19505213 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1405G>A (p.Val469Met) single nucleotide variant
Inborn genetic diseases [RCV003351443 ]
Chr8:19405974 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.641A>G (p.Tyr214Cys) single nucleotide variant
Inborn genetic diseases [RCV003367727 ]
Chr8:19458636 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.178G>A (p.Val60Ile) single nucleotide variant
Inborn genetic diseases [RCV003356051 ]
Chr8:19505657 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1548A>G (p.Ile516Met) single nucleotide variant
Inborn genetic diseases [RCV003364120 ]
Chr8:19405831 [GRCh38]
uncertain significance
GRCh37/hg19 8p23.1-21.1(chr8:12490999-28150620)x1 copy number loss
not provided [RCV003483018 ]
Chr8:12490999..28150620 [GRCh37]
pathogenic
NM_001354483.2(CSGALNACT1):c.981C>T (p.Phe327=) single nucleotide variant
not provided [RCV003873843 ]
Chr8:19420491 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.282G>A (p.Arg94=) single nucleotide variant
not provided [RCV003873219 ]
Chr8:19505553 [GRCh38]
likely benign
GRCh37/hg19 8p23.1-11.23(chr8:11945856-37902453)x3 copy number gain
not provided [RCV003484722 ]
Chr8:11945856..37902453 [GRCh37]
pathogenic
GRCh37/hg19 8p23.1-11.22(chr8:12560782-38748763)x3 copy number gain
not provided [RCV003484724 ]
Chr8:12560782..38748763 [GRCh37]
pathogenic
GRCh37/hg19 8p22-11.1(chr8:14240573-43824035)x3 copy number gain
not provided [RCV003484725 ]
Chr8:14240573..43824035 [GRCh37]
pathogenic
GRCh37/hg19 8p23.2-11.21(chr8:2201405-41723095)x3 copy number gain
not provided [RCV003484713 ]
Chr8:2201405..41723095 [GRCh37]
pathogenic
GRCh37/hg19 8p21.3(chr8:19323985-20513166)x1 copy number loss
not provided [RCV003483021 ]
Chr8:19323985..20513166 [GRCh37]
uncertain significance
Single allele duplication
not provided [RCV003448693 ]
Chr8:12530550..43483193 [GRCh37]
pathogenic
NM_001354483.2(CSGALNACT1):c.696C>T (p.His232=) single nucleotide variant
not provided [RCV003877543 ]
Chr8:19458581 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1090A>G (p.Thr364Ala) single nucleotide variant
not provided [RCV003687855 ]
Chr8:19420382 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.852-9G>T single nucleotide variant
not provided [RCV003662882 ]
Chr8:19439940 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.635-9T>C single nucleotide variant
not provided [RCV003825709 ]
Chr8:19458651 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.681C>T (p.Thr227=) single nucleotide variant
not provided [RCV003830835 ]
Chr8:19458596 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.85C>T (p.Leu29=) single nucleotide variant
not provided [RCV003827266 ]
Chr8:19505750 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1128G>A (p.Gln376=) single nucleotide variant
not provided [RCV003826214 ]
Chr8:19420344 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.270T>C (p.Ser90=) single nucleotide variant
not provided [RCV003832544 ]
Chr8:19505565 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.851+17G>A single nucleotide variant
not provided [RCV003698376 ]
Chr8:19458409 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1227+16G>T single nucleotide variant
not provided [RCV003856155 ]
Chr8:19418640 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1314G>C (p.Gly438=) single nucleotide variant
not provided [RCV003833007 ]
Chr8:19406065 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.634+17T>A single nucleotide variant
not provided [RCV003813850 ]
Chr8:19505184 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.852-19C>G single nucleotide variant
not provided [RCV003833909 ]
Chr8:19439950 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.267G>A (p.Arg89=) single nucleotide variant
not provided [RCV003717936 ]
Chr8:19505568 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.372G>A (p.Leu124=) single nucleotide variant
not provided [RCV003835701 ]
Chr8:19505463 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.285T>C (p.Asn95=) single nucleotide variant
not provided [RCV003860573 ]
Chr8:19505550 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.71G>C (p.Cys24Ser) single nucleotide variant
not provided [RCV003823280 ]
Chr8:19505764 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1191C>A (p.Gly397=) single nucleotide variant
not provided [RCV003848688 ]
Chr8:19418692 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1224G>A (p.Gln408=) single nucleotide variant
not provided [RCV003735546 ]
Chr8:19418659 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.498C>T (p.His166=) single nucleotide variant
not provided [RCV003864500 ]
Chr8:19505337 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.42G>T (p.Arg14=) single nucleotide variant
not provided [RCV003824226 ]
Chr8:19505793 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1518G>A (p.Gln506=) single nucleotide variant
not provided [RCV003860308 ]
Chr8:19405861 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.159G>C (p.Gly53=) single nucleotide variant
not provided [RCV003819177 ]
Chr8:19505676 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.986A>G (p.Gln329Arg) single nucleotide variant
not provided [RCV003820686 ]
Chr8:19420486 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.703G>A (p.Glu235Lys) single nucleotide variant
not provided [RCV003722208 ]
Chr8:19458574 [GRCh38]
uncertain significance
GRCh37/hg19 8p23.3-q24.3(chr8:158048-146295771)x3 copy number gain
not specified [RCV003986742 ]
Chr8:158048..146295771 [GRCh37]
pathogenic
NM_001354483.2(CSGALNACT1):c.1245T>C (p.Thr415=) single nucleotide variant
not provided [RCV003728642 ]
Chr8:19408677 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1320T>G (p.Asp440Glu) single nucleotide variant
not provided [RCV003677716 ]
Chr8:19406059 [GRCh38]
uncertain significance
GRCh37/hg19 8p23.3-11.21(chr8:158048-41600696)x3 copy number gain
not specified [RCV003986756 ]
Chr8:158048..41600696 [GRCh37]
pathogenic
NM_001354483.2(CSGALNACT1):c.703G>T (p.Glu235Ter) single nucleotide variant
not provided [RCV003710897 ]
Chr8:19458574 [GRCh38]
pathogenic
NM_001354483.2(CSGALNACT1):c.635-19C>T single nucleotide variant
not provided [RCV003557138 ]
Chr8:19458661 [GRCh38]
likely benign
GRCh37/hg19 8p21.3(chr8:19252047-19341794)x1 copy number loss
not specified [RCV003986781 ]
Chr8:19252047..19341794 [GRCh37]
uncertain significance
GRCh37/hg19 8p21.3(chr8:19211984-19268822)x1 copy number loss
not specified [RCV003986785 ]
Chr8:19211984..19268822 [GRCh37]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1513G>A (p.Gly505Ser) single nucleotide variant
not provided [RCV003820909 ]
Chr8:19405866 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.99C>T (p.Ala33=) single nucleotide variant
not provided [RCV003720457 ]
Chr8:19505736 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.851+12C>G single nucleotide variant
not provided [RCV003710609 ]
Chr8:19458414 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.930A>G (p.Lys310=) single nucleotide variant
not provided [RCV003848245 ]
Chr8:19439853 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.162G>A (p.Lys54=) single nucleotide variant
not provided [RCV003733102 ]
Chr8:19505673 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1473G>C (p.Lys491Asn) single nucleotide variant
Inborn genetic diseases [RCV004370337 ]
Chr8:19405906 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.43G>C (p.Val15Leu) single nucleotide variant
Inborn genetic diseases [RCV004370338 ]
Chr8:19505792 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.715C>T (p.Leu239Phe) single nucleotide variant
Inborn genetic diseases [RCV004370341 ]
Chr8:19458562 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.551T>C (p.Ile184Thr) single nucleotide variant
Inborn genetic diseases [RCV004370339 ]
Chr8:19505284 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.115G>C (p.Asp39His) single nucleotide variant
Inborn genetic diseases [RCV004370336 ]
Chr8:19505720 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.619T>G (p.Ser207Ala) single nucleotide variant
Inborn genetic diseases [RCV004370340 ]
Chr8:19505216 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.799G>A (p.Val267Met) single nucleotide variant
Inborn genetic diseases [RCV004370343 ]
Chr8:19458478 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.366C>A (p.Ala122=) single nucleotide variant
CSGALNACT1-related disorder [RCV003894459 ]
Chr8:19505469 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.354C>T (p.Ala118=) single nucleotide variant
CSGALNACT1-related disorder [RCV003962014 ]
Chr8:19505481 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.348C>G (p.Thr116=) single nucleotide variant
CSGALNACT1-related disorder [RCV003924006 ]
Chr8:19505487 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.356A>T (p.Asp119Val) single nucleotide variant
CSGALNACT1-related disorder [RCV003966876 ]
Chr8:19505479 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.*8G>T single nucleotide variant
CSGALNACT1-related disorder [RCV003919517 ]
Chr8:19405772 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.221G>T (p.Ser74Ile) single nucleotide variant
Inborn genetic diseases [RCV004613566 ]
Chr8:19505614 [GRCh38]
uncertain significance
NC_000008.10:g.(?_17915043)_(20112692_?)del deletion
not provided [RCV004583317 ]
Chr8:17915043..20112692 [GRCh37]
pathogenic
NM_001354483.2(CSGALNACT1):c.1033C>T (p.Arg345Cys) single nucleotide variant
CSGALNACT1-related disorder [RCV004757630 ]|Inborn genetic diseases [RCV004613567 ]
Chr8:19420439 [GRCh38]
uncertain significance
NC_000008.10:g.(?_19362692)_(20112692_?)del deletion
not provided [RCV004583318 ]
Chr8:19362692..20112692 [GRCh37]
pathogenic
NC_000008.10:g.(?_19263291)_(19363345_?)dup duplication
not provided [RCV004583319 ]
Chr8:19263291..19363345 [GRCh37]
uncertain significance
NM_001354483.2(CSGALNACT1):c.901T>A (p.Phe301Ile) single nucleotide variant
CSGALNACT1-related disorder [RCV004730739 ]
Chr8:19439882 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.49G>A (p.Val17Ile) single nucleotide variant
Inborn genetic diseases [RCV004979257 ]
Chr8:19505786 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.500C>G (p.Pro167Arg) single nucleotide variant
Inborn genetic diseases [RCV004979261 ]
Chr8:19505335 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1324G>A (p.Asp442Asn) single nucleotide variant
Inborn genetic diseases [RCV004979258 ]
Chr8:19406055 [GRCh38]
uncertain significance
GRCh37/hg19 8p23.3-21.2(chr8:158049-24812752)x1 copy number loss
not provided [RCV004819357 ]
Chr8:158049..24812752 [GRCh37]
pathogenic
NM_001354483.2(CSGALNACT1):c.1542C>G (p.His514Gln) single nucleotide variant
Inborn genetic diseases [RCV004979259 ]
Chr8:19405837 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.271G>A (p.Glu91Lys) single nucleotide variant
Inborn genetic diseases [RCV004979260 ]
Chr8:19505564 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1438C>G (p.Arg480Gly) single nucleotide variant
Inborn genetic diseases [RCV004979262 ]
Chr8:19405941 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.852G>A (p.Arg284=) single nucleotide variant
Inborn genetic diseases [RCV004979256 ]
Chr8:19439931 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1388T>C (p.Ile463Thr) single nucleotide variant
Skeletal dysplasia, mild, with joint laxity and advanced bone age [RCV005041088 ]
Chr8:19405991 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.171C>T (p.Tyr57=) single nucleotide variant
not provided [RCV005067112 ]
Chr8:19505664 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1160T>G (p.Phe387Cys) single nucleotide variant
not provided [RCV005144916 ]
Chr8:19418723 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1309+10dup duplication
not provided [RCV005066533 ]
Chr8:19408602..19408603 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1152A>T (p.Pro384=) single nucleotide variant
not provided [RCV005088864 ]
Chr8:19418731 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.189G>A (p.Glu63=) single nucleotide variant
not provided [RCV005060639 ]
Chr8:19505646 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.852-4C>G single nucleotide variant
not provided [RCV005065889 ]
Chr8:19439935 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1227+20_1227+29del deletion
not provided [RCV005070121 ]
Chr8:19418627..19418636 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.150C>T (p.Ser50=) single nucleotide variant
not provided [RCV005069384 ]
Chr8:19505685 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1110G>A (p.Thr370=) single nucleotide variant
not provided [RCV005126348 ]
Chr8:19420362 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1132+12CT[2] microsatellite
not provided [RCV005161662 ]
Chr8:19420323..19420324 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.364G>A (p.Ala122Thr) single nucleotide variant
not provided [RCV005128690 ]
Chr8:19505471 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.1368G>A (p.Lys456=) single nucleotide variant
not provided [RCV005163449 ]
Chr8:19406011 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.635-16G>A single nucleotide variant
not provided [RCV005161249 ]
Chr8:19458658 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1047A>G (p.Gly349=) single nucleotide variant
not provided [RCV005137063 ]
Chr8:19420425 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.338dup (p.Glu114fs) duplication
not provided [RCV005169552 ]
Chr8:19505496..19505497 [GRCh38]
pathogenic
NM_001354483.2(CSGALNACT1):c.1278G>C (p.Thr426=) single nucleotide variant
not provided [RCV005178876 ]
Chr8:19408644 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1260C>T (p.Asp420=) single nucleotide variant
not provided [RCV005080734 ]
Chr8:19408662 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.18G>T (p.Arg6=) single nucleotide variant
not provided [RCV005207054 ]
Chr8:19505817 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1542C>T (p.His514=) single nucleotide variant
not provided [RCV005136692 ]
Chr8:19405837 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.635-18T>C single nucleotide variant
not provided [RCV005084551 ]
Chr8:19458660 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1227+10T>G single nucleotide variant
not provided [RCV005159827 ]
