Advanced Search (OLGA)

Gene: Rad21 (RAD21 cohesin complex component) Rattus norvegicus

Analyze

Symbol:

Rad21

Name:

RAD21 cohesin complex component

RGD ID:

1594529

Description:

Enables DNA-binding transcription factor binding activity and lncRNA binding activity. Involved in negative regulation of apoptotic process; regulation of cytokine production; and response to hypoxia. Located in nucleus. Human ortholog(s) of this gene implicated in Cornelia de Lange syndrome 4; endometrial cancer; hepatocellular carcinoma; and lung non-small cell carcinoma. Orthologous to human RAD21 (RAD21 cohesin complex component); PARTICIPATES IN cell cycle pathway, mitotic; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

double-strand-break repair protein rad21 homolog; MGC116373; RAD21 homolog; RAD21 homolog (S. pombe); similar to HR21spA

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RAD21 (RAD21 cohesin complex component)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rad21 (RAD21 cohesin complex component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rad21 (RAD21 cohesin complex component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RAD21 (RAD21 cohesin complex component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RAD21 (RAD21 cohesin complex component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rad21 (RAD21 cohesin complex component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RAD21 (RAD21 cohesin complex component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RAD21 (RAD21 cohesin complex component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rad21 (RAD21 cohesin complex component)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RAD21 (RAD21 cohesin complex component)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rad21 (RAD21 cohesin complex component)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rad21a (RAD21 cohesin complex component a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rad21b (RAD21 cohesin complex component b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	MCD1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	coh-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	scc-1	Alliance	DIOPT (OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	vtd	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rad21	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	85,177,715 - 85,204,657 (-)	NCBI		GRCr8
mRatBN7.2	7	83,287,867 - 83,314,810 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	83,287,870 - 83,314,817 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	85,183,451 - 85,210,398 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	87,384,656 - 87,411,603 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	87,211,563 - 87,238,505 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	91,511,755 - 91,538,673 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	91,511,756 - 91,538,673 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	92,155,546 - 92,182,749 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	88,267,648 - 88,294,703 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	7	80,164,565 - 80,191,459 (-)	NCBI		Celera
Cytogenetic Map	7	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rad21	Rat	Cerebral Hemorrhage	severity	IMP		243065265		RGD
Rad21	Rat	colorectal carcinoma	exacerbates	ISO	RGD:1317642	150520034	mRNA, protein:increased expression:colorectum (human)	RGD
Rad21	Rat	endometrial cancer	onset	ISO	RGD:1317642	329322876	DNA:CNV: (human)	RGD
Rad21	Rat	hepatocellular carcinoma	treatment	ISO	RGD:1317642	150520026	human cells in a mouse model	RGD
Rad21	Rat	hepatocellular carcinoma	susceptibility	ISO	RGD:1317642	9068941	associated with hepatitis c, liver cirrhosis;mRNA:increased expression:liver (human)	RGD	PMID:30698808\|REF_RGD_ID:150520029
Rad21	Rat	hepatocellular carcinoma	exacerbates	ISO	RGD:1317642	150520035	mRNA:increased expression:liver (human)	RGD
Rad21	Rat	lung non-small cell carcinoma	exacerbates	ISO	RGD:1317642	9068941	mRNA:increased expression:lung (human)	RGD	PMID:32178590\|REF_RGD_ID:150520031
Rad21	Rat	lung non-small cell carcinoma	susceptibility	ISO	RGD:1317642	150520036	DNA:SNP:intron: (rs1374297) (human)	RGD
Rad21	Rat	malignant pleural mesothelioma		ISO	RGD:1317642	9068941		RGD	PMID:19380173\|REF_RGD_ID:150520037
Rad21	Rat	oral squamous cell carcinoma	exacerbates	ISO	RGD:1317642	150520028	mRNA:decreased expression:oral cavity (human)	RGD
Rad21	Rat	Spinal Cord Injuries	treatment	IEP		243065262		RGD