Chr8:19418646 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1290G>C (p.Arg430=) single nucleotide variant
not provided [RCV005074004 ]
Chr8:19408632 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.1302C>T (p.Ile434=) single nucleotide variant
not provided [RCV005074289 ]
Chr8:19408620 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.667T>C (p.Leu223=) single nucleotide variant
not provided [RCV005155471 ]
Chr8:19458610 [GRCh38]
likely benign
NM_001354483.2(CSGALNACT1):c.580C>T (p.Pro194Ser) single nucleotide variant
not provided [RCV005122269 ]
Chr8:19505255 [GRCh38]
uncertain significance
NM_001354483.2(CSGALNACT1):c.787A>T (p.Ile263Phe) single nucleotide variant
not provided [RCV002970754 ]
Chr8:19458490 [GRCh38]
uncertain significance
GRCh37/hg19 8p23.3-q24.3(chr8:158991-146280828)x3 copy number gain
See cases [RCV000447507 ]
Chr8:158991..146280828 [GRCh37]
pathogenic
GRCh37/hg19 8p23.1-12(chr8:11945855-34875355)x3 copy number gain
See cases [RCV000510899 ]
Chr8:11945855..34875355 [GRCh37]
pathogenic
GRCh37/hg19 8p23.1-12(chr8:12552775-35935825)x3 copy number gain
not provided [RCV000683043 ]
Chr8:12552775..35935825 [GRCh37]
pathogenic
Confirmed Target Of
MIR126 hsa-miR-126-5p Mirtarbase external_info CLASH Functional MTI (Weak) 23622248
Predicted Target Of
Count of predictions: 5820 Count of miRNA genes: 1200 Interacting mature miRNAs: 1523 Transcripts: ENST00000311540, ENST00000332246, ENST00000397998, ENST00000454498, ENST00000517494, ENST00000517651, ENST00000518542, ENST00000519222, ENST00000520003, ENST00000522573, ENST00000522732, ENST00000522854, ENST00000523227, ENST00000523262, ENST00000523919, ENST00000524112, ENST00000524213, ENST00000544602 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
597047574 GWAS1143648_H metabolic syndrome QTL GWAS1143648 (human) 8e-15 metabolic syndrome 8 19726822 19726823 Human 596954517 GWAS1074036_H metabolic syndrome QTL GWAS1074036 (human) 4e-11 metabolic syndrome 8 19658107 19658108 Human 597047572 GWAS1143646_H metabolic syndrome QTL GWAS1143646 (human) 4e-11 metabolic syndrome 8 19658107 19658108 Human 597029015 GWAS1125089_H response to antidepressant QTL GWAS1125089 (human) 0.000004 response to antidepressant 8 19663020 19663021 Human 596954518 GWAS1074037_H metabolic syndrome QTL GWAS1074037 (human) 5e-25 metabolic syndrome 8 19718960 19718961 Human 597047573 GWAS1143647_H metabolic syndrome QTL GWAS1143647 (human) 5e-25 metabolic syndrome 8 19718960 19718961 Human 597364376 GWAS1460450_H acute myeloid leukemia QTL GWAS1460450 (human) 3e-13 leukocyte integrity trait (VT:0010898) 8 19726039 19726040 Human 596954519 GWAS1074038_H metabolic syndrome QTL GWAS1074038 (human) 8e-15 metabolic syndrome 8 19726822 19726823 Human 596976017 GWAS1095536_H body height QTL GWAS1095536 (human) 4e-14 body height 8 19500923 19500924 Human 597148319 GWAS1244393_H triglyceride measurement QTL GWAS1244393 (human) 1e-19 triglyceride measurement blood triglyceride level (CMO:0000118) 8 19718332 19718333 Human 597148318 GWAS1244392_H triglyceride measurement QTL GWAS1244392 (human) 1e-09 triglyceride measurement blood triglyceride level (CMO:0000118) 8 19709906 19709907 Human 597148317 GWAS1244391_H triglyceride measurement QTL GWAS1244391 (human) 1e-16 triglyceride measurement blood triglyceride level (CMO:0000118) 8 19660486 19660487 Human 597116060 GWAS1212134_H self reported educational attainment QTL GWAS1212134 (human) 2e-09 self reported educational attainment 8 19521910 19521911 Human 597335825 GWAS1431899_H COVID-19 QTL GWAS1431899 (human) 0.000005 COVID-19 8 19709911 19709912 Human 597118873 GWAS1214947_H appendicular lean mass QTL GWAS1214947 (human) 9e-10 appendicular lean mass 8 19755623 19755624 Human 596965019 GWAS1084538_H diet measurement, sex hormone-binding globulin measurement QTL GWAS1084538 (human) 0.000008 diet measurement, sex hormone-binding globulin measurement 8 19412566 19412567 Human 597343240 GWAS1439314_H sexual dimorphism measurement QTL GWAS1439314 (human) 8e-14 sexual dimorphism measurement 8 19757450 19757451 Human 597149059 GWAS1245133_H bacterial pathogen genotype measurement, pulmonary tuberculosis QTL GWAS1245133 (human) 5e-08 bacterial pathogen genotype measurement, pulmonary tuberculosis 8 19555738 19555739 Human 1298482 BP2_H Blood pressure QTL 2 (human) 1.8 Blood pressure diastolic 8 6953256 32953256 Human 597145398 GWAS1241472_H high density lipoprotein cholesterol measurement QTL GWAS1241472 (human) 8e-36 high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 8 19757450 19757451 Human 597145397 GWAS1241471_H high density lipoprotein cholesterol measurement QTL GWAS1241471 (human) 2e-16 high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 8 19742145 19742146 Human 597258043 GWAS1354117_H triglyceride measurement QTL GWAS1354117 (human) 3e-11 triglyceride measurement blood triglyceride level (CMO:0000118) 8 19749037 19749038 Human 597255869 GWAS1351943_H triglyceride measurement QTL GWAS1351943 (human) 3e-16 triglyceride measurement blood triglyceride level (CMO:0000118) 8 19670025 19670026 Human 597323708 GWAS1419782_H educational attainment QTL GWAS1419782 (human) 2e-08 educational attainment 8 19446748 19446749 Human 597323709 GWAS1419783_H educational attainment QTL GWAS1419783 (human) 3e-11 educational attainment 8 19514163 19514164 Human 407040746 GWAS689722_H self reported educational attainment QTL GWAS689722 (human) 0.000001 self reported educational attainment 8 19470448 19470449 Human 597100989 GWAS1197063_H vesicoureteral reflux QTL GWAS1197063 (human) 0.0000007 vesicoureteral reflux 8 19574687 19574688 Human 597243819 GWAS1339893_H high density lipoprotein cholesterol measurement QTL GWAS1339893 (human) 1e-13 high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 8 19670025 19670026 Human 597148322 GWAS1244396_H triglyceride measurement QTL GWAS1244396 (human) 5e-18 triglyceride measurement blood triglyceride level (CMO:0000118) 8 19755373 19755374 Human 597473706 GWAS1569780_H asparaginase hypersensitivity QTL GWAS1569780 (human) 0.000003 asparaginase hypersensitivity 8 19688743 19688744 Human 597362221 GWAS1458295_H acute myeloid leukemia QTL GWAS1458295 (human) 1e-09 leukocyte integrity trait (VT:0010898) 8 19726039 19726040 Human 597148321 GWAS1244395_H triglyceride measurement QTL GWAS1244395 (human) 2e-21 triglyceride measurement blood triglyceride level (CMO:0000118) 8 19738160 19738161 Human 597148320 GWAS1244394_H triglyceride measurement QTL GWAS1244394 (human) 2e-08 triglyceride measurement blood triglyceride level (CMO:0000118) 8 19734750 19734751 Human 1558703 SCL6_H Serum cholesterol level QTL 1 (human) 1.2 Lipid level HDL cholesterol 8 12468635 38468635 Human 597067054 GWAS1163128_H susceptibility to rheumatic fever measurement QTL GWAS1163128 (human) 0.000008 susceptibility to rheumatic fever measurement 8 19607257 19607258 Human 597100974 GWAS1197048_H vesicoureteral reflux QTL GWAS1197048 (human) 3e-08 vesicoureteral reflux 8 19456108 19456109 Human 597042988 GWAS1139062_H forced expiratory volume QTL GWAS1139062 (human) 0.0000004 forced expiratory volume forced expiratory volume (CMO:0000254) 8 19410684 19410685 Human 597227302 GWAS1323376_H self reported educational attainment QTL GWAS1323376 (human) 2e-09 self reported educational attainment 8 19514256 19514257 Human 597167910 GWAS1263984_H atopic eczema QTL GWAS1263984 (human) 3e-11 atopic eczema 8 19515754 19515755 Human 597067049 GWAS1163123_H susceptibility to rheumatic fever measurement QTL GWAS1163123 (human) 0.000002 susceptibility to rheumatic fever measurement 8 19442699 19442700 Human 597244376 GWAS1340450_H high density lipoprotein cholesterol measurement QTL GWAS1340450 (human) 4e-12 high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 8 19636275 19636276 Human 597076308 GWAS1172382_H oropharynx cancer QTL GWAS1172382 (human) 0.000003 oropharynx cancer 8 19513087 19513088 Human 597045840 GWAS1141914_H soluble triggering receptor expressed on myeloid cells 2 measurement QTL GWAS1141914 (human) 0.0000005 soluble triggering receptor expressed on myeloid cells 2 measurement 8 19626934 19626935 Human 597143504 GWAS1239578_H triglyceride measurement QTL GWAS1239578 (human) 0.0000001 triglyceride measurement blood triglyceride level (CMO:0000118) 8 19719785 19719786 Human 597142111 GWAS1238185_H high density lipoprotein cholesterol measurement QTL GWAS1238185 (human) 4e-08 high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 8 19720961 19720962 Human 597142110 GWAS1238184_H high density lipoprotein cholesterol measurement QTL GWAS1238184 (human) 4e-17 high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 8 19718960 19718961 Human 597142109 GWAS1238183_H high density lipoprotein cholesterol measurement QTL GWAS1238183 (human) 2e-20 high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 8 19660486 19660487 Human 597241673 GWAS1337747_H high density lipoprotein cholesterol measurement QTL GWAS1337747 (human) 1e-09 high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 8 19749037 19749038 Human 597151814 GWAS1247888_H diet measurement, sex hormone-binding globulin measurement QTL GWAS1247888 (human) 0.000008 eating behavior trait (VT:0001431) food intake measurement (CMO:0000772) 8 19412566 19412567 Human 597241672 GWAS1337746_H high density lipoprotein cholesterol measurement QTL GWAS1337746 (human) 1e-09 high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 8 19663020 19663021 Human 597250635 GWAS1346709_H apolipoprotein A 1 measurement QTL GWAS1346709 (human) 3e-10 apolipoprotein A 1 measurement blood apolipoprotein AI level (CMO:0000520) 8 19734750 19734751 Human 597277389 GWAS1373463_H diet measurement QTL GWAS1373463 (human) 4e-08 eating behavior trait (VT:0001431) food intake measurement (CMO:0000772) 8 19756436 19756437 Human 597026880 GWAS1122954_H cesarean section, intelligence QTL GWAS1122954 (human) 0.000009 cesarean section, intelligence 8 19676584 19676585 Human 407123614 GWAS772590_H response to antidepressant QTL GWAS772590 (human) 0.0000002 response to antidepressant 8 19682127 19682128 Human 597339584 GWAS1435658_H sexual dimorphism measurement QTL GWAS1435658 (human) 4e-09 sexual dimorphism measurement 8 19736073 19736074 Human 597144524 GWAS1240598_H APOE carrier status, dementia QTL GWAS1240598 (human) 0.000005 APOE carrier status, dementia 8 19750150 19750151 Human 597240644 GWAS1336718_H high density lipoprotein cholesterol measurement QTL GWAS1336718 (human) 2e-15 high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 8 19734750 19734751 Human 597339460 GWAS1435534_H sexual dimorphism measurement QTL GWAS1435534 (human) 1e-09 sexual dimorphism measurement 8 19755373 19755374 Human 597620476 GWAS1677336_H Vertigo QTL GWAS1677336 (human) 6e-13 Vertigo 8 19614606 19614607 Human 597339257 GWAS1435331_H sexual dimorphism measurement QTL GWAS1435331 (human) 5e-10 sexual dimorphism measurement 8 19736073 19736074 Human 597065214 GWAS1161288_H cognitive decline measurement, memory performance, language measurement QTL GWAS1161288 (human) 0.000004 cognitive behavior trait (VT:0010450) 8 19449107 19449108 Human 597272688 GWAS1368762_H high density lipoprotein cholesterol measurement QTL GWAS1368762 (human) 2e-12 high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 8 19434911 19434912 Human 597344887 GWAS1440961_H eosinophil measurement QTL GWAS1440961 (human) 3e-09 eosinophil measurement 8 19538167 19538168 Human 597242217 GWAS1338291_H triglyceride measurement QTL GWAS1338291 (human) 7e-10 triglyceride measurement blood triglyceride level (CMO:0000118) 8 19734750 19734751 Human 597142112 GWAS1238186_H high density lipoprotein cholesterol measurement QTL GWAS1238186 (human) 5e-21 high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 8 19736073 19736074 Human 597242211 GWAS1338285_H triglyceride measurement QTL GWAS1338285 (human) 4e-10 triglyceride measurement blood triglyceride level (CMO:0000118) 8 19636275 19636276 Human 597212643 GWAS1308717_H mathematical ability QTL GWAS1308717 (human) 2e-08 mathematical ability 8 19521910 19521911 Human 597242212 GWAS1338286_H triglyceride measurement QTL GWAS1338286 (human) 9e-10 triglyceride measurement blood triglyceride level (CMO:0000118) 8 19663020 19663021 Human
RH68573
Human Assembly Chr Position (strand) Source JBrowse GRCh37 8 19,317,990 - 19,318,177 UniSTS GRCh37 Build 36 8 19,362,270 - 19,362,457 RGD NCBI36 Celera 8 18,281,407 - 18,281,594 RGD Cytogenetic Map 8 p21.3 UniSTS HuRef 8 17,858,399 - 17,858,586 UniSTS GeneMap99-GB4 RH Map 8 80.52 UniSTS
G32206
Human Assembly Chr Position (strand) Source JBrowse GRCh37 8 19,493,905 - 19,494,208 UniSTS GRCh37 Build 36 8 19,538,185 - 19,538,488 RGD NCBI36 Celera 8 18,457,221 - 18,457,524 RGD Cytogenetic Map 8 p21.3 UniSTS HuRef 8 18,034,187 - 18,034,490 UniSTS
RH103012
Human Assembly Chr Position (strand) Source JBrowse GRCh37 8 19,261,869 - 19,262,050 UniSTS GRCh37 Build 36 8 19,306,149 - 19,306,330 RGD NCBI36 Celera 8 18,225,207 - 18,225,388 RGD Cytogenetic Map 8 p21.3 UniSTS HuRef 8 17,802,186 - 17,802,367 UniSTS GeneMap99-GB4 RH Map 8 82.04 UniSTS
SHGC-78756
Human Assembly Chr Position (strand) Source JBrowse GRCh37 8 19,434,446 - 19,434,745 UniSTS GRCh37 Build 36 8 19,478,726 - 19,479,025 RGD NCBI36 Celera 8 18,397,796 - 18,398,095 RGD Cytogenetic Map 8 p21.3 UniSTS HuRef 8 17,974,770 - 17,975,069 UniSTS TNG Radiation Hybrid Map 8 10195.0 UniSTS
D8S1643
Human Assembly Chr Position (strand) Source JBrowse GRCh37 8 19,368,676 - 19,368,776 UniSTS GRCh37 Build 36 8 19,412,956 - 19,413,056 RGD NCBI36 Celera 8 18,332,010 - 18,332,110 RGD Cytogenetic Map 8 p21.3 UniSTS Whitehead-RH Map 8 88.9 UniSTS Whitehead-YAC Contig Map 8 UniSTS
AFMA125YC5
Human Assembly Chr Position (strand) Source JBrowse GRCh37 8 19,387,780 - 19,387,886 UniSTS GRCh37 Build 36 8 19,432,060 - 19,432,166 RGD NCBI36 Celera 8 18,351,130 - 18,351,236 RGD Cytogenetic Map 8 p21.3 UniSTS HuRef 8 17,928,070 - 17,928,176 UniSTS
WI-21956
Human Assembly Chr Position (strand) Source JBrowse GRCh37 8 19,328,933 - 19,329,202 UniSTS GRCh37 Build 36 8 19,373,213 - 19,373,482 RGD NCBI36 Celera 8 18,292,350 - 18,292,619 RGD Cytogenetic Map 8 p21.3 UniSTS HuRef 8 17,869,284 - 17,869,553 UniSTS GeneMap99-GB4 RH Map 8 85.37 UniSTS Whitehead-RH Map 8 75.5 UniSTS
D10S16
No map positions available.
D11S2560
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 10 p12.1-p11.2 UniSTS Cytogenetic Map 22 q13.1 UniSTS Cytogenetic Map 12 p13.3 UniSTS Cytogenetic Map 20 q13.3 UniSTS Cytogenetic Map 19 p13.12 UniSTS Cytogenetic Map 8 q21.13 UniSTS Cytogenetic Map 18 p11.22 UniSTS Cytogenetic Map 9 p13.3-p12 UniSTS Cytogenetic Map 10 p12.1 UniSTS Cytogenetic Map 19 q13.11 UniSTS Cytogenetic Map 22 q11.23 UniSTS Cytogenetic Map 5 q23.3 UniSTS Cytogenetic Map 15 q21.1 UniSTS Cytogenetic Map 14 q24.2 UniSTS Cytogenetic Map 15 q13 UniSTS Cytogenetic Map 6 q25.3 UniSTS Cytogenetic Map 8 p22-p21 UniSTS Cytogenetic Map 1 p34.1 UniSTS Cytogenetic Map 4 p16.3 UniSTS Cytogenetic Map 17 q12 UniSTS Cytogenetic Map 15 q21.3 UniSTS Cytogenetic Map 12 q24.31 UniSTS Cytogenetic Map 2 p13.1 UniSTS Cytogenetic Map 19 q13.12 UniSTS Cytogenetic Map 10 q24.2 UniSTS Cytogenetic Map 2 p23.3 UniSTS Cytogenetic Map 19 q13.42 UniSTS Cytogenetic Map 6 q16.2 UniSTS Cytogenetic Map X q26.3 UniSTS Cytogenetic Map 9 q22.33 UniSTS Cytogenetic Map 7 q21.2 UniSTS Cytogenetic Map 16 p11.2 UniSTS Cytogenetic Map 8 q24.13 UniSTS Cytogenetic Map 4 q25 UniSTS Cytogenetic Map 12 p13.33 UniSTS Cytogenetic Map 19 p13.3 UniSTS Cytogenetic Map 5 q23 UniSTS Cytogenetic Map 16 p13.3 UniSTS Cytogenetic Map 1 q32.1 UniSTS Cytogenetic Map 3 p21.2 UniSTS Cytogenetic Map 19 q13.32 UniSTS Cytogenetic Map 1 p13.2 UniSTS Cytogenetic Map 6 q27 UniSTS Cytogenetic Map 2 p13.3 UniSTS Cytogenetic Map 2 p25.1 UniSTS Cytogenetic Map 16 q24.1 UniSTS Cytogenetic Map 7 q22.1 UniSTS Cytogenetic Map 22 q11.21 UniSTS Cytogenetic Map 17 q21.31 UniSTS Cytogenetic Map 2 q12.1 UniSTS Cytogenetic Map 9 q13-q21 UniSTS Cytogenetic Map 19 p12 UniSTS Cytogenetic Map 2 p15 UniSTS Cytogenetic Map 8 q11.21 UniSTS Cytogenetic Map 15 q15 UniSTS Cytogenetic Map 1 p36.21 UniSTS Cytogenetic Map 12 q23-q24.1 UniSTS Cytogenetic Map 1 p34.2 UniSTS Cytogenetic Map 10 q23.2 UniSTS Cytogenetic Map 3 q23 UniSTS Cytogenetic Map 19 p13.2 UniSTS Cytogenetic Map 15 q21 UniSTS Cytogenetic Map 9 q34.2 UniSTS Cytogenetic Map 17 q25.1 UniSTS Cytogenetic Map 2 q35 UniSTS Cytogenetic Map 6 p21.1 UniSTS Cytogenetic Map 22 q12.2 UniSTS Cytogenetic Map 1 p32 UniSTS Cytogenetic Map 1 p35.1 UniSTS Cytogenetic Map 7 p15.2 UniSTS Cytogenetic Map 12 p13.2 UniSTS Cytogenetic Map 16 q12.2 UniSTS Cytogenetic Map 3 q26.2-q27 UniSTS Cytogenetic Map 2 p21 UniSTS Cytogenetic Map 8 p23.1 UniSTS Cytogenetic Map 17 p11.2 UniSTS Cytogenetic Map X p11.2 UniSTS Cytogenetic Map 20 q11.2 UniSTS Cytogenetic Map 3 q26.2 UniSTS Cytogenetic Map 4 q22.1 UniSTS Cytogenetic Map 4 p15.32 UniSTS Cytogenetic Map 7 q36.3 UniSTS Cytogenetic Map 2 q33.2 UniSTS Cytogenetic Map 20 q13.13 UniSTS Cytogenetic Map 10 p13 UniSTS Cytogenetic Map 19 q13.4 UniSTS Cytogenetic Map 1 p36.11-p34.2 UniSTS Cytogenetic Map 1 q21.3 UniSTS Cytogenetic Map 8 p21.3 UniSTS Cytogenetic Map 18 p11.32 UniSTS Cytogenetic Map 17 p13.2 UniSTS Cytogenetic Map 8 q22.1 UniSTS Cytogenetic Map 16 q22.1 UniSTS Cytogenetic Map 3 p21 UniSTS Cytogenetic Map 14 q13.2 UniSTS Cytogenetic Map 8 q12.1 UniSTS Cytogenetic Map 3 p22.3 UniSTS Cytogenetic Map 8 q24.3 UniSTS Cytogenetic Map 13 q12.11 UniSTS Cytogenetic Map 12 p12 UniSTS Cytogenetic Map 22 q13.33 UniSTS Cytogenetic Map 14 q31.1 UniSTS Cytogenetic Map 21 q22.2 UniSTS Cytogenetic Map 2 p11.2 UniSTS Cytogenetic Map 18 q12.3 UniSTS Cytogenetic Map 12 q13.3 UniSTS Cytogenetic Map 2 p16.1 UniSTS Cytogenetic Map 9 q34.11 UniSTS Cytogenetic Map 12 q13.13 UniSTS Cytogenetic Map 8 q24.21 UniSTS Cytogenetic Map 12 q22-q23.1 UniSTS Cytogenetic Map 3 q26.33 UniSTS Cytogenetic Map 1 q23 UniSTS Cytogenetic Map 11 p15.1 UniSTS Cytogenetic Map 7 q32 UniSTS Cytogenetic Map 11 p13 UniSTS Cytogenetic Map 5 p13.1 UniSTS Cytogenetic Map 18 q21 UniSTS Cytogenetic Map 7 p14-p13 UniSTS Cytogenetic Map 11 q13 UniSTS Cytogenetic Map 11 q22-q23 UniSTS Cytogenetic Map 19 p13.3-p13.2 UniSTS Cytogenetic Map 6 q22-q23 UniSTS Cytogenetic Map 7 p14.3 UniSTS Cytogenetic Map 1 q21.1 UniSTS Cytogenetic Map 14 q32.31 UniSTS Cytogenetic Map 11 q13.1-q13.3 UniSTS Cytogenetic Map 1 q32 UniSTS Cytogenetic Map 6 p24 UniSTS Cytogenetic Map 10 q25 UniSTS Cytogenetic Map 8 q22.3 UniSTS Cytogenetic Map 2 p14 UniSTS Cytogenetic Map 1 p36.31 UniSTS Cytogenetic Map 6 q13 UniSTS Cytogenetic Map 2 p25.2 UniSTS Cytogenetic Map 1 p31.1 UniSTS Cytogenetic Map 15 q14-q15 UniSTS Cytogenetic Map 9 q31.1 UniSTS Cytogenetic Map 21 q22.11 UniSTS Cytogenetic Map 7 p15.3 UniSTS Cytogenetic Map 5 q35.3 UniSTS Cytogenetic Map 1 p36.32 UniSTS Cytogenetic Map 15 q11.2 UniSTS Cytogenetic Map 12 p12.1 UniSTS Cytogenetic Map X q25 UniSTS Cytogenetic Map X q28 UniSTS Cytogenetic Map 19 q13.3 UniSTS Cytogenetic Map 8 p21.1 UniSTS Cytogenetic Map 3 p26.1-p25.1 UniSTS Cytogenetic Map 6 q16.3 UniSTS Cytogenetic Map 3 q21.3 UniSTS Cytogenetic Map X q27.1 UniSTS Cytogenetic Map 3 q12.3 UniSTS Cytogenetic Map 3 q25.31 UniSTS Cytogenetic Map 17 q25.3 UniSTS Cytogenetic Map 17 p13.3 UniSTS Cytogenetic Map 11 q12.3 UniSTS Cytogenetic Map 11 q13.4 UniSTS Cytogenetic Map 19 q13.1 UniSTS Cytogenetic Map 1 q42.3 UniSTS Cytogenetic Map 22 q13.2 UniSTS Cytogenetic Map 12 q13.12 UniSTS Cytogenetic Map 2 q33.1 UniSTS Cytogenetic Map 11 q23.3 UniSTS Cytogenetic Map 4 q31.1 UniSTS Cytogenetic Map 14 q32.33 UniSTS Cytogenetic Map 9 q33.2 UniSTS Cytogenetic Map 5 q13 UniSTS Cytogenetic Map 8 q12 UniSTS Cytogenetic Map 15 q22.31 UniSTS Cytogenetic Map 17 q24.3 UniSTS Cytogenetic Map 5 q12.3 UniSTS Cytogenetic Map 1 p32.3 UniSTS Cytogenetic Map 6 q21 UniSTS Cytogenetic Map 10 q24.32 UniSTS Cytogenetic Map 19 q13 UniSTS Cytogenetic Map 17 q21 UniSTS Cytogenetic Map 14 q32.32 UniSTS Cytogenetic Map 16 p13.2 UniSTS Cytogenetic Map 1 p36.33 UniSTS Cytogenetic Map 10 q11.22 UniSTS Cytogenetic Map 1 p34 UniSTS Cytogenetic Map 6 q14.1 UniSTS Cytogenetic Map 14 q32 UniSTS Cytogenetic Map 1 p36.3-p36.2 UniSTS Cytogenetic Map 2 q11.2 UniSTS Cytogenetic Map 1 p32-p31 UniSTS Cytogenetic Map 7 q34 UniSTS Cytogenetic Map 5 q33.1 UniSTS Cytogenetic Map 2 q21.1 UniSTS Cytogenetic Map 19 q13.41 UniSTS Cytogenetic Map 18 p11.21 UniSTS Cytogenetic Map 10 q26.11 UniSTS Cytogenetic Map 12 q14.3 UniSTS Cytogenetic Map 5 q34 UniSTS Cytogenetic Map 2 q36.1 UniSTS Cytogenetic Map 15 q25.2 UniSTS Cytogenetic Map 1 q21 UniSTS Cytogenetic Map 4 p16.1 UniSTS Cytogenetic Map 9 q32 UniSTS Cytogenetic Map 15 q24 UniSTS Cytogenetic Map 1 p34.3 UniSTS Cytogenetic Map 12 q21 UniSTS Cytogenetic Map 19 q13.43 UniSTS Cytogenetic Map 1 p35-p34 UniSTS Cytogenetic Map 9 q34.1 UniSTS Cytogenetic Map 9 q22.2 UniSTS Cytogenetic Map X p22 UniSTS Cytogenetic Map 13 q14 UniSTS Cytogenetic Map 2 q33 UniSTS Cytogenetic Map 16 p12.2 UniSTS Cytogenetic Map 10 q11.23 UniSTS Cytogenetic Map 20 q13.31 UniSTS Cytogenetic Map 3 p25.2 UniSTS Cytogenetic Map 5 q11 UniSTS
D16S325
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 9 q34.13 UniSTS Cytogenetic Map 9 q22.33 UniSTS Cytogenetic Map 20 p13 UniSTS Cytogenetic Map 4 q21.1 UniSTS Cytogenetic Map 6 q25.3 UniSTS Cytogenetic Map 2 q32.3 UniSTS Cytogenetic Map 6 q22 UniSTS Cytogenetic Map 12 q24.31 UniSTS Cytogenetic Map 17 q21.2-q21.3 UniSTS Cytogenetic Map 13 q14.3 UniSTS Cytogenetic Map 17 q11.2 UniSTS Cytogenetic Map 2 q33.3 UniSTS Cytogenetic Map 20 q13.32 UniSTS Cytogenetic Map 1 p21.2 UniSTS Cytogenetic Map 1 p35.1 UniSTS Cytogenetic Map 12 q13.2 UniSTS Cytogenetic Map 17 q12 UniSTS Cytogenetic Map 19 p13.12 UniSTS Cytogenetic Map 12 p13.32 UniSTS Cytogenetic Map 19 p13.3 UniSTS Cytogenetic Map 17 p13.2 UniSTS Cytogenetic Map 8 q22.3 UniSTS Cytogenetic Map 5 q35.3 UniSTS Cytogenetic Map 1 p13.1 UniSTS Cytogenetic Map 7 q22.1 UniSTS Cytogenetic Map 4 q25 UniSTS Cytogenetic Map 19 q13.32 UniSTS Cytogenetic Map 7 p22.2 UniSTS Cytogenetic Map 7 q33 UniSTS Cytogenetic Map 1 p31.3 UniSTS Cytogenetic Map 16 q24.1 UniSTS Cytogenetic Map 6 q13 UniSTS Cytogenetic Map 4 p16.3 UniSTS Cytogenetic Map 2 q35 UniSTS Cytogenetic Map 10 q11.2 UniSTS Cytogenetic Map 7 q11.23 UniSTS Cytogenetic Map 3 q13.32 UniSTS Cytogenetic Map 19 p12 UniSTS Cytogenetic Map 19 p13.11 UniSTS Cytogenetic Map 19 q13.41 UniSTS Cytogenetic Map 6 p22.3 UniSTS Cytogenetic Map 12 q22 UniSTS Cytogenetic Map 21 q22.3 UniSTS Cytogenetic Map 3 q22.1 UniSTS Cytogenetic Map 19 p13.2 UniSTS Cytogenetic Map 6 q25.2-q25.3 UniSTS Cytogenetic Map 1 p36.1 UniSTS Cytogenetic Map 22 q11.2 UniSTS Cytogenetic Map 3 q26.31 UniSTS Cytogenetic Map 7 p12.3 UniSTS Cytogenetic Map 4 q12 UniSTS Cytogenetic Map 5 p12 UniSTS Cytogenetic Map 9 q21.13 UniSTS Cytogenetic Map 17 q21.33 UniSTS Cytogenetic Map 20 p12.3-p11.21 UniSTS Cytogenetic Map 11 q13 UniSTS Cytogenetic Map 2 p13-p12 UniSTS Cytogenetic Map 1 q32 UniSTS Cytogenetic Map 7 p13 UniSTS Cytogenetic Map 4 q22.1 UniSTS Cytogenetic Map 3 q25.33 UniSTS Cytogenetic Map 2 q33.2 UniSTS Cytogenetic Map 7 p11.2 UniSTS Cytogenetic Map 8 q21.13 UniSTS Cytogenetic Map 7 q32.1 UniSTS Cytogenetic Map 8 p21.3 UniSTS Cytogenetic Map 17 q22 UniSTS Cytogenetic Map 3 p24.2 UniSTS Cytogenetic Map 8 q24.3 UniSTS Cytogenetic Map 14 q32 UniSTS Cytogenetic Map X p22.33 UniSTS Cytogenetic Map Y p11.32 UniSTS Cytogenetic Map 10 q24.31 UniSTS Cytogenetic Map 4 q34.3 UniSTS Cytogenetic Map 10 p11.23 UniSTS Cytogenetic Map 10 p15.1 UniSTS Cytogenetic Map 14 q21.2 UniSTS Cytogenetic Map 6 p21.31 UniSTS Cytogenetic Map 9 p24.1-p23 UniSTS Cytogenetic Map 15 q15.3 UniSTS Cytogenetic Map 12 q12 UniSTS Cytogenetic Map 5 q32 UniSTS Cytogenetic Map 10 pter-q25.3 UniSTS Cytogenetic Map 6 q25.2-q27 UniSTS Cytogenetic Map 15 q26.3 UniSTS Cytogenetic Map 15 q14 UniSTS Cytogenetic Map 2 p23.3 UniSTS Cytogenetic Map 19 q13.12 UniSTS Cytogenetic Map 3 q23 UniSTS Cytogenetic Map 1 q21.2 UniSTS Cytogenetic Map 1 q21.3 UniSTS Cytogenetic Map 11 p11.2 UniSTS Cytogenetic Map 17 q21.32 UniSTS Cytogenetic Map 11 p15.5 UniSTS Cytogenetic Map 7 p15.3 UniSTS Cytogenetic Map 7 p21.1 UniSTS Cytogenetic Map 17 q23.2 UniSTS Cytogenetic Map 11 q13.2 UniSTS Cytogenetic Map 1 p36.3-p34.3 UniSTS Cytogenetic Map 1 p13.3 UniSTS Cytogenetic Map 4 p15.2 UniSTS Cytogenetic Map 3 p25.3 UniSTS Cytogenetic Map 2 p11.2 UniSTS Cytogenetic Map 2 q24.3 UniSTS Cytogenetic Map 1 q25.2 UniSTS Cytogenetic Map 6 q27 UniSTS Cytogenetic Map 12 q14.3 UniSTS Cytogenetic Map 19 q13.3 UniSTS Cytogenetic Map 22 q13.1 UniSTS Cytogenetic Map 6 p21.1 UniSTS Cytogenetic Map 17 p11.2 UniSTS Cytogenetic Map 3 q27.1 UniSTS Cytogenetic Map 15 q11.2 UniSTS Cytogenetic Map 6 p21.33 UniSTS Cytogenetic Map 20 q11.23 UniSTS Cytogenetic Map 2 q12.2 UniSTS Cytogenetic Map 11 q13.4 UniSTS Cytogenetic Map 3 p26 UniSTS Cytogenetic Map X q28 UniSTS Cytogenetic Map 3 p14.3 UniSTS Cytogenetic Map 17 q25.1 UniSTS Cytogenetic Map 10 q21-q22 UniSTS Cytogenetic Map 5 q22 UniSTS Cytogenetic Map 19 q13.43 UniSTS Cytogenetic Map 10 q22.2 UniSTS Cytogenetic Map 8 p22 UniSTS Cytogenetic Map 22 q11.23 UniSTS Cytogenetic Map 16 q22.1 UniSTS Cytogenetic Map 12 q14.2 UniSTS Cytogenetic Map 11 q22.3 UniSTS Cytogenetic Map 10 q26.11 UniSTS Cytogenetic Map 10 q25.3 UniSTS Cytogenetic Map 6 q22.32 UniSTS Cytogenetic Map 20 q13.12 UniSTS Cytogenetic Map 1 q21.1 UniSTS Cytogenetic Map 19 q13.31 UniSTS Cytogenetic Map 17 p13.1 UniSTS Cytogenetic Map 12 q23.3 UniSTS Cytogenetic Map 3 q21 UniSTS Cytogenetic Map 3 q21.3 UniSTS Cytogenetic Map 17 q21.31 UniSTS Cytogenetic Map 13 q14.11 UniSTS Cytogenetic Map 7 q36 UniSTS Cytogenetic Map 4 q26 UniSTS Cytogenetic Map 19 qter UniSTS Cytogenetic Map 7 p13-p12 UniSTS Cytogenetic Map 2 p22 UniSTS Cytogenetic Map 2 q14.3 UniSTS Cytogenetic Map 19 q13.4 UniSTS