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rad21	Rat	Cornelia de Lange syndrome		ISO	RGD:1317642	8554872	ClinVar Annotator: match by term: De Lange syndrome	ClinVar
Rad21	Rat	Cornelia de Lange syndrome 1		ISO	RGD:1317642	8554872	ClinVar Annotator: match by term: Cornelia de Lange syndrome 1	ClinVar	PMID:25741868
Rad21	Rat	Cornelia de Lange syndrome 4		ISO	RGD:1317642	8554872	ClinVar Annotator: match by term: CORNELIA DE LANGE SYNDROME 4 WITH OR WITHOUT MIDLINE BRAIN more ...	ClinVar	PMID:16199547\|PMID:17576681\|PMID:18414213\|PMID:22633399\|PMID:24378232\|PMID:25326637\|PMID:25575569\|PMID:25741868\|PMID:27620904\|PMID:27882533\|PMID:28441377\|PMID:28492532\|PMID:30125677\|PMID:30158690\|PMID:30716475\|PMID:31173765\|PMID:31334757\|PMID:32193685\|PMID:32687945\|PMID:32696056\|PMID:33084842\|PMID:37350193\|PMID:9536098
Rad21	Rat	Cornelia de Lange syndrome 4		ISO	RGD:1317642	8554872	ClinVar Annotator: match by term: CORNELIA DE LANGE SYNDROME 4 WITH OR WITHOUT MIDLINE BRAIN more ...	ClinVar	PMID:17576681\|PMID:18414213\|PMID:22633399\|PMID:24378232\|PMID:25326637\|PMID:25741868\|PMID:27620904\|PMID:27882533\|PMID:28492532\|PMID:30125677\|PMID:30158690\|PMID:30716475\|PMID:31173765\|PMID:31334757\|PMID:32193685\|PMID:32696056\|PMID:9536098
Rad21	Rat	genetic disease		ISO	RGD:1317642	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:17576681\|PMID:18414213\|PMID:22633399\|PMID:24378232\|PMID:25125236\|PMID:25741868\|PMID:27882533\|PMID:28441377\|PMID:28492532\|PMID:31173765\|PMID:37350193\|PMID:9536098
Rad21	Rat	hereditary multiple exostoses		ISO	RGD:1317642	8554872	ClinVar Annotator: match by term: Multiple congenital exostosis	ClinVar	PMID:28492532
Rad21	Rat	Hereditary Neoplastic Syndromes		ISO	RGD:1317642	8554872	ClinVar Annotator: match by term: Hereditary cancer-predisposing syndrome	ClinVar	PMID:28492532
Rad21	Rat	Mungan Syndrome		ISO	RGD:1317642	8554872	ClinVar Annotator: match by term: Mungan syndrome	ClinVar	PMID:14638363\|PMID:18414213\|PMID:25575569\|PMID:25741868\|PMID:28492532
Rad21	Rat	myeloid leukemia associated with Down Syndrome		ISO	RGD:1317642	8554872	ClinVar Annotator: match by term: Acute megakaryoblastic leukemia in down syndrome	ClinVar	PMID:27993330
Rad21	Rat	trichorhinophalangeal syndrome type I		ISO	RGD:1317642	8554872	ClinVar Annotator: match by term: Trichorhinophalangeal dysplasia type I	ClinVar	PMID:25741868
Rad21	Rat	trichorhinophalangeal syndrome type III		ISO	RGD:1317642	8554872	ClinVar Annotator: match by term: Trichorhinophalangeal syndrome, type III	ClinVar	PMID:11112658\|PMID:25792522\|PMID:28492532

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rad21	Rat	Cornelia de Lange syndrome		ISO	RGD:1317642	11554173	CTD Direct Evidence: marker/mechanism	CTD
Rad21	Rat	Mungan Syndrome		ISO	RGD:1317642	11554173	CTD Direct Evidence: marker/mechanism	CTD
Rad21	Rat	myeloid leukemia		ISO	RGD:1317642	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:23955599
Rad21	Rat	myeloid leukemia associated with Down Syndrome		ISO	RGD:1317642	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:24056718

Imported Disease Annotations - OMIM

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rad21	Rat	Cornelia de Lange syndrome 4		ISO	RGD:1317642	7240710		OMIM
Rad21	Rat	Mungan Syndrome		ISO	RGD:1317642	7240710		OMIM

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rad21	Rat	1,2-dimethylhydrazine	affects expression	ISO	RGD:1317643	6480464	1,2-Dimethylhydrazine affects the expression of RAD21 mRNA	CTD	PMID:22206623
Rad21	Rat	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of RAD21 mRNA	CTD	PMID:32145629
Rad21	Rat	17beta-hydroxy-5alpha-androstan-3-one	increases expression	ISO	RGD:1317643	6480464	Dihydrotestosterone results in increased expression of RAD21 mRNA	CTD	PMID:17023530
Rad21	Rat	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	ISO	RGD:1317642	6480464	2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of RAD21 protein	CTD	PMID:31675489
Rad21	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of RAD21 mRNA	CTD	PMID:34747641
Rad21	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of RAD21 mRNA	CTD	PMID:33387578
Rad21	Rat	2,4,6-tribromophenol	decreases expression	ISO	RGD:1317642	6480464	2,4,6-tribromophenol results in decreased expression of RAD21 mRNA	CTD	PMID:31675489
Rad21	Rat	2,6-di-tert-butyl-4-methylphenol	increases expression	ISO	RGD:1317643	6480464	Butylated Hydroxytoluene results in increased expression of RAD21 mRNA	CTD	PMID:19000923
Rad21	Rat	2-butoxyethanol	increases expression	ISO	RGD:1317643	6480464	n-butoxyethanol results in increased expression of RAD21 mRNA	CTD	PMID:19812364
Rad21	Rat	2-methylcholine	affects expression	ISO	RGD:1317642	6480464	beta-methylcholine affects the expression of RAD21 mRNA	CTD	PMID:21179406
Rad21	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	RGD:1317642	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Rad21	Rat	4,4'-diaminodiphenylmethane	affects expression	ISO	RGD:1317643	6480464	4,4'-diaminodiphenylmethane affects the expression of RAD21 mRNA	CTD	PMID:18648102
Rad21	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	RGD:1317643	6480464	bisphenol S results in decreased expression of RAD21 mRNA	CTD	PMID:39298647
Rad21	Rat	4-hydroperoxycyclophosphamide	decreases expression	ISO	RGD:1317643	6480464	perfosfamide results in decreased expression of RAD21 mRNA	CTD	PMID:19429390
Rad21	Rat	4-hydroxyphenyl retinamide	decreases expression	ISO	RGD:1317642	6480464	Fenretinide results in decreased expression of RAD21 mRNA	CTD	PMID:16671099
Rad21	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of RAD21 mRNA	CTD	PMID:30047161
Rad21	Rat	afimoxifene	affects response to substance	ISO	RGD:1317642	6480464	RAD21 gene affects the susceptibility to afimoxifene	CTD	PMID:21482774
Rad21	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of RAD21 mRNA	CTD	PMID:30047161
Rad21	Rat	aristolochic acid A	decreases expression	ISO	RGD:1317642	6480464	aristolochic acid I results in decreased expression of RAD21 mRNA	CTD	PMID:33212167
Rad21	Rat	Aroclor 1254	decreases expression	ISO	RGD:1317643	6480464	Chlorodiphenyl (54% Chlorine) results in decreased expression of RAD21 mRNA	CTD	PMID:23650126
Rad21	Rat	arsenite(3-)	multiple interactions	ISO	RGD:1317642	6480464	arsenite inhibits the reaction [G3BP1 protein binds to RAD21 mRNA]	CTD	PMID:32406909
Rad21	Rat	arsenous acid	affects methylation	ISO	RGD:1317642	6480464	Arsenic Trioxide affects the methylation of RAD21 promoter	CTD	PMID:26046465
Rad21	Rat	atrazine	increases expression	ISO	RGD:1317642	6480464	Atrazine results in increased expression of RAD21 mRNA	CTD	PMID:22378314
Rad21	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	RGD:1317642	6480464	7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of RAD21 mRNA	CTD	PMID:20382639
Rad21	Rat	beta-lapachone	decreases expression	ISO	RGD:1317642	6480464	beta-lapachone results in decreased expression of RAD21 mRNA	CTD	PMID:38218311
Rad21	Rat	bis(2-ethylhexyl) phthalate	increases activity	ISO	RGD:1317643	6480464	Diethylhexyl Phthalate results in increased activity of RAD21 protein	CTD	PMID:35842051
Rad21	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	RGD:1317643	6480464	Diethylhexyl Phthalate results in decreased expression of RAD21 mRNA	CTD	PMID:34319233
Rad21	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of RAD21 mRNA	CTD	PMID:25181051\|PMID:32145629
Rad21	Rat	bisphenol A	decreases expression	ISO	RGD:1317642	6480464	bisphenol A results in decreased expression of RAD21 protein	CTD	PMID:31675489
Rad21	Rat	bisphenol A	multiple interactions	ISO	RGD:1317642	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Rad21	Rat	Brevetoxin B	decreases expression	ISO	RGD:1317642	6480464	brevetoxin 2 results in decreased expression of RAD21 mRNA	CTD	PMID:20498034
Rad21	Rat	cadmium atom	multiple interactions	ISO	RGD:1317642	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of RAD21 more ...	CTD	PMID:35301059
Rad21	Rat	cadmium dichloride	decreases expression	ISO	RGD:1317643	6480464	Cadmium Chloride results in decreased expression of RAD21 mRNA	CTD	PMID:15501611
Rad21	Rat	cadmium dichloride	multiple interactions	ISO	RGD:1317642	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of RAD21 more ...	CTD	PMID:35301059