D1S1425
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 19 q13.3 UniSTS Cytogenetic Map 1 p33 UniSTS Cytogenetic Map 17 q11.2 UniSTS Cytogenetic Map 1 p31.3 UniSTS Cytogenetic Map 22 q13.1 UniSTS Cytogenetic Map 9 q34.3 UniSTS Cytogenetic Map 6 q25.3 UniSTS Cytogenetic Map 19 p13.12 UniSTS Cytogenetic Map 1 q32.1 UniSTS Cytogenetic Map 2 p13.1 UniSTS Cytogenetic Map 5 q35.3 UniSTS Cytogenetic Map 2 p11.2 UniSTS Cytogenetic Map 4 q21.23 UniSTS Cytogenetic Map 22 q12.1 UniSTS Cytogenetic Map 8 q24.13 UniSTS Cytogenetic Map 1 p36.33 UniSTS Cytogenetic Map 11 q13 UniSTS Cytogenetic Map 1 q23.1 UniSTS Cytogenetic Map 10 q22 UniSTS Cytogenetic Map 4 q12 UniSTS Cytogenetic Map 10 p14 UniSTS Cytogenetic Map 6 p21.33 UniSTS Cytogenetic Map 10 q26.3 UniSTS Cytogenetic Map 7 q22.1 UniSTS Cytogenetic Map 19 q13.32 UniSTS Cytogenetic Map 17 q21.31 UniSTS Cytogenetic Map 7 p22.2 UniSTS Cytogenetic Map 12 q13.12 UniSTS Cytogenetic Map 18 p11.21 UniSTS Cytogenetic Map 14 q32.12 UniSTS Cytogenetic Map 2 q31.1 UniSTS Cytogenetic Map 18 p11.31 UniSTS Cytogenetic Map 13 q34 UniSTS Cytogenetic Map 4 p14 UniSTS Cytogenetic Map 8 p23.1 UniSTS Cytogenetic Map 4 p16.3 UniSTS Cytogenetic Map 3 q21.3 UniSTS Cytogenetic Map 19 p13.2 UniSTS Cytogenetic Map 8 q12.1 UniSTS Cytogenetic Map 11 q12.3 UniSTS Cytogenetic Map 16 p11.2 UniSTS Cytogenetic Map 10 p12 UniSTS Cytogenetic Map 12 q13 UniSTS Cytogenetic Map 11 p15.4 UniSTS Cytogenetic Map 19 p12 UniSTS Cytogenetic Map 16 p13.3 UniSTS Cytogenetic Map 8 q24 UniSTS Cytogenetic Map 2 p23.3 UniSTS Cytogenetic Map 5 q13.2 UniSTS Cytogenetic Map 5 q32 UniSTS Cytogenetic Map 1 q21.2 UniSTS Cytogenetic Map 3 q26.2 UniSTS Cytogenetic Map 6 q25.2-q25.3 UniSTS Cytogenetic Map 20 q11.2-q13.2 UniSTS Cytogenetic Map 12 q13.3 UniSTS Cytogenetic Map 1 q21-q23 UniSTS Cytogenetic Map 17 q21.32 UniSTS Cytogenetic Map 1 p35.3 UniSTS Cytogenetic Map 1 p12 UniSTS Cytogenetic Map 2 p23-p22 UniSTS Cytogenetic Map 2 q36.1 UniSTS Cytogenetic Map 11 q23.3 UniSTS Cytogenetic Map 2 p16.1 UniSTS Cytogenetic Map 19 q13.2 UniSTS Cytogenetic Map 16 q12.1 UniSTS Cytogenetic Map 17 q22-q23 UniSTS Cytogenetic Map 2 p11.1 UniSTS Cytogenetic Map 16 q12.2 UniSTS Cytogenetic Map 2 p12-p11.2 UniSTS Cytogenetic Map 3 q11.1 UniSTS Cytogenetic Map 2 p21 UniSTS Cytogenetic Map 17 q11.2-q12 UniSTS Cytogenetic Map 2 q37.1 UniSTS Cytogenetic Map 1 p32-p31 UniSTS Cytogenetic Map 1 p21.3 UniSTS Cytogenetic Map 1 q32.2 UniSTS Cytogenetic Map 19 q13.1 UniSTS Cytogenetic Map 7 q21-q22 UniSTS Cytogenetic Map 1 q25.3 UniSTS Cytogenetic Map 18 p11.3-p11.2 UniSTS Cytogenetic Map 2 q33.2 UniSTS Cytogenetic Map 20 q13.13 UniSTS Cytogenetic Map 21 p11.1 UniSTS Cytogenetic Map 12 q24.31-q24.32 UniSTS Cytogenetic Map 9 q33.2 UniSTS Cytogenetic Map 11 q13.5 UniSTS Cytogenetic Map 12 p12.2-p11.2 UniSTS Cytogenetic Map 21 q22.3 UniSTS Cytogenetic Map 2 q14.3 UniSTS Cytogenetic Map 19 p13.3-p13.2 UniSTS Cytogenetic Map 7 q32.1 UniSTS Cytogenetic Map 8 p21.3 UniSTS Cytogenetic Map 17 q22-q23.2 UniSTS Cytogenetic Map 3 q27.1 UniSTS Cytogenetic Map 11 q13.1 UniSTS Cytogenetic Map 4 q21.21 UniSTS Cytogenetic Map 1 q32 UniSTS Cytogenetic Map 14 q32 UniSTS Cytogenetic Map 14 q24.2 UniSTS Cytogenetic Map 20 q13.33 UniSTS Cytogenetic Map 3 p21 UniSTS Cytogenetic Map 10 p11.23 UniSTS Cytogenetic Map 1 p35.1 UniSTS Cytogenetic Map 1 q25.2 UniSTS Cytogenetic Map 18 q12.1 UniSTS Cytogenetic Map 1 p34.3 UniSTS Cytogenetic Map 2 q11.2 UniSTS Cytogenetic Map 15 q23 UniSTS Cytogenetic Map 8 q24.3 UniSTS Cytogenetic Map 13 q12.11 UniSTS Cytogenetic Map 1 p36.31 UniSTS Cytogenetic Map 3 q21.1 UniSTS Cytogenetic Map 12 p12 UniSTS Cytogenetic Map 21 q22.11 UniSTS Cytogenetic Map 15 q15.3 UniSTS Cytogenetic Map X q12-q13 UniSTS Cytogenetic Map 22 q11.2 UniSTS Cytogenetic Map 7 q31.1-q31.3 UniSTS Cytogenetic Map X p22.11 UniSTS Cytogenetic Map 3 p21.1-p14.2 UniSTS Cytogenetic Map 2 p24 UniSTS Cytogenetic Map 20 p12.1 UniSTS Cytogenetic Map 3 q26.33 UniSTS Cytogenetic Map 12 q13.11-q14.3 UniSTS Cytogenetic Map 2 q37.3 UniSTS Cytogenetic Map 9 q21.33 UniSTS Cytogenetic Map 12 q12 UniSTS Cytogenetic Map X q13-q21 UniSTS Cytogenetic Map 8 q24.22 UniSTS Cytogenetic Map 11 p13 UniSTS Cytogenetic Map 17 q25.1 UniSTS Cytogenetic Map 6 q25.2-q27 UniSTS Cytogenetic Map 12 q24.32 UniSTS Cytogenetic Map 15 q22.31 UniSTS Cytogenetic Map X q13.1 UniSTS Cytogenetic Map 22 q12.2 UniSTS Cytogenetic Map 14 q12 UniSTS Cytogenetic Map 12 q23-q24.1 UniSTS Cytogenetic Map 4 q35.1 UniSTS Cytogenetic Map 17 q24.1 UniSTS Cytogenetic Map 17 p13.3 UniSTS Cytogenetic Map 14 q21 UniSTS Cytogenetic Map 9 p24.3 UniSTS Cytogenetic Map 7 p13 UniSTS Cytogenetic Map 2 p14 UniSTS Cytogenetic Map 21 q22.2 UniSTS Cytogenetic Map 2 q12.3 UniSTS Cytogenetic Map 8 p21.1 UniSTS Cytogenetic Map 17 p13.2 UniSTS Cytogenetic Map 3 q25.33 UniSTS Cytogenetic Map 19 q13.12 UniSTS Cytogenetic Map 5 q31.1 UniSTS Cytogenetic Map 1 p34 UniSTS Cytogenetic Map 19 p13.1 UniSTS Cytogenetic Map 5 q14.1 UniSTS Cytogenetic Map X q22.3 UniSTS Cytogenetic Map 7 p21.1 UniSTS Cytogenetic Map 6 p25.2 UniSTS Cytogenetic Map 10 q23.33 UniSTS Cytogenetic Map 15 q11-q12 UniSTS Cytogenetic Map 3 p22.2 UniSTS Cytogenetic Map 1 p13.3 UniSTS Cytogenetic Map 15 q21.1-q21.2 UniSTS Cytogenetic Map 6 p21.3 UniSTS Cytogenetic Map 7 q34 UniSTS Cytogenetic Map 4 q13.3 UniSTS Cytogenetic Map 19 p13.13 UniSTS Cytogenetic Map 19 q13.41 UniSTS Cytogenetic Map 17 q24.3 UniSTS Cytogenetic Map 12 p13.33 UniSTS Cytogenetic Map 11 q14.1 UniSTS Cytogenetic Map 3 p22-p21.3 UniSTS Cytogenetic Map 16 q22.3 UniSTS Cytogenetic Map 1 p22.1 UniSTS Cytogenetic Map 6 p12.1 UniSTS Cytogenetic Map 19 q13.33-q13.41 UniSTS Cytogenetic Map 2 p25.3 UniSTS Cytogenetic Map 22 q13.2 UniSTS Cytogenetic Map 5 p12 UniSTS Cytogenetic Map 6 q21 UniSTS Cytogenetic Map 7 q35 UniSTS Cytogenetic Map 17 p12 UniSTS Cytogenetic Map 7 q11.1 UniSTS Cytogenetic Map 2 p25.1-p24.1 UniSTS Cytogenetic Map 3 q23 UniSTS Cytogenetic Map 4 q31.21 UniSTS Cytogenetic Map 5 p13.1 UniSTS Cytogenetic Map X q22.1 UniSTS Cytogenetic Map 9 q21.11 UniSTS Cytogenetic Map 5 q13 UniSTS Cytogenetic Map 1 p22.2 UniSTS Cytogenetic Map 12 q13.13 UniSTS Cytogenetic Map 12 q24 UniSTS Cytogenetic Map X q24 UniSTS Cytogenetic Map 1 q24.2 UniSTS Cytogenetic Map 22 q13.31 UniSTS Cytogenetic Map 8 p11.23 UniSTS Cytogenetic Map 1 q23.3 UniSTS Cytogenetic Map 16 p12 UniSTS Cytogenetic Map 10 p15-p14 UniSTS Cytogenetic Map 19 q13 UniSTS Cytogenetic Map 1 q22-q23 UniSTS Cytogenetic Map 20 q11.23 UniSTS Cytogenetic Map 7 q31 UniSTS Cytogenetic Map 10 q26 UniSTS Cytogenetic Map 7 p22.1 UniSTS Cytogenetic Map 6 p22.3 UniSTS Cytogenetic Map 6 p21.2 UniSTS Cytogenetic Map 11 q13.4 UniSTS Cytogenetic Map 11 q24.2 UniSTS Cytogenetic Map X q28 UniSTS Cytogenetic Map 1 p33-p32 UniSTS Cytogenetic Map 5 q35.2 UniSTS Cytogenetic Map 3 p14.3 UniSTS Cytogenetic Map 12 q24.33 UniSTS Cytogenetic Map 3 q26.1-q26.2 UniSTS Cytogenetic Map 12 p13 UniSTS Cytogenetic Map 7 q36.1 UniSTS Cytogenetic Map 8 p11.21 UniSTS Cytogenetic Map 12 q13.1-q13.2 UniSTS Cytogenetic Map 1 p36.11 UniSTS Cytogenetic Map 19 q13.33 UniSTS Cytogenetic Map 16 p12.3 UniSTS Cytogenetic Map 13 q14.11 UniSTS Cytogenetic Map 9 p13.2 UniSTS Cytogenetic Map 4 q22.1 UniSTS Cytogenetic Map 3 q13.2 UniSTS Cytogenetic Map 8 p22 UniSTS Cytogenetic Map 22 q11.23 UniSTS Cytogenetic Map 22 q11.21 UniSTS Cytogenetic Map 1 q42.3 UniSTS Cytogenetic Map 19 q13.43 UniSTS Cytogenetic Map 5 q12.3 UniSTS Cytogenetic Map 20 q11.21 UniSTS Cytogenetic Map 9 q34.11 UniSTS Cytogenetic Map 12 q14.3 UniSTS Cytogenetic Map 6 q15 UniSTS Cytogenetic Map 6 q22.32 UniSTS Cytogenetic Map 6 p21.1 UniSTS Cytogenetic Map 19 q13.31 UniSTS Cytogenetic Map 16 p13.11 UniSTS Cytogenetic Map 10 q24.32 UniSTS Cytogenetic Map 4 p16.1 UniSTS Cytogenetic Map 18 q11.1 UniSTS Cytogenetic Map 16 q23.2 UniSTS Cytogenetic Map 3 q12.1 UniSTS Cytogenetic Map 15 q24-q25 UniSTS Cytogenetic Map 7 q31.1 UniSTS Cytogenetic Map 15 q26.1 UniSTS Cytogenetic Map 8 q13.1 UniSTS Cytogenetic Map 6 pter-p12.1 UniSTS Cytogenetic Map 6 q16 UniSTS Cytogenetic Map 12 q14.1 UniSTS Cytogenetic Map 17 q21.2 UniSTS Cytogenetic Map 9 q22.2 UniSTS Cytogenetic Map 17 q23.2 UniSTS Cytogenetic Map 11 q23.1-q23.2 UniSTS Cytogenetic Map 13 q14 UniSTS Cytogenetic Map 4 q23 UniSTS Cytogenetic Map 16 p12.2 UniSTS Cytogenetic Map 11 q24.3 UniSTS Cytogenetic Map 7 p14 UniSTS Cytogenetic Map 15 q24.1 UniSTS Cytogenetic Map 16 q24.2 UniSTS Cytogenetic Map 12 q13.11 UniSTS Cytogenetic Map 9 p13.3 UniSTS Cytogenetic Map 8 q22.1 UniSTS Cytogenetic Map 6 q16.2 UniSTS Cytogenetic Map 5 p15.2 UniSTS Cytogenetic Map 20 q13.12 UniSTS Cytogenetic Map 14 q22.3 UniSTS Cytogenetic Map 2 q13 UniSTS Cytogenetic Map 3 p21.3 UniSTS Cytogenetic Map 12 q13.2 UniSTS Cytogenetic Map 20 p13 UniSTS Cytogenetic Map 3 q29 UniSTS Cytogenetic Map 5 q23.3-q31.1 UniSTS Cytogenetic Map 1 p36 UniSTS Cytogenetic Map 19 p13.11 UniSTS Cytogenetic Map 17 q12 UniSTS Cytogenetic Map 2 q35 UniSTS Cytogenetic Map 17 p11.2 UniSTS Cytogenetic Map 1 p34.2 UniSTS Cytogenetic Map 12 p13.31 UniSTS Cytogenetic Map 3 q12.3 UniSTS Cytogenetic Map 11 q23 UniSTS Cytogenetic Map 12 q24.31 UniSTS Cytogenetic Map 17 q25.3 UniSTS Cytogenetic Map 20 q11 UniSTS Cytogenetic Map 16 q22.1 UniSTS Cytogenetic Map 5 q23.3 UniSTS Cytogenetic Map 15 q15.1 UniSTS Cytogenetic Map 17 q21 UniSTS Cytogenetic Map 1 q42 UniSTS Cytogenetic Map X p11.23 UniSTS Cytogenetic Map 12 q24.13 UniSTS Cytogenetic Map 3 q27.3 UniSTS Cytogenetic Map 14 q21.3 UniSTS Cytogenetic Map 19 p13.3 UniSTS Cytogenetic Map 2 p15 UniSTS Cytogenetic Map 17 q22 UniSTS Cytogenetic Map 20 q13.32 UniSTS Cytogenetic Map 14 q24.3 UniSTS Cytogenetic Map X q21.1 UniSTS
D10S16