Rad21	Rat	cadmium dichloride	decreases expression	ISO	RGD:1317642	6480464	Cadmium Chloride results in decreased expression of RAD21 mRNA	CTD	PMID:38568856
Rad21	Rat	cadmium dichloride	decreases expression	EXP		6480464	Cadmium Chloride results in decreased expression of RAD21 mRNA	CTD	PMID:33453195
Rad21	Rat	caffeine	increases phosphorylation	ISO	RGD:1317642	6480464	Caffeine results in increased phosphorylation of RAD21 protein	CTD	PMID:35688186
Rad21	Rat	carbon nanotube	decreases expression	ISO	RGD:1317643	6480464	Nanotubes, Carbon analog results in decreased expression of RAD21 mRNA	CTD	PMID:25554681
Rad21	Rat	cisplatin	affects response to substance	ISO	RGD:1317642	6480464	RAD21 protein affects the susceptibility to Cisplatin	CTD	PMID:16217747
Rad21	Rat	copper atom	multiple interactions	ISO	RGD:1317642	6480464	[Chelating Agents binds to Copper] which results in increased expression of RAD21 mRNA	CTD	PMID:30911355
Rad21	Rat	copper(0)	multiple interactions	ISO	RGD:1317642	6480464	[Chelating Agents binds to Copper] which results in increased expression of RAD21 mRNA	CTD	PMID:30911355
Rad21	Rat	coumarin	decreases phosphorylation	ISO	RGD:1317642	6480464	coumarin results in decreased phosphorylation of RAD21 protein	CTD	PMID:35688186
Rad21	Rat	coumestrol	increases expression	ISO	RGD:1317642	6480464	Coumestrol results in increased expression of RAD21 mRNA	CTD	PMID:19167446
Rad21	Rat	coumestrol	multiple interactions	ISO	RGD:1317642	6480464	[Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of RAD21 mRNA	CTD	PMID:19167446
Rad21	Rat	deguelin	increases expression	ISO	RGD:1317642	6480464	deguelin results in increased expression of RAD21 mRNA	CTD	PMID:33512557
Rad21	Rat	dexamethasone	multiple interactions	ISO	RGD:1317642	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Rad21	Rat	diarsenic trioxide	affects methylation	ISO	RGD:1317642	6480464	Arsenic Trioxide affects the methylation of RAD21 promoter	CTD	PMID:26046465
Rad21	Rat	dorsomorphin	multiple interactions	ISO	RGD:1317642	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Rad21	Rat	doxorubicin	decreases expression	EXP		6480464	Doxorubicin results in decreased expression of RAD21 mRNA	CTD	PMID:27181935
Rad21	Rat	doxorubicin	multiple interactions	ISO	RGD:1317642	6480464	[TP53 protein affects the susceptibility to Doxorubicin] which affects the expression of RAD21 mRNA	CTD	PMID:36634904
Rad21	Rat	doxorubicin	decreases expression	ISO	RGD:1317642	6480464	Doxorubicin results in decreased expression of RAD21 mRNA	CTD	PMID:36634904
Rad21	Rat	doxorubicin	multiple interactions	EXP		6480464	Fungal Polysaccharides inhibits the reaction [Doxorubicin results in decreased expression of RAD21 mRNA]	CTD	PMID:27181935
Rad21	Rat	Echimidine	multiple interactions	ISO	RGD:1317642	6480464	[CYP3A4 protein results in increased metabolism of echimidine] which results in decreased expression of RAD21 more ...	CTD	PMID:33884520
Rad21	Rat	Enterolactone	multiple interactions	ISO	RGD:1317642	6480464	[Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of RAD21 mRNA	CTD	PMID:19167446
Rad21	Rat	finasteride	increases expression	EXP		6480464	Finasteride results in increased expression of RAD21 mRNA	CTD	PMID:24136188
Rad21	Rat	genistein	decreases expression	ISO	RGD:1317642	6480464	Genistein results in decreased expression of RAD21 mRNA	CTD	PMID:22228119
Rad21	Rat	glafenine	decreases expression	EXP		6480464	Glafenine results in decreased expression of RAD21 mRNA	CTD	PMID:24136188
Rad21	Rat	glycyrrhizinic acid	decreases binding	ISO	RGD:1317642	243065267	Glycyrrhizinic acid decreases binding of RAD21 protein to SMC3 protein in lymphoma cells	RGD
Rad21	Rat	GSK-J4	increases expression	ISO	RGD:1317642	6480464	GSK-J4 results in increased expression of RAD21 mRNA	CTD	PMID:29301935
Rad21	Rat	hydralazine	multiple interactions	ISO	RGD:1317642	6480464	[Hydralazine co-treated with Valproic Acid] results in increased expression of RAD21 mRNA	CTD	PMID:17183730
Rad21	Rat	hydrogen peroxide	affects expression	ISO	RGD:1317642	6480464	Hydrogen Peroxide affects the expression of RAD21 mRNA	CTD	PMID:21179406
Rad21	Rat	indometacin	multiple interactions	ISO	RGD:1317642	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Rad21	Rat	ivermectin	decreases expression	ISO	RGD:1317642	6480464	Ivermectin results in decreased expression of RAD21 protein	CTD	PMID:32959892
Rad21	Rat	Lasiocarpine	multiple interactions	ISO	RGD:1317642	6480464	[CYP3A4 protein results in increased metabolism of lasiocarpine] which results in decreased expression of RAD21 more ...	CTD	PMID:33884520
Rad21	Rat	methapyrilene	decreases expression	EXP		6480464	Methapyrilene results in decreased expression of RAD21 mRNA	CTD	PMID:30467583
Rad21	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of RAD21 mRNA	CTD	PMID:30047161
Rad21	Rat	Mezerein	increases expression	ISO	RGD:1317643	6480464	mezerein results in increased expression of RAD21 mRNA	CTD	PMID:19000923
Rad21	Rat	microcystin-LR	decreases expression	ISO	RGD:1317643	6480464	cyanoginosin LR results in decreased expression of RAD21 protein	CTD	PMID:26984711
Rad21	Rat	monocrotaline	multiple interactions	ISO	RGD:1317642	6480464	[CYP3A4 protein results in increased metabolism of Monocrotaline] which results in decreased expression of RAD21 more ...	CTD	PMID:33884520
Rad21	Rat	N-methyl-4-phenylpyridinium	increases expression	ISO	RGD:1317643	6480464	1-Methyl-4-phenylpyridinium results in increased expression of RAD21 protein	CTD	PMID:26558463
Rad21	Rat	N-methyl-N'-nitro-N-nitrosoguanidine	multiple interactions	ISO	RGD:1317643	6480464	[Methylnitronitrosoguanidine co-treated with Okadaic Acid] results in increased expression of RAD21 mRNA	CTD	PMID:19840844
Rad21	Rat	N-nitrosodiethylamine	increases expression	ISO	RGD:1317643	6480464	Diethylnitrosamine results in increased expression of RAD21 mRNA	CTD	PMID:17854601
Rad21	Rat	N-nitrosodiethylamine	multiple interactions	ISO	RGD:1317643	6480464	RB1 protein inhibits the reaction [Diethylnitrosamine results in increased expression of RAD21 mRNA]	CTD	PMID:17854601
Rad21	Rat	okadaic acid	multiple interactions	ISO	RGD:1317643	6480464	[Methylnitronitrosoguanidine co-treated with Okadaic Acid] results in increased expression of RAD21 mRNA	CTD	PMID:19840844
Rad21	Rat	oxaliplatin	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of RAD21 mRNA	CTD	PMID:25729387
Rad21	Rat	paracetamol	affects expression	ISO	RGD:1317643	6480464	Acetaminophen affects the expression of RAD21 mRNA	CTD	PMID:17562736
Rad21	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of RAD21 mRNA	CTD	PMID:33387578
Rad21	Rat	pentachlorophenol	decreases expression	ISO	RGD:1317643	6480464	Pentachlorophenol results in decreased expression of RAD21 mRNA	CTD	PMID:23892564
Rad21	Rat	phorbol 13-acetate 12-myristate	increases expression	ISO	RGD:1317643	6480464	Tetradecanoylphorbol Acetate results in increased expression of RAD21 mRNA	CTD	PMID:19000923
Rad21	Rat	phosphoramide mustard	increases expression	EXP		6480464	phosphoramide mustard results in increased expression of RAD21 mRNA	CTD	PMID:26708502
Rad21	Rat	pirinixic acid	decreases expression	ISO	RGD:1317643	6480464	pirinixic acid results in decreased expression of RAD21 mRNA	CTD	PMID:18445702
Rad21	Rat	quercetin	decreases expression	ISO	RGD:1317642	6480464	Quercetin results in decreased expression of RAD21 mRNA	CTD	PMID:23727915
Rad21	Rat	riddelliine	multiple interactions	ISO	RGD:1317642	6480464	[CYP3A4 protein results in increased metabolism of riddelliine] which results in decreased expression of RAD21 more ...	CTD	PMID:33884520
Rad21	Rat	rotenone	increases expression	ISO	RGD:1317642	6480464	Rotenone results in increased expression of RAD21 mRNA	CTD	PMID:33512557
Rad21	Rat	saccharin	increases expression	ISO	RGD:1317643	6480464	Saccharin results in increased expression of RAD21 mRNA	CTD	PMID:19000923
Rad21	Rat	SB 431542	multiple interactions	ISO	RGD:1317642	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Rad21	Rat	sodium arsenite	decreases expression	ISO	RGD:1317642	6480464	sodium arsenite results in decreased expression of RAD21 mRNA	CTD	PMID:38568856
Rad21	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of RAD21 mRNA	CTD	PMID:30047161
Rad21	Rat	tetrachloromethane	increases expression	ISO	RGD:1317643	6480464	Carbon Tetrachloride results in increased expression of RAD21 mRNA	CTD	PMID:31919559
Rad21	Rat	titanium dioxide	decreases methylation	ISO	RGD:1317643	6480464	titanium dioxide results in decreased methylation of RAD21 gene; titanium dioxide results in decreased methylation more ...	CTD	PMID:35295148
Rad21	Rat	topotecan	multiple interactions	EXP		6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of RAD21 mRNA	CTD	PMID:25729387
Rad21	Rat	torcetrapib	increases expression	ISO	RGD:1317642	6480464	torcetrapib results in increased expression of RAD21 mRNA	CTD	PMID:23228038
Rad21	Rat	Tributyltin oxide	decreases expression	ISO	RGD:1317643	6480464	bis(tri-n-butyltin)oxide results in decreased expression of RAD21 mRNA	CTD	PMID:18958704
Rad21	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of RAD21 mRNA	CTD	PMID:33387578
Rad21	Rat	trichostatin A	decreases expression	ISO	RGD:1317642	6480464	trichostatin A results in decreased expression of RAD21 mRNA	CTD	PMID:26272509
Rad21	Rat	trichostatin A	multiple interactions	ISO	RGD:1317642	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Rad21	Rat	triphenyl phosphate	affects expression	ISO	RGD:1317642	6480464	triphenyl phosphate affects the expression of RAD21 mRNA	CTD	PMID:37042841
Rad21	Rat	valproic acid	multiple interactions	ISO	RGD:1317642	6480464	[Hydralazine co-treated with Valproic Acid] results in increased expression of RAD21 mRNA	CTD	PMID:17183730
Rad21	Rat	zinc dichloride	increases expression	ISO	RGD:1317643	6480464	zinc chloride results in increased expression of RAD21 mRNA	CTD	PMID:19000923