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 3 p24.2 UniSTS Cytogenetic Map 21 q21.3 UniSTS Cytogenetic Map 1 p36.33 UniSTS Cytogenetic Map 16 q24.1 UniSTS Cytogenetic Map 5 q31 UniSTS Cytogenetic Map 17 p11.2 UniSTS Cytogenetic Map 11 q24.2 UniSTS Cytogenetic Map 5 q23.3-q31.1 UniSTS Cytogenetic Map 7 q32 UniSTS Cytogenetic Map 1 q21-q23 UniSTS Cytogenetic Map X p11.23 UniSTS Cytogenetic Map 2 q11.2-q12 UniSTS Cytogenetic Map 7 p13 UniSTS Cytogenetic Map 19 q13.4 UniSTS Cytogenetic Map 17 q25.1 UniSTS Cytogenetic Map 1 p36.21 UniSTS Cytogenetic Map 3 p22 UniSTS Cytogenetic Map 19 p13.2 UniSTS Cytogenetic Map 2 p12 UniSTS Cytogenetic Map 19 q13.12 UniSTS Cytogenetic Map 9 p13.3-p12 UniSTS Cytogenetic Map 3 p21.1 UniSTS Cytogenetic Map 5 p13.1 UniSTS Cytogenetic Map 14 q24.3 UniSTS Cytogenetic Map 2 p25.2 UniSTS Cytogenetic Map 5 q21-q22 UniSTS Cytogenetic Map 2 p22.1 UniSTS Cytogenetic Map 1 q32.3 UniSTS Cytogenetic Map 1 p36.11 UniSTS Cytogenetic Map 18 q12 UniSTS Cytogenetic Map 19 q13.41 UniSTS Cytogenetic Map 17 q21 UniSTS Cytogenetic Map 3 q27.3 UniSTS Cytogenetic Map 2 q37.3 UniSTS Cytogenetic Map 19 p13.3 UniSTS Cytogenetic Map 2 p15 UniSTS Cytogenetic Map 20 q13.32 UniSTS Cytogenetic Map 10 q26 UniSTS Cytogenetic Map 19 q13.3 UniSTS Cytogenetic Map 7 q21.13 UniSTS Cytogenetic Map 1 p33 UniSTS Cytogenetic Map 1 p35.1 UniSTS Cytogenetic Map 9 q22.3 UniSTS Cytogenetic Map 17 q11.2 UniSTS Cytogenetic Map 12 q13.2 UniSTS Cytogenetic Map 22 q13.31-q13.33 UniSTS Cytogenetic Map 1 q24.1 UniSTS Cytogenetic Map 7 q32.2 UniSTS Cytogenetic Map 19 q13.43 UniSTS Cytogenetic Map 1 q42.11 UniSTS Cytogenetic Map 19 p13.11 UniSTS Cytogenetic Map 12 q24.31 UniSTS Cytogenetic Map 19 p13.1 UniSTS Cytogenetic Map 11 q13.5 UniSTS Cytogenetic Map 11 q24 UniSTS Cytogenetic Map 2 q11.2-q12.1 UniSTS Cytogenetic Map 3 q21.2 UniSTS Cytogenetic Map 19 q13.1 UniSTS Cytogenetic Map 19 p13 UniSTS Cytogenetic Map 8 p11.21 UniSTS Cytogenetic Map 17 p13.2 UniSTS Cytogenetic Map 16 p13.3 UniSTS Cytogenetic Map 20 q12 UniSTS Cytogenetic Map 2 q13 UniSTS Cytogenetic Map 5 q31.1 UniSTS Cytogenetic Map 17 q22.2 UniSTS Cytogenetic Map 18 q21 UniSTS Cytogenetic Map 11 q14.2 UniSTS Cytogenetic Map 16 q22.1 UniSTS Cytogenetic Map 4 q34 UniSTS Cytogenetic Map 2 p22-p21 UniSTS Cytogenetic Map 10 q26.3 UniSTS Cytogenetic Map 7 q22.1 UniSTS Cytogenetic Map 11 q13.4 UniSTS Cytogenetic Map 2 q37.1 UniSTS Cytogenetic Map 17 q21.31 UniSTS Cytogenetic Map 1 p36.23 UniSTS Cytogenetic Map 7 p22.2 UniSTS Cytogenetic Map 12 q24.13 UniSTS Cytogenetic Map 8 p21.2 UniSTS Cytogenetic Map 22 q13.33 UniSTS Cytogenetic Map 14 q32.12 UniSTS Cytogenetic Map 2 q31.1 UniSTS Cytogenetic Map 1 p36.31 UniSTS Cytogenetic Map 1 p32.3 UniSTS Cytogenetic Map X q26.3 UniSTS Cytogenetic Map 8 p23.1 UniSTS Cytogenetic Map 6 q13 UniSTS Cytogenetic Map 3 p21.31 UniSTS Cytogenetic Map 9 p13.2 UniSTS Cytogenetic Map 17 q25 UniSTS Cytogenetic Map 9 q22.2 UniSTS Cytogenetic Map 14 q32.33 UniSTS Cytogenetic Map 1 q21.3 UniSTS Cytogenetic Map 13 q12.11 UniSTS Cytogenetic Map 16 p13.13 UniSTS Cytogenetic Map 11 p15.4 UniSTS Cytogenetic Map 7 q22 UniSTS Cytogenetic Map 3 q21 UniSTS Cytogenetic Map 11 q12.3 UniSTS Cytogenetic Map 22 q13 UniSTS Cytogenetic Map 4 p16.3 UniSTS Cytogenetic Map 11 p15.3-p15.1 UniSTS Cytogenetic Map 11 q13 UniSTS Cytogenetic Map 22 q11.21 UniSTS Cytogenetic Map 10 q22.2 UniSTS Cytogenetic Map 17 p13.3 UniSTS Cytogenetic Map 7 p22.3 UniSTS Cytogenetic Map 3 p21 UniSTS Cytogenetic Map X p22.3 UniSTS Cytogenetic Map 1 q42.3 UniSTS Cytogenetic Map 18 q11.2 UniSTS Cytogenetic Map 6 p24.3 UniSTS Cytogenetic Map 7 q34 UniSTS Cytogenetic Map 16 p11.2 UniSTS Cytogenetic Map 1 q25 UniSTS Cytogenetic Map 15 q11.2 UniSTS Cytogenetic Map 19 p13.12 UniSTS Cytogenetic Map 3 q26 UniSTS Cytogenetic Map 12 p12.1-p11.2 UniSTS Cytogenetic Map 11 q23.1 UniSTS Cytogenetic Map 13 q14.11 UniSTS Cytogenetic Map 22 q13.1 UniSTS Cytogenetic Map 7 p15.2 UniSTS Cytogenetic Map 1 q21 UniSTS Cytogenetic Map 10 q11.22 UniSTS Cytogenetic Map 5 p12 UniSTS Cytogenetic Map 6 q21 UniSTS Cytogenetic Map 9 q21.13 UniSTS Cytogenetic Map 5 q13.2 UniSTS Cytogenetic Map 19 q13.2 UniSTS Cytogenetic Map X q23 UniSTS Cytogenetic Map 2 p21 UniSTS Cytogenetic Map 22 q11.1 UniSTS Cytogenetic Map 16 q13 UniSTS Cytogenetic Map 16 p UniSTS Cytogenetic Map 11 q13.2 UniSTS Cytogenetic Map X p11.3 UniSTS Cytogenetic Map 1 q25.1 UniSTS Cytogenetic Map 10 q23-q24 UniSTS Cytogenetic Map 20 p13 UniSTS Cytogenetic Map 7 q31 UniSTS Cytogenetic Map 6 q23.3 UniSTS Cytogenetic Map X p22.2 UniSTS Cytogenetic Map 9 q32 UniSTS Cytogenetic Map 1 q32.1 UniSTS Cytogenetic Map 17 q25.3 UniSTS Cytogenetic Map 20 q11.22 UniSTS Cytogenetic Map 4 q35.1 UniSTS Cytogenetic Map 3 q21.3 UniSTS Cytogenetic Map 5 q12.3 UniSTS Cytogenetic Map 6 q25.1 UniSTS Cytogenetic Map 14 q24.1 UniSTS Cytogenetic Map 2 q33.2 UniSTS Cytogenetic Map 20 q13.13 UniSTS Cytogenetic Map 14 q23.2 UniSTS Cytogenetic Map 15 q24.1 UniSTS Cytogenetic Map 3 q23 UniSTS Cytogenetic Map 8 q23.1 UniSTS Cytogenetic Map 2 q14.3 UniSTS Cytogenetic Map 20 q13.33 UniSTS Cytogenetic Map 21 q22.11 UniSTS Cytogenetic Map 5 p15.1 UniSTS Cytogenetic Map 15 q13.1 UniSTS Cytogenetic Map 15 q26.1 UniSTS Cytogenetic Map 7 q32.1 UniSTS Cytogenetic Map 8 p21.3 UniSTS Cytogenetic Map 1 p31.1 UniSTS Cytogenetic Map 17 qter UniSTS Cytogenetic Map 11 q13.1 UniSTS Cytogenetic Map 12 q22 UniSTS Cytogenetic Map 16 q22.2 UniSTS Cytogenetic Map 14 q32 UniSTS Cytogenetic Map X p22.33 UniSTS Cytogenetic Map Y p11.32 UniSTS Cytogenetic Map 14 q24.2 UniSTS Cytogenetic Map 3 p25.3 UniSTS Cytogenetic Map 13 q34 UniSTS Cytogenetic Map 10 p11.23 UniSTS Cytogenetic Map 15 q15.2 UniSTS Cytogenetic Map 8 p21.1 UniSTS Cytogenetic Map 22 q12.2 UniSTS Cytogenetic Map 15 q22.2 UniSTS Cytogenetic Map 15 q21 UniSTS Cytogenetic Map 6 p21.31 UniSTS Cytogenetic Map 10 q23.1 UniSTS Cytogenetic Map 1 p36.2 UniSTS Cytogenetic Map 2 p16.1 UniSTS Cytogenetic Map 22 q11.2 UniSTS Cytogenetic Map 17 q23.3 UniSTS Cytogenetic Map 12 q13.13 UniSTS Cytogenetic Map 20 q12-q13.12 UniSTS Cytogenetic Map 3 q26.33 UniSTS Cytogenetic Map 5 q31.2-q34 UniSTS Cytogenetic Map 5 q31.2 UniSTS Cytogenetic Map 8 q24.3 UniSTS Cytogenetic Map 5 q35.3 UniSTS Cytogenetic Map X q13-q21 UniSTS Cytogenetic Map 7 q11.23 UniSTS Cytogenetic Map 1 pter-q31.3 UniSTS Cytogenetic Map 15 q21.1 UniSTS Cytogenetic Map 3 q13.33 UniSTS Cytogenetic Map X q13.1 UniSTS Cytogenetic Map 3 p23-p21 UniSTS Cytogenetic Map 11 q22-q23 UniSTS Cytogenetic Map 1 p34.1 UniSTS Cytogenetic Map 2 q21.1 UniSTS Cytogenetic Map 6 p21.3 UniSTS Cytogenetic Map 7 p11.2 UniSTS Cytogenetic Map 7 p22.1 UniSTS Cytogenetic Map 17 q21.33 UniSTS Cytogenetic Map 14 q32.31 UniSTS Cytogenetic Map 10 q11.21 UniSTS Cytogenetic Map 16 q22 UniSTS Cytogenetic Map 2 q24 UniSTS Cytogenetic Map 1 q23.3 UniSTS Cytogenetic Map 3 q13.13 UniSTS Cytogenetic Map 19 p12 UniSTS Cytogenetic Map 16 p13.1 UniSTS Cytogenetic Map 19 q13.11 UniSTS Cytogenetic Map X p22.12 UniSTS Cytogenetic Map 9 q21.33 UniSTS Cytogenetic Map 5 q32 UniSTS Cytogenetic Map 16 q11.2 UniSTS Cytogenetic Map 10 p12.31 UniSTS Cytogenetic Map 3 q25.33 UniSTS Cytogenetic Map 8 q21.2 UniSTS Cytogenetic Map 10 q26.13 UniSTS Cytogenetic Map 10 q25.3 UniSTS Cytogenetic Map 15 q14-q15 UniSTS Cytogenetic Map 8 p11.2 UniSTS Cytogenetic Map 1 p34.3 UniSTS Cytogenetic Map 4 p15.2 UniSTS Cytogenetic Map 17 q12 UniSTS Cytogenetic Map 7 p15.3 UniSTS Cytogenetic Map 7 p21.1 UniSTS Cytogenetic Map 1 p36.32 UniSTS Cytogenetic Map 1 p36.1-p34 UniSTS Cytogenetic Map 4 p13 UniSTS Cytogenetic Map 7 q31.1-q31.2 UniSTS Cytogenetic Map 8 q22.2 UniSTS Cytogenetic Map 15 q21.1-q21.2 UniSTS Cytogenetic Map 16 q21 UniSTS Cytogenetic Map X q12 UniSTS Cytogenetic Map 7 q36.1 UniSTS Cytogenetic Map 7 p14.1 UniSTS Cytogenetic Map 6 p23 UniSTS Cytogenetic Map 3 p11.1 UniSTS Cytogenetic Map 15 q21.3 UniSTS Cytogenetic Map 13 q12 UniSTS Cytogenetic Map 12 q23.2 UniSTS Cytogenetic Map 22 q13.2 UniSTS Cytogenetic Map 16 q22.3 UniSTS Cytogenetic Map X q21 UniSTS Cytogenetic Map 15 q15 UniSTS Cytogenetic Map 4 q25 UniSTS Cytogenetic Map 3 q22.1 UniSTS Cytogenetic Map 1 q25.2 UniSTS Cytogenetic Map 11 q14.3 UniSTS Cytogenetic Map 10 q21.3 UniSTS Cytogenetic Map 14 q11.2 UniSTS Cytogenetic Map 15 q24.2 UniSTS Cytogenetic Map 2 p14 UniSTS Cytogenetic Map 7 q11.1 UniSTS Cytogenetic Map 6 p21 UniSTS Cytogenetic Map 2 p25.1-p24.1 UniSTS Cytogenetic Map 16 p12.2 UniSTS Cytogenetic Map 4 q13.3 UniSTS Cytogenetic Map 12 p11.21 UniSTS Cytogenetic Map 18 q21.3 UniSTS Cytogenetic Map 17 p13 UniSTS Cytogenetic Map 8 q12 UniSTS Cytogenetic Map 2 q35 UniSTS Cytogenetic Map 21 q22.13 UniSTS Cytogenetic Map 6 p21.1 UniSTS Cytogenetic Map 17 q24.3 UniSTS Cytogenetic Map 1 p21 UniSTS Cytogenetic Map X q24 UniSTS Cytogenetic Map 2 q34 UniSTS Cytogenetic Map 8 p11.23 UniSTS Cytogenetic Map 1 p36.13 UniSTS Cytogenetic Map 9 q34.3 UniSTS Cytogenetic Map 11 q23.3 UniSTS Cytogenetic Map 9 q33.3 UniSTS Cytogenetic Map 16 p12 UniSTS Cytogenetic Map 2 p23.3 UniSTS Cytogenetic Map 20 q11.23 UniSTS Cytogenetic Map 12 q15 UniSTS Cytogenetic Map 2 q12.2 UniSTS Cytogenetic Map 8 p12 UniSTS Cytogenetic Map 7 q22.3 UniSTS Cytogenetic Map 19 q13.42 UniSTS Cytogenetic Map 4 q35 UniSTS Cytogenetic Map 19 q13.1-q13.2 UniSTS Cytogenetic Map 16 p13.12 UniSTS Cytogenetic Map 9 q34.1 UniSTS Cytogenetic Map 7 q36.2 UniSTS Cytogenetic Map 3 p23 UniSTS Cytogenetic Map 6 p25 UniSTS Cytogenetic Map 9 q22.1-q22.2 UniSTS Cytogenetic Map 3 q26.1-q26.2 UniSTS Cytogenetic Map 5 q31-q34 UniSTS Cytogenetic Map 9 q34 UniSTS Cytogenetic Map 12 p13 UniSTS Cytogenetic Map 4 q26 UniSTS Cytogenetic Map 4 p15.3 UniSTS Cytogenetic Map 2 q33.1 UniSTS Cytogenetic Map 15 q15.1 UniSTS Cytogenetic Map 1 p32-p31 UniSTS Cytogenetic Map 7 q36.3 UniSTS Cytogenetic Map 4 q22.1 UniSTS Cytogenetic Map 3 q13.2 UniSTS Cytogenetic Map 2 q33.3 UniSTS Cytogenetic Map 8 p22 UniSTS Cytogenetic Map 22 q11.23 UniSTS Cytogenetic Map 19 q13.32 UniSTS Cytogenetic Map 18 q21.32 UniSTS Cytogenetic Map 15 q26.3 UniSTS Cytogenetic Map 12 q14.2 UniSTS Cytogenetic Map 2 q31.1-q31.2 UniSTS Cytogenetic Map 12 q13.11 UniSTS Cytogenetic Map 9 p13.3 UniSTS Cytogenetic Map 9 q34.11 UniSTS Cytogenetic Map 6 p12.3 UniSTS Cytogenetic Map 6 q22.32 UniSTS Cytogenetic Map 5 q15 UniSTS Cytogenetic Map 3 p14.2 UniSTS Cytogenetic Map 3 p25.1 UniSTS Cytogenetic Map 3 q27.1 UniSTS Cytogenetic Map 2 q36.1 UniSTS Cytogenetic Map 2 q37 UniSTS Cytogenetic Map 19 q13.31 UniSTS Cytogenetic Map 4 q23 UniSTS Cytogenetic Map 16 q24.3 UniSTS Cytogenetic Map 15 q22.31 UniSTS Cytogenetic Map 10 q22.1 UniSTS Cytogenetic Map 18 q11.1 UniSTS Cytogenetic Map 16 q23.2 UniSTS Cytogenetic Map 12 q13 UniSTS Cytogenetic Map 18 q21.1 UniSTS Cytogenetic Map 12 q12-q13 UniSTS Cytogenetic Map 9 p22.3 UniSTS Cytogenetic Map 6 p21.2 UniSTS Cytogenetic Map 6 p22.1 UniSTS Cytogenetic Map 11 p15.1 UniSTS Cytogenetic Map 19 qter UniSTS Cytogenetic Map 20 q13.3-qter UniSTS Cytogenetic Map 12 q14.1 UniSTS Cytogenetic Map 7 p11 UniSTS Cytogenetic Map 7 p15 UniSTS Cytogenetic Map 1 p13.3 UniSTS Cytogenetic Map 16 p12.3 UniSTS Cytogenetic Map 3 q29 UniSTS Cytogenetic Map 3 p21.3 UniSTS Cytogenetic Map 13 q14 UniSTS Cytogenetic Map 17 p UniSTS Cytogenetic Map 11 p14.1 UniSTS Cytogenetic Map 2 p13.2 UniSTS Cytogenetic Map 15 q25.2 UniSTS Cytogenetic Map 10 q11.23 UniSTS Cytogenetic Map 20 q13.12 UniSTS Cytogenetic Map 13 q22.1 UniSTS Cytogenetic Map 17 p13.1 UniSTS Cytogenetic Map 14 q23.3 UniSTS Cytogenetic Map 3 q26.2 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2411
2788
2235
4961
1722
2324
5
621
1832
462
2268
7158
6354
45
3719
841
1731
1592
174
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000332246 ⟹ ENSP00000330805