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rad21	Rat	chromatin looping	acts_upstream_of_or_within	IEA	UniProtKB:Q61550\|ensembl:ENSMUSP00000022927	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rad21	Rat	chromatin looping	acts_upstream_of_or_within	ISO	RGD:1317643	1624291	PMID:32328639	RGD	PMID:32328639
Rad21	Rat	chromosome segregation	involved_in	IEA	UniProtKB-KW:KW-0159	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Rad21	Rat	negative regulation of G2/M transition of mitotic cell cycle	involved_in	ISO	RGD:1317643	1624291	PMID:10375619	RGD	PMID:10375619
Rad21	Rat	negative regulation of G2/M transition of mitotic cell cycle	involved_in	IEA	UniProtKB:Q61550\|ensembl:ENSMUSP00000022927	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rad21	Rat	negative regulation of gene expression		IMP		243065265	Nos2, Fcgr2b	RGD
Rad21	Rat	negative regulation of glial cell apoptotic process		IMP		243065265		RGD
Rad21	Rat	negative regulation of interleukin-1 beta production		IMP		243065265		RGD
Rad21	Rat	negative regulation of mitotic metaphase/anaphase transition	involved_in	ISO	RGD:1317643	1624291	PMID:10375619	RGD	PMID:10375619
Rad21	Rat	negative regulation of mitotic metaphase/anaphase transition	involved_in	IEA	UniProtKB:Q61550\|ensembl:ENSMUSP00000022927	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rad21	Rat	negative regulation of neuron apoptotic process		IMP		243065262		RGD
Rad21	Rat	negative regulation of tumor necrosis factor production		IMP		243065265		RGD
Rad21	Rat	positive regulation of gene expression		IMP		243065265	Arg1, Klf4, Pparg, Tgfb1	RGD
Rad21	Rat	positive regulation of interleukin-10 production		IMP		243065265		RGD
Rad21	Rat	positive regulation of sister chromatid cohesion	involved_in	ISO	RGD:1317642	1624291	PMID:18499658	RGD	PMID:18499658
Rad21	Rat	positive regulation of sister chromatid cohesion	involved_in	IEA	UniProtKB:O60216\|ensembl:ENSP00000297338	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rad21	Rat	protein localization to chromatin	involved_in	ISO	RGD:1317642	1624291	PMID:21111234	RGD	PMID:21111234
Rad21	Rat	protein localization to chromatin	involved_in	IEA	UniProtKB:O60216\|ensembl:ENSP00000297338	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rad21	Rat	regulation of transcription by RNA polymerase II	involved_in	ISO	RGD:1317642	1624291	PMID:19468298	RGD	PMID:19468298
Rad21	Rat	regulation of transcription by RNA polymerase II	involved_in	IEA	UniProtKB:O60216\|ensembl:ENSP00000297338	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rad21	Rat	replication-born double-strand break repair via sister chromatid exchange	involved_in	IBA	PANTHER:PTN000286904\|SGD:S000002161	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rad21	Rat	response to hypoxia		IEP		243065262		RGD
Rad21	Rat	sister chromatid cohesion	involved_in	IEA	InterPro:IPR039781	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Rad21	Rat	sister chromatid cohesion	involved_in	IBA	FB:FBgn0260987\|PANTHER:PTN000286904\|PomBase:SPBC29A10.14\|PomBase:SPCC338.17c\|SGD:S000002161\|SGD:S000006211\|TAIR:locus:2169667\|TAIR:locus:2181457\|WB:WBGene00004333\|ZFIN:ZDB-GENE-030131-994	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rad21	Rat	chromatin	located_in	ISO	RGD:1317643	1624291	PMID:23920377	RGD	PMID:23920377
Rad21	Rat	chromatin	located_in	IEA	UniProtKB:Q61550\|ensembl:ENSMUSP00000022927	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rad21	Rat	chromosome	located_in	IEA	UniProtKB-SubCell:SL-0468	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Rad21	Rat	chromosome	located_in	IEA	UniProtKB-KW:KW-0158	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Rad21	Rat	chromosome, centromeric region	located_in	ISO	RGD:1317643	1624291	PMID:26919979	RGD	PMID:26919979
Rad21	Rat	chromosome, centromeric region	located_in	IEA	UniProtKB:Q61550\|ensembl:ENSMUSP00000022927	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rad21	Rat	cohesin complex	part_of	ISO	RGD:1317643	1624291	PMID:10375619, PMID:22419665	RGD	PMID:10375619\|PMID:22419665
Rad21	Rat	cohesin complex	part_of	IEA	InterPro:IPR039781	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Rad21	Rat	cohesin complex	part_of	IEA	UniProtKB:Q61550\|ensembl:ENSMUSP00000022927	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rad21	Rat	cohesin complex	part_of	IEA	UniProtKB:O60216\|ensembl:ENSP00000297338	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rad21	Rat	cohesin complex	part_of	ISO	RGD:1317642	1624291	PMID:11590136, PMID:22628566	RGD	PMID:11590136\|PMID:22628566
Rad21	Rat	condensed nuclear chromosome	located_in	IEA	UniProtKB:Q61550\|ensembl:ENSMUSP00000022927	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rad21	Rat	condensed nuclear chromosome	located_in	ISO	RGD:1317643	1624291	PMID:24797475	RGD	PMID:24797475
Rad21	Rat	meiotic cohesin complex	part_of	IBA	MGI:3652039\|PANTHER:PTN000286934	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rad21	Rat	midbody	located_in	IEA	UniProtKB:O60216\|ensembl:ENSP00000297338	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rad21	Rat	midbody	located_in	ISO	RGD:1317642	1624291		RGD	GO_REF:0000052
Rad21	Rat	mitotic cohesin complex	part_of	ISO	RGD:1317642	1624291	PMID:23242214	RGD	PMID:23242214
Rad21	Rat	mitotic cohesin complex	part_of	IEA	UniProtKB:O60216\|ensembl:ENSP00000297338	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rad21	Rat	nuclear matrix	located_in	ISO	RGD:1317642	1624291	PMID:11590136	RGD	PMID:11590136
Rad21	Rat	nuclear matrix	located_in	IEA	UniProtKB:O60216\|ensembl:ENSP00000297338	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rad21	Rat	nucleoplasm	located_in	IEA	UniProtKB:O60216\|ensembl:ENSP00000297338	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rad21	Rat	nucleoplasm	located_in	ISO	RGD:1317642	1624291		RGD	GO_REF:0000052
Rad21	Rat	nucleus	located_in	ISO	RGD:1317643	1624291	PMID:10375619	RGD	PMID:10375619
Rad21	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Rad21	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Rad21	Rat	nucleus		IDA		243065265		RGD
Rad21	Rat	nucleus	located_in	IEA	UniProtKB:Q61550\|ensembl:ENSMUSP00000022927	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rad21	Rat	chromatin binding	enables	IBA	PANTHER:PTN000286904\|SGD:S000002161\|SGD:S000006211	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rad21	Rat	cis-regulatory region sequence-specific DNA binding	enables	ISO	RGD:1317643	1624291	PMID:28636939	RGD	PMID:28636939
Rad21	Rat	cis-regulatory region sequence-specific DNA binding	enables	IEA	UniProtKB:Q61550\|ensembl:ENSMUSP00000022927	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rad21	Rat	DNA-binding transcription factor binding		IPI	RGD:3371	243065265		RGD
Rad21	Rat	lncRNA binding		IDA		243065262	MIAT	RGD
Rad21	Rat	protein binding	enables	ISO	RGD:1317643	1624291	PR:Q924K8\|UniProtKB:Q9CU62\|UniProtKB:Q9CW03 PMID:10375619, PMID:22075476	RGD	PMID:10375619\|PMID:22075476
Rad21	Rat	protein binding	enables	ISO	RGD:1317642	1624291	UniProtKB:Q13643\|UniProtKB:Q14674\|UniProtKB:Q14683\|UniProtKB:Q29RF7\|UniProtKB:Q7Z5K2\|UniProtKB:Q8N3U4\|UniProtKB:Q8WVB6\|UniProtKB:Q96FC9\|UniProtKB:Q9CPY3\|UniProtKB:Q9NP77\|UniProtKB:Q9NTI5\|UniProtKB:Q9UQE7 PMID:12672959, PMID:12930902, PMID:15837422, PMID:15855230, PMID:16802858, PMID:17105772, PMID:17112726, PMID:17113138, PMID:17349791, PMID:17962804, PMID:18235444, PMID:19629043, PMID:19696148, more ...	RGD	PMID:12672959\|PMID:12930902\|PMID:15837422\|PMID:15855230\|PMID:16802858\|PMID:17105772\|PMID:17112726\|PMID:17113138\|PMID:17349791\|PMID:17962804\|PMID:18235444\|PMID:19629043\|PMID:19696148\|PMID:20360068\|PMID:20818333\|PMID:22293751\|PMID:22885700\|PMID:23242214\|PMID:24981860\|PMID:25173175\|PMID:25416956\|PMID:26496610\|PMID:28514442\|PMID:29263825\|PMID:29867216\|PMID:31515488\|PMID:33961781\|PMID:35271311