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,404,161 - 19,682,583 (-) Ensembl
Ensembl Acc Id:
ENST00000397998 ⟹ ENSP00000381084
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,404,161 - 19,682,761 (-) Ensembl
Ensembl Acc Id:
ENST00000454498 ⟹ ENSP00000411816
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,404,161 - 19,602,495 (-) Ensembl
Ensembl Acc Id:
ENST00000517494 ⟹ ENSP00000429130
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,505,545 - 19,758,029 (-) Ensembl
Ensembl Acc Id:
ENST00000517651
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,505,880 - 19,642,022 (-) Ensembl
Ensembl Acc Id:
ENST00000518542
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,420,383 - 19,495,191 (-) Ensembl
Ensembl Acc Id:
ENST00000519222 ⟹ ENSP00000428216
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,439,877 - 19,602,759 (-) Ensembl
Ensembl Acc Id:
ENST00000520003 ⟹ ENSP00000428774
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,505,674 - 19,602,495 (-) Ensembl
Ensembl Acc Id:
ENST00000522573
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,506,116 - 19,757,217 (-) Ensembl
Ensembl Acc Id:
ENST00000522732
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,506,037 - 19,532,020 (-) Ensembl
Ensembl Acc Id:
ENST00000522854 ⟹ ENSP00000429809
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,405,780 - 19,601,865 (-) Ensembl
Ensembl Acc Id:
ENST00000523227
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,505,906 - 19,683,240 (-) Ensembl
Ensembl Acc Id:
ENST00000523262 ⟹ ENSP00000428089
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,505,523 - 19,757,938 (-) Ensembl
Ensembl Acc Id:
ENST00000523919
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,585,286 - 19,602,224 (-) Ensembl
Ensembl Acc Id:
ENST00000524112
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,587,874 - 19,602,224 (-) Ensembl
Ensembl Acc Id:
ENST00000524213 ⟹ ENSP00000427740
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,505,792 - 19,757,305 (-) Ensembl
Ensembl Acc Id:
ENST00000692225 ⟹ ENSP00000509853
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,404,161 - 19,757,277 (-) Ensembl
Ensembl Acc Id:
ENST00000695892 ⟹ ENSP00000512242
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,404,161 - 19,707,142 (-) Ensembl
Ensembl Acc Id:
ENST00000695893 ⟹ ENSP00000512243
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,404,161 - 19,732,689 (-) Ensembl
Ensembl Acc Id:
ENST00000695894 ⟹ ENSP00000512244
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,404,161 - 19,732,689 (-) Ensembl
Ensembl Acc Id:
ENST00000695895 ⟹ ENSP00000512245
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,404,161 - 19,757,284 (-) Ensembl
Ensembl Acc Id:
ENST00000695896 ⟹ ENSP00000512246
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,404,161 - 19,757,908 (-) Ensembl
Ensembl Acc Id:
ENST00000695897 ⟹ ENSP00000512247
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,404,161 - 19,757,920 (-) Ensembl
Ensembl Acc Id:
ENST00000695898 ⟹ ENSP00000512248
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,404,161 - 19,757,938 (-) Ensembl
Ensembl Acc Id:
ENST00000695899 ⟹ ENSP00000512249
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,404,166 - 19,602,988 (-) Ensembl
Ensembl Acc Id:
ENST00000695900 ⟹ ENSP00000512250
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 8 19,404,189 - 19,757,938 (-) Ensembl
RefSeq Acc Id:
NM_001130518 ⟹ NP_001123990
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,602,229 (-) NCBI GRCh37 8 19,261,672 - 19,540,261 (-) RGD Celera 8 18,225,010 - 18,503,692 (-) RGD HuRef 8 17,801,989 - 18,080,455 (-) ENTREZGENE CHM1_1 8 19,463,117 - 19,661,567 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 19,867,239 (-) NCBI
Sequence:
AGAGCATTGGAAGCAGAGCTGCGAGTTAGGAAGCGGCTCGCTGGCAGCTGGGCACGTTTCTTTCCTGCGAGATCGGCTTTTTTGATTTGCTCTTTTTCACATGAAAATGTTCAGCTTCATTTTTAGAC
hide sequence
RefSeq Acc Id:
NM_001354475 ⟹ NP_001341404
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,908 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 20,022,919 (-) NCBI
Sequence:
AGACATCGCTTACCCACAGTGGTGCGGTGTGAGAGTTACAGGGGTTCCTGACCTTCGCTTCTTAGGTATGTCTTTATCAGCAGCATAAAAACGGACTAATACAAGTACACAAGAATACAAAGAAAAGA
hide sequence
RefSeq Acc Id:
NM_001354476 ⟹ NP_001341405
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,908 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 20,022,919 (-) NCBI
Sequence:
AGACATCGCTTACCCACAGTGGTGCGGTGTGAGAGTTACAGGGGTTCCTGACCTTCGCTCTGCCTTCCTATTTCAAGGAAAGACGCCAAGGTAATTTTGACCCAGAGGAGCAATGATGTAGCCACCTC
hide sequence
RefSeq Acc Id:
NM_001354477 ⟹ NP_001341406
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,908 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 20,022,919 (-) NCBI
Sequence:
AGACATCGCTTACCCACAGTGGTGCGGTGTGAGAGTTACAGGGGTTCCTGACCTTCGCTCTGCCTTCCTATTTCAAGGAAAGACGCCAAGGTAATTTTGACCCAGAGGAGCAATGATGTAGCCACCTC
hide sequence
RefSeq Acc Id:
NM_001354480 ⟹ NP_001341409
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,908 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 20,022,919 (-) NCBI
Sequence:
AGACATCGCTTACCCACAGTGGTGCGGTGTGAGAGTTACAGGGGTTCCTGACCTTCGCTCTGCCTTCCTATTTCAAGGAAAGACGCCAAGGTAATTTTGACCCAGAGGAGCAATGATGTAGCCACCTC
hide sequence
RefSeq Acc Id:
NM_001354481 ⟹ NP_001341410
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,908 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 20,022,919 (-) NCBI
Sequence:
AGACATCGCTTACCCACAGTGGTGCGGTGTGAGAGTTACAGGGGTTCCTGACCTTCGCTCTGCC
hide sequence
RefSeq Acc Id:
NM_001354483 ⟹ NP_001341412
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,277 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 20,022,288 (-) NCBI
Sequence:
GGAGCCGAGTCCGCGGCGGCCGCGCAGGAGGGAAAGTTCAGCGACGGCGGCAGCGGCCGGAGCC
hide sequence
RefSeq Acc Id:
NM_001354484 ⟹ NP_001341413
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,277 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 20,022,288 (-) NCBI
Sequence:
GGAGCCGAGTCCGCGGCGGCCGCGCAGGAGGGAAAGTTCAGCGACGGCGGCAGCGGCCGGAGCC
hide sequence
RefSeq Acc Id:
NM_001354485 ⟹ NP_001341414
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,277 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 20,022,288 (-) NCBI
Sequence:
GGAGCCGAGTCCGCGGCGGCCGCGCAGGAGGGAAAGTTCAGCGACGGCGGCAGCGGCCGGAGCCGGGCCGGGCAGCTAGCAGGGCGCTTCGGCTGCCTTCCTATTTCAAGGAAAGACGCCAAGGTAAT
hide sequence
RefSeq Acc Id:
NM_001354487 ⟹ NP_001341416
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,277 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 20,022,288 (-) NCBI
Sequence:
GGAGCCGAGTCCGCGGCGGCCGCGCAGGAGGGAAAGTTCAGCGACGGCGGCAGCGGCCGGAGCC
hide sequence
RefSeq Acc Id:
NM_001354488 ⟹ NP_001341417
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,277 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 20,022,288 (-) NCBI
Sequence:
GGAGCCGAGTCCGCGGCGGCCGCGCAGGAGGGAAAGTTCAGCGACGGCGGCAGCGGCCGGAGCCGGGCCGGGCAGCTAGCAGGGCGCTTCGGGTGCTGTGCTGGTGATATGGGGTGAAAGTCCCATGA
hide sequence
RefSeq Acc Id:
NM_001354489 ⟹ NP_001341418
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,277 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 20,022,288 (-) NCBI
Sequence:
GGAGCCGAGTCCGCGGCGGCCGCGCAGGAGGGAAAGTTCAGCGACGGCGGCAGCGGCCGGAGCCGGGCCGGGCAGCTAGCAGGGCGCTTCGGCTGCCTTCCTATTTCAAGGAAAGACGCCAAGGTAAT
hide sequence
RefSeq Acc Id:
NM_001354490 ⟹ NP_001341419
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,572 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 20,022,583 (-) NCBI
Sequence:
AGTCACGCGTAAACCGCCCCTGGTGTCCGAGCGCGGCCCCTTCCGAGAGTGACAGGCTTCGGCC
hide sequence
RefSeq Acc Id:
NM_001354491 ⟹ NP_001341420
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,602,229 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 19,867,239 (-) NCBI
Sequence:
AGAGCATTGGAAGCAGAGCTGCGAGTTAGGAAGCGGCTCGCTGGCAGCTGGGCACGTTTCTTTCCTGCGAGATCGGCTTTTTTGATTTGCTCTTTTTCACATGAAAATGTTCAGCTTCATTTTTAGAC
hide sequence
RefSeq Acc Id:
NM_001354492 ⟹ NP_001341421
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,602,229 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 19,867,239 (-) NCBI
Sequence:
AGAGCATTGGAAGCAGAGCTGCGAGTTAGGAAGCGGCTCGCTGGCAGCTGGGCACGTTTCTTTC
hide sequence
RefSeq Acc Id:
NM_001354494 ⟹ NP_001341423
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,602,229 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 19,867,239 (-) NCBI
Sequence:
AGAGCATTGGAAGCAGAGCTGCGAGTTAGGAAGCGGCTCGCTGGCAGCTGGGCACGTTTCTTTCCTGCGAGATCGGCTTTTTTGATTTGCTCTTTTTCACATGAAAATGTTCAGCTTCATTTTTAGAC
hide sequence
RefSeq Acc Id:
NM_001354495 ⟹ NP_001341424
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,602,229 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 19,867,239 (-) NCBI
Sequence:
AGAGCATTGGAAGCAGAGCTGCGAGTTAGGAAGCGGCTCGCTGGCAGCTGGGCACGTTTCTTTC
hide sequence
RefSeq Acc Id:
NM_001354496 ⟹ NP_001341425
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,602,229 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 19,867,239 (-) NCBI
Sequence:
AGAGCATTGGAAGCAGAGCTGCGAGTTAGGAAGCGGCTCGCTGGCAGCTGGGCACGTTTCTTTCCTGCGAGATCGGCTTTTTTGATTTGCTCTTTTTCACATGAAAATGTTCAGCTTCATTTTTAGAC
hide sequence
RefSeq Acc Id:
NM_001354497 ⟹ NP_001341426
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,602,229 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 19,867,239 (-) NCBI
Sequence:
AGAGCATTGGAAGCAGAGCTGCGAGTTAGGAAGCGGCTCGCTGGCAGCTGGGCACGTTTCTTTC
hide sequence
RefSeq Acc Id:
NM_001354498 ⟹ NP_001341427
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,602,229 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 19,867,239 (-) NCBI
Sequence:
AGAGCATTGGAAGCAGAGCTGCGAGTTAGGAAGCGGCTCGCTGGCAGCTGGGCACGTTTCTTTCCTGCGAGATCGGCTTTTTTGATTTGCTCTTTTTCACATGAAAATGTTCAGCTTCATTTTTAGAC
hide sequence
RefSeq Acc Id:
NM_001354499 ⟹ NP_001341428
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,602,229 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 19,867,239 (-) NCBI
Sequence:
AGAGCATTGGAAGCAGAGCTGCGAGTTAGGAAGCGGCTCGCTGGCAGCTGGGCACGTTTCTTTC
hide sequence
RefSeq Acc Id:
NM_018371 ⟹ NP_060841
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,682,603 (-) NCBI GRCh37 8 19,261,672 - 19,540,261 (-) RGD Build 36 8 19,305,952 - 19,584,374 (-) NCBI Archive Celera 8 18,225,010 - 18,503,692 (-) RGD HuRef 8 17,801,989 - 18,080,455 (-) ENTREZGENE CHM1_1 8 19,463,117 - 19,741,637 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 19,947,597 (-) NCBI
Sequence:
AGTGTACATCAGTGAGTGCTCTCCTTAGGTGGAAACCCTGGGAGTAGAGTACTGACAGCAAAGACCGGGAAAGACCATACGTCCCCGGGCAGGGGTGACAACAGGTGTCATCTTTTTGATCTCGTGTG
hide sequence
RefSeq Acc Id:
NR_024040
RefSeq Status:
REVIEWED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,682,761 (-) NCBI GRCh37 8 19,261,672 - 19,540,261 (-) RGD Celera 8 18,225,010 - 18,503,692 (-) RGD HuRef 8 17,801,989 - 18,080,455 (-) ENTREZGENE CHM1_1 8 19,463,117 - 19,741,804 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 19,947,755 (-) NCBI
Sequence:
GGGCTTGTTCTGGGATCCGCAGCCTTGCTCAGGCTGTGCATTGGTGTGGCCCCGAATTGCACGG
hide sequence
RefSeq Acc Id:
NR_148897
RefSeq Status:
REVIEWED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,908 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 20,022,919 (-) NCBI
Sequence:
AGACATCGCTTACCCACAGTGGTGCGGTGTGAGAGTTACAGGGGTTCCTGACCTTCGCTCTGCC
hide sequence
RefSeq Acc Id:
NR_148898
RefSeq Status:
REVIEWED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,908 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 20,022,919 (-) NCBI
Sequence:
AGACATCGCTTACCCACAGTGGTGCGGTGTGAGAGTTACAGGGGTTCCTGACCTTCGCTCTGCCTTCCTATTTCAAGGAAAGACGCCAAGGTAATTTTGACCCAGAGGAGCAATGATGTAGCCACCTC
hide sequence
RefSeq Acc Id:
NR_148899
RefSeq Status:
REVIEWED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,277 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 20,022,288 (-) NCBI
Sequence:
GGAGCCGAGTCCGCGGCGGCCGCGCAGGAGGGAAAGTTCAGCGACGGCGGCAGCGGCCGGAGCCGGGCCGGGCAGCTAGCAGGGCGCTTCGGCTGCCTTCCTATTTCAAGGAAAGACGCCAAGGTAAT
hide sequence
RefSeq Acc Id:
NR_148900
RefSeq Status:
REVIEWED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,277 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 20,022,288 (-) NCBI
Sequence:
GGAGCCGAGTCCGCGGCGGCCGCGCAGGAGGGAAAGTTCAGCGACGGCGGCAGCGGCCGGAGCC
hide sequence
RefSeq Acc Id:
NR_148901
RefSeq Status:
REVIEWED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,602,229 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 19,867,239 (-) NCBI
Sequence:
AGAGCATTGGAAGCAGAGCTGCGAGTTAGGAAGCGGCTCGCTGGCAGCTGGGCACGTTTCTTTCCTGCGAGATCGGCTTTTTTGATTTGCTCTTTTTCACATGAAAATGTTCAGCTTCATTTTTAGAC
hide sequence
RefSeq Acc Id:
NR_148902
RefSeq Status:
REVIEWED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,602,229 (-) NCBI T2T-CHM13v2.0 8 19,669,045 - 19,867,239 (-) NCBI
Sequence:
AGAGCATTGGAAGCAGAGCTGCGAGTTAGGAAGCGGCTCGCTGGCAGCTGGGCACGTTTCTTTC
hide sequence
RefSeq Acc Id:
XM_006716360 ⟹ XP_006716423
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,602,229 (-) NCBI
Sequence:
GTTCTCCCTGGGGAGCGGGAGGCTCCAGGCGCGGCTGGGGCGCTGTGGGCAGATGCGCTCGGTC
hide sequence
RefSeq Acc Id:
XM_006716363 ⟹ XP_006716426
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,683,240 (-) NCBI
Sequence:
AGAGTAAAGGTGATGCCGCACAGACCTTGTAGAATTTTACACATCGTGGAAAAGCCTGACCAAG
hide sequence
RefSeq Acc Id:
XM_006716364 ⟹ XP_006716427
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,506,536 (-) NCBI
Sequence:
CCATCTGGAGAGAATTATTGTTCAGATTTTGCCATTTTCCTTCCAATCTTTTTTCTCTGTCCTT
hide sequence
RefSeq Acc Id:
XM_011544578 ⟹ XP_011542880
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,602,229 (-) NCBI
Sequence:
GTTCTCCCTGGGGAGCGGGAGGCTCCAGGCGCGGCTGGGGCGCTGTGGGCAGATGCGCTCGGTCCTCACCAGCGGCGTTGTGCGGCGAACCCTGCGGTGCTTCGGGAAGGCGGTCGTTCCTCCCTGCT
hide sequence
RefSeq Acc Id:
XM_011544583 ⟹ XP_011542885
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,532,270 (-) NCBI
Sequence:
AGGAAAGAAAAACTCAACCAGCAGGCAGGAAGTAGAGAGATTCAGAAGGGCCAGGCTCCTCTTTTCCCTTCCAGAAGCCCAAGCATCCAGGGAAAAGGGAAGGGGCAGGCAGGAGAAACCCAGAGGCC
hide sequence
RefSeq Acc Id:
XM_011544585 ⟹ XP_011542887
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,497,303 (-) NCBI
Sequence:
GTCTAGGACGCATTCTTCCTCCCTCTCCACCTGTTTCCATTGAGATTGCTTATCAGAAGTCAAC
hide sequence
RefSeq Acc Id:
XM_017013625 ⟹ XP_016869114
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,515,199 (-) NCBI
Sequence:
GGCAGGAAAGGACATGGCCTGACAGCAGGTGCTAGGGACCTGAGATAGAGACAGTGGGGTCCAG
hide sequence
RefSeq Acc Id:
XM_024447190 ⟹ XP_024302958
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,606,952 (-) NCBI
Sequence:
CGATCTCCTGACCTTCGCTCTGCCTTCCTATTTCAAGGAAAGACGCCAAGGTAATTTTGACCCAGAGGAGCAATGATGTAGCCACCTCCTAACCTTCCCTTCTTGAACCCCCAGGTCCCCTCTTGCTG
hide sequence
RefSeq Acc Id:
XM_024447191 ⟹ XP_024302959
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,682,603 (-) NCBI
Sequence:
GTGAGTGCTCTCCTTAGGTGGAAACCCTGGGAGTAGAGTACTGACAGCAAAGACCGGGAAAGAC
hide sequence
RefSeq Acc Id:
XM_024447192 ⟹ XP_024302960
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,682,761 (-) NCBI
Sequence:
GTTGGACCTGTGAGGGCTGCTGACTGCAGTGTCCTGGCCCTGATTGCAGAACAGGATAGTGTTATCTGTGCTGGCCGGAAAGGCTGCTTAAAACCAGACCTCAAACTTGGGCAGACGGGCTTGTTCTG
hide sequence
RefSeq Acc Id:
XM_024447193 ⟹ XP_024302961
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,908 (-) NCBI
Sequence:
GCGCAGGGACGCACTGCAGAGAGGCCGTGGGTGACGCGGAGCTGCCTTCCTATTTCAAGGAAAGACGCCAAGGTAATTTTGACCCAGAGGAGCAATGATGTAGCCACCTCCTAACCTTCCCTTCTTGA
hide sequence
RefSeq Acc Id:
XM_047421960 ⟹ XP_047277916
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,908 (-) NCBI
RefSeq Acc Id:
XM_047421961 ⟹ XP_047277917
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,908 (-) NCBI
RefSeq Acc Id:
XM_047421962 ⟹ XP_047277918
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,755,455 (-) NCBI
RefSeq Acc Id:
XM_047421963 ⟹ XP_047277919
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,277 (-) NCBI
RefSeq Acc Id:
XM_047421964 ⟹ XP_047277920
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,908 (-) NCBI
RefSeq Acc Id:
XM_047421965 ⟹ XP_047277921
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,908 (-) NCBI
RefSeq Acc Id:
XM_047421966 ⟹ XP_047277922
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,625,322 (-) NCBI
RefSeq Acc Id:
XM_047421967 ⟹ XP_047277923
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,682,603 (-) NCBI
RefSeq Acc Id:
XM_047421968 ⟹ XP_047277924
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,755,455 (-) NCBI
RefSeq Acc Id:
XM_047421969 ⟹ XP_047277925
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,908 (-) NCBI
RefSeq Acc Id:
XM_047421970 ⟹ XP_047277926
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,751,633 (-) NCBI
RefSeq Acc Id:
XM_047421971 ⟹ XP_047277927
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,908 (-) NCBI
RefSeq Acc Id:
XM_047421972 ⟹ XP_047277928
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,277 (-) NCBI
RefSeq Acc Id:
XM_047421973 ⟹ XP_047277929
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,277 (-) NCBI
RefSeq Acc Id:
XM_047421974 ⟹ XP_047277930
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,751,633 (-) NCBI
RefSeq Acc Id:
XM_047421975 ⟹ XP_047277931
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,277 (-) NCBI
RefSeq Acc Id:
XM_047421976 ⟹ XP_047277932
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,908 (-) NCBI
RefSeq Acc Id:
XM_047421977 ⟹ XP_047277933
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,757,908 (-) NCBI
RefSeq Acc Id:
XM_047421978 ⟹ XP_047277934
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,682,603 (-) NCBI
RefSeq Acc Id:
XM_047421979 ⟹ XP_047277935
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,404,161 - 19,755,455 (-) NCBI
RefSeq Acc Id:
XM_054360802 ⟹ XP_054216777
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 19,947,597 (-) NCBI
RefSeq Acc Id:
XM_054360803 ⟹ XP_054216778
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 20,022,919 (-) NCBI
RefSeq Acc Id:
XM_054360804 ⟹ XP_054216779
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 20,022,919 (-) NCBI
RefSeq Acc Id:
XM_054360805 ⟹ XP_054216780
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 19,948,663 (-) NCBI
RefSeq Acc Id:
XM_054360806 ⟹ XP_054216781
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 19,867,239 (-) NCBI
RefSeq Acc Id:
XM_054360807 ⟹ XP_054216782
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 19,867,239 (-) NCBI
RefSeq Acc Id:
XM_054360808 ⟹ XP_054216783
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 19,947,755 (-) NCBI
RefSeq Acc Id:
XM_054360809 ⟹ XP_054216784
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 19,871,961 (-) NCBI
RefSeq Acc Id:
XM_054360810 ⟹ XP_054216785
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 20,022,288 (-) NCBI
RefSeq Acc Id:
XM_054360811 ⟹ XP_054216786
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 20,022,919 (-) NCBI
RefSeq Acc Id:
XM_054360812 ⟹ XP_054216787
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 19,779,967 (-) NCBI
RefSeq Acc Id:
XM_054360813 ⟹ XP_054216788
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 20,022,919 (-) NCBI
RefSeq Acc Id:
XM_054360814 ⟹ XP_054216789
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 19,890,324 (-) NCBI
RefSeq Acc Id:
XM_054360815 ⟹ XP_054216790
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 19,947,597 (-) NCBI
RefSeq Acc Id:
XM_054360816 ⟹ XP_054216791
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 19,771,522 (-) NCBI
RefSeq Acc Id:
XM_054360817 ⟹ XP_054216792
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 20,022,919 (-) NCBI
RefSeq Acc Id:
XM_054360818 ⟹ XP_054216793
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 20,022,288 (-) NCBI
RefSeq Acc Id:
XM_054360819 ⟹ XP_054216794
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 20,016,627 (-) NCBI
RefSeq Acc Id:
XM_054360820 ⟹ XP_054216795
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 20,022,919 (-) NCBI
RefSeq Acc Id:
XM_054360821 ⟹ XP_054216796
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 20,022,919 (-) NCBI
RefSeq Acc Id:
XM_054360822 ⟹ XP_054216797
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 20,022,288 (-) NCBI
RefSeq Acc Id:
XM_054360823 ⟹ XP_054216798
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 20,022,288 (-) NCBI
RefSeq Acc Id:
XM_054360824 ⟹ XP_054216799
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 20,016,627 (-) NCBI
RefSeq Acc Id:
XM_054360825 ⟹ XP_054216800
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 19,797,268 (-) NCBI
RefSeq Acc Id:
XM_054360826 ⟹ XP_054216801
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 20,022,288 (-) NCBI
RefSeq Acc Id:
XM_054360827 ⟹ XP_054216802
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 20,022,919 (-) NCBI
RefSeq Acc Id:
XM_054360828 ⟹ XP_054216803
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 20,022,919 (-) NCBI
RefSeq Acc Id:
XM_054360829 ⟹ XP_054216804
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 19,947,597 (-) NCBI
RefSeq Acc Id:
XM_054360830 ⟹ XP_054216805
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 20,021,540 (-) NCBI
RefSeq Acc Id:
XM_054360831 ⟹ XP_054216806
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 19,953,724 (-) NCBI
RefSeq Acc Id:
XM_054360832 ⟹ XP_054216807
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 20,022,919 (-) NCBI
RefSeq Acc Id:
XM_054360833 ⟹ XP_054216808
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,669,045 - 19,760,114 (-) NCBI
RefSeq Acc Id:
XR_007060745
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 8 19,408,608 - 19,602,229 (-) NCBI
RefSeq Acc Id:
XR_008487863
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 8 19,673,593 - 19,867,239 (-) NCBI
RefSeq Acc Id:
NP_060841 ⟸ NM_018371
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRNYVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQV
hide sequence
RefSeq Acc Id:
NP_001123990 ⟸ NM_001130518
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEW
hide sequence
RefSeq Acc Id:
XP_006716426 ⟸ XM_006716363
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRNYVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQV
hide sequence
RefSeq Acc Id:
XP_006716423 ⟸ XM_006716360
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEW
hide sequence
RefSeq Acc Id:
XP_006716427 ⟸ XM_006716364
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRNYVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQV
hide sequence
RefSeq Acc Id:
XP_011542880 ⟸ XM_011544578
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEW
hide sequence
RefSeq Acc Id:
XP_011542885 ⟸ XM_011544583
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRNYVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQV
hide sequence
RefSeq Acc Id:
XP_011542887 ⟸ XM_011544585
- Peptide Label:
isoform X2
- Sequence:
MKVKNEKLNMANTLINVIVPLAKRVDKFRQFMQNFREMCIEQDGRVHLTVVYFGKEEINEVKGI
hide sequence
RefSeq Acc Id:
XP_016869114 ⟸ XM_017013625
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRNYVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQV
hide sequence
RefSeq Acc Id:
NP_001341405 ⟸ NM_001354476
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEW
hide sequence
RefSeq Acc Id:
NP_001341410 ⟸ NM_001354481
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRNYVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQV
hide sequence
RefSeq Acc Id:
NP_001341406 ⟸ NM_001354477
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEW
hide sequence
RefSeq Acc Id:
NP_001341409 ⟸ NM_001354480
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRNYVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQV
hide sequence
RefSeq Acc Id:
NP_001341404 ⟸ NM_001354475
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEW
hide sequence
RefSeq Acc Id:
XP_024302961 ⟸ XM_024447193
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRNYVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQV
hide sequence
RefSeq Acc Id:
NP_001341412 ⟸ NM_001354483
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEW
hide sequence
RefSeq Acc Id:
NP_001341416 ⟸ NM_001354487
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRNYVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQV
hide sequence
RefSeq Acc Id:
NP_001341418 ⟸ NM_001354489
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEW
hide sequence
RefSeq Acc Id:
NP_001341414 ⟸ NM_001354485
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRNYVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQV
hide sequence
RefSeq Acc Id:
NP_001341413 ⟸ NM_001354484
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEW
hide sequence
RefSeq Acc Id:
NP_001341417 ⟸ NM_001354488
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRNYVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQV
hide sequence
RefSeq Acc Id:
NP_001341419 ⟸ NM_001354490
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEW
hide sequence
RefSeq Acc Id:
XP_024302960 ⟸ XM_024447192
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRNYVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQV
hide sequence
RefSeq Acc Id:
XP_024302959 ⟸ XM_024447191
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEW
hide sequence
RefSeq Acc Id:
XP_024302958 ⟸ XM_024447190
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRNYVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQV
hide sequence
RefSeq Acc Id:
NP_001341426 ⟸ NM_001354497
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEW
hide sequence
RefSeq Acc Id:
NP_001341421 ⟸ NM_001354492
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRNYVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQV
hide sequence
RefSeq Acc Id:
NP_001341424 ⟸ NM_001354495
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEW
hide sequence
RefSeq Acc Id:
NP_001341423 ⟸ NM_001354494
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRNYVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQV
hide sequence
RefSeq Acc Id:
NP_001341425 ⟸ NM_001354496
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEW
hide sequence
RefSeq Acc Id:
NP_001341428 ⟸ NM_001354499
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRNYVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQV
hide sequence
RefSeq Acc Id:
NP_001341420 ⟸ NM_001354491
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEW
hide sequence
RefSeq Acc Id:
NP_001341427 ⟸ NM_001354498
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
- Sequence:
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRNYVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQV
hide sequence
Ensembl Acc Id:
ENSP00000429130 ⟸ ENST00000517494
Ensembl Acc Id:
ENSP00000330805 ⟸ ENST00000332246
Ensembl Acc Id:
ENSP00000428216 ⟸ ENST00000519222
Ensembl Acc Id:
ENSP00000411816 ⟸ ENST00000454498
Ensembl Acc Id:
ENSP00000428774 ⟸ ENST00000520003
Ensembl Acc Id:
ENSP00000429809 ⟸ ENST00000522854
Ensembl Acc Id:
ENSP00000428089 ⟸ ENST00000523262
Ensembl Acc Id:
ENSP00000427740 ⟸ ENST00000524213
Ensembl Acc Id:
ENSP00000381084 ⟸ ENST00000397998
Ensembl Acc Id:
ENSP00000509853 ⟸ ENST00000692225
Ensembl Acc Id:
ENSP00000512248 ⟸ ENST00000695898
Ensembl Acc Id:
ENSP00000512243 ⟸ ENST00000695893
Ensembl Acc Id:
ENSP00000512244 ⟸ ENST00000695894
Ensembl Acc Id:
ENSP00000512245 ⟸ ENST00000695895
Ensembl Acc Id:
ENSP00000512246 ⟸ ENST00000695896
Ensembl Acc Id:
ENSP00000512250 ⟸ ENST00000695900
Ensembl Acc Id:
ENSP00000512242 ⟸ ENST00000695892
Ensembl Acc Id:
ENSP00000512249 ⟸ ENST00000695899
Ensembl Acc Id:
ENSP00000512247 ⟸ ENST00000695897
RefSeq Acc Id:
XP_047277916 ⟸ XM_047421960
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047277927 ⟸ XM_047421971
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047277920 ⟸ XM_047421964
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047277933 ⟸ XM_047421977
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047277917 ⟸ XM_047421961
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047277925 ⟸ XM_047421969
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047277932 ⟸ XM_047421976
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047277921 ⟸ XM_047421965
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047277928 ⟸ XM_047421972
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047277929 ⟸ XM_047421973
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047277931 ⟸ XM_047421975
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047277919 ⟸ XM_047421963
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047277918 ⟸ XM_047421962
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047277924 ⟸ XM_047421968
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047277935 ⟸ XM_047421979
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047277926 ⟸ XM_047421970
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047277930 ⟸ XM_047421974
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047277934 ⟸ XM_047421978
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047277923 ⟸ XM_047421967
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047277922 ⟸ XM_047421966
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216807 ⟸ XM_054360832
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216778 ⟸ XM_054360803
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216795 ⟸ XM_054360820
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216786 ⟸ XM_054360811
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216803 ⟸ XM_054360828
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216779 ⟸ XM_054360804
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216796 ⟸ XM_054360821
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216792 ⟸ XM_054360817
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216802 ⟸ XM_054360827
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216788 ⟸ XM_054360813
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216797 ⟸ XM_054360822
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216798 ⟸ XM_054360823
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216801 ⟸ XM_054360826
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216785 ⟸ XM_054360810
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216793 ⟸ XM_054360818
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216805 ⟸ XM_054360830
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216794 ⟸ XM_054360819
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216799 ⟸ XM_054360824
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216806 ⟸ XM_054360831
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216780 ⟸ XM_054360805
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216783 ⟸ XM_054360808
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216777 ⟸ XM_054360802
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216804 ⟸ XM_054360829
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216790 ⟸ XM_054360815
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216789 ⟸ XM_054360814
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216784 ⟸ XM_054360809
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216782 ⟸ XM_054360807
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216781 ⟸ XM_054360806
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216800 ⟸ XM_054360825
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216787 ⟸ XM_054360812
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216791 ⟸ XM_054360816
- Peptide Label:
isoform X1
- UniProtKB:
Q9NSQ7 (UniProtKB/Swiss-Prot), Q8TDX6 (UniProtKB/Swiss-Prot), Q8IUF9 (UniProtKB/Swiss-Prot), Q6P9G6 (UniProtKB/Swiss-Prot), B2RBE4 (UniProtKB/Swiss-Prot), Q9NUM9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054216808 ⟸ XM_054360833
- Peptide Label:
isoform X2
RGD ID: 6806653 Promoter ID: HG_KWN:60835 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell Transcripts: ENST00000311540 Position: Human Assembly Chr Position (strand) Source Build 36 8 19,360,056 - 19,360,556 (-) MPROMDB
RGD ID: 7212739 Promoter ID: EPDNEW_H12115 Type: initiation region Name: CSGALNACT1_2 Description: chondroitin sulfate N-acetylgalactosaminyltransferase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H12116 EPDNEW_H12117 EPDNEW_H12118 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 8 19,602,229 - 19,602,289 EPDNEW
RGD ID: 7212741 Promoter ID: EPDNEW_H12116 Type: initiation region Name: CSGALNACT1_1 Description: chondroitin sulfate N-acetylgalactosaminyltransferase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H12115 EPDNEW_H12117 EPDNEW_H12118 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 8 19,602,495 - 19,602,555 EPDNEW
RGD ID: 7212743 Promoter ID: EPDNEW_H12117 Type: initiation region Name: CSGALNACT1_3 Description: chondroitin sulfate N-acetylgalactosaminyltransferase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H12115 EPDNEW_H12116 EPDNEW_H12118 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 8 19,682,603 - 19,682,663 EPDNEW
RGD ID: 7212745 Promoter ID: EPDNEW_H12118 Type: initiation region Name: CSGALNACT1_4 Description: chondroitin sulfate N-acetylgalactosaminyltransferase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H12115 EPDNEW_H12116 EPDNEW_H12117 Experiment Methods: Single-end sequencing.; Paired-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 8 19,758,029 - 19,758,089 EPDNEW