Molecular Pathway Annotations Click to see Annotation Detail View

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rad21	Rat	cell cycle pathway, mitotic		IEA		6907045		KEGG	rno:04110

Disease Annotations Click to see Annotation Detail View

Cerebral Hemorrhage (IMP)

colorectal carcinoma (ISO)

Cornelia de Lange syndrome (ISO)

Cornelia de Lange syndrome 1 (ISO)

Cornelia de Lange syndrome 4 (ISO)

endometrial cancer (ISO)

genetic disease (ISO)

hepatocellular carcinoma (ISO)

hereditary multiple exostoses (ISO)

Hereditary Neoplastic Syndromes (ISO)

lung non-small cell carcinoma (ISO)

malignant pleural mesothelioma (ISO)

Mungan Syndrome (ISO)

myeloid leukemia (ISO)

myeloid leukemia associated with Down Syndrome (ISO)

oral squamous cell carcinoma (ISO)

Spinal Cord Injuries (IEP)

trichorhinophalangeal syndrome type I (ISO)

trichorhinophalangeal syndrome type III (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4,6-tribromophenol (ISO)

2,6-di-tert-butyl-4-methylphenol (ISO)

2-butoxyethanol (ISO)

2-methylcholine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroperoxycyclophosphamide (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

afimoxifene (ISO)

amitrole (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Brevetoxin B (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

caffeine (ISO)

carbon nanotube (ISO)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

coumarin (ISO)

coumestrol (ISO)

deguelin (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dorsomorphin (ISO)

doxorubicin (EXP,ISO)

Echimidine (ISO)

Enterolactone (ISO)

finasteride (EXP)

genistein (ISO)

glafenine (EXP)

glycyrrhizinic acid (ISO)

GSK-J4 (ISO)

hydralazine (ISO)

hydrogen peroxide (ISO)

indometacin (ISO)

ivermectin (ISO)

Lasiocarpine (ISO)

methapyrilene (EXP)

methimazole (EXP)

Mezerein (ISO)

microcystin-LR (ISO)

monocrotaline (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-methyl-N'-nitro-N-nitrosoguanidine (ISO)

N-nitrosodiethylamine (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

paracetamol (EXP,ISO)

pentachlorophenol (ISO)

phorbol 13-acetate 12-myristate (ISO)

phosphoramide mustard (EXP)

pirinixic acid (ISO)

quercetin (ISO)

riddelliine (ISO)

rotenone (ISO)

saccharin (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

tetrachloromethane (ISO)

titanium dioxide (ISO)

topotecan (EXP)

torcetrapib (ISO)

Tributyltin oxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

zinc dichloride (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chromatin looping (IEA,ISO)

chromosome segregation (IEA)

negative regulation of G2/M transition of mitotic cell cycle (IEA,ISO)

negative regulation of gene expression (IMP)

negative regulation of glial cell apoptotic process (IMP)

negative regulation of interleukin-1 beta production (IMP)

negative regulation of mitotic metaphase/anaphase transition (IEA,ISO)

negative regulation of neuron apoptotic process (IMP)

negative regulation of tumor necrosis factor production (IMP)

positive regulation of gene expression (IMP)

positive regulation of interleukin-10 production (IMP)

positive regulation of sister chromatid cohesion (IEA,ISO)

protein localization to chromatin (IEA,ISO)

regulation of transcription by RNA polymerase II (IEA,ISO)

replication-born double-strand break repair via sister chromatid exchange (IBA)

response to hypoxia (IEP)

sister chromatid cohesion (IBA,IEA)

Cellular Component

chromatin (IEA,ISO)

chromosome (IEA)

chromosome, centromeric region (IEA,ISO)

cohesin complex (IEA,ISO)

condensed nuclear chromosome (IEA,ISO)

meiotic cohesin complex (IBA)

midbody (IEA,ISO)

mitotic cohesin complex (IEA,ISO)

nuclear matrix (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IDA,IEA,ISO)

Molecular Function

chromatin binding (IBA)

cis-regulatory region sequence-specific DNA binding (IEA,ISO)

DNA-binding transcription factor binding (IPI)

lncRNA binding (IDA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

cell cycle pathway, mitotic (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	PPARγ/RAD21 alleviates peripheral secondary brain injury in rat cerebral hemorrhage model through promoting M2 polarization of microglial cells.	Jiao Y, etal., Int Immunopharmacol. 2023 Jan;114:109572. doi: 10.1016/j.intimp.2022.109572. Epub 2022 Dec 18.
3.	Mechanism of glycyrrhizic acid inhibition of Kaposi's sarcoma-associated herpesvirus: disruption of CTCF-cohesin-mediated RNA polymerase II pausing and sister chromatid cohesion.	Kang H and Lieberman PM, J Virol. 2011 Nov;85(21):11159-69. doi: 10.1128/JVI.00720-11. Epub 2011 Aug 31.
4.	Polymorphisms in mitotic checkpoint-related genes can influence survival outcomes of early-stage non-small cell lung cancer.	Kang HG, etal., Oncotarget. 2017 Jun 27;8(37):61777-61785. doi: 10.18632/oncotarget.18693. eCollection 2017 Sep 22.
5.	[Endometrial cancer in young women--clinical and molecular aspects].	Lapińska-Szumczyk S, etal., Ginekol Pol. 2014 Oct;85(10):754-9.
6.	LncRNA MIAT activates vascular endothelial growth factor A through RAD21 to promote nerve injury repair in acute spinal cord injury.	Li D, etal., Mol Cell Endocrinol. 2021 May 15;528:111244. doi: 10.1016/j.mce.2021.111244. Epub 2021 Mar 17.
7.	Cell Cycle Genes Are Potential Diagnostic and Prognostic Biomarkers in Hepatocellular Carcinoma.	Liping X, etal., Biomed Res Int. 2020 Jun 7;2020:6206157. doi: 10.1155/2020/6206157. eCollection 2020.
8.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	MiR-320b/RAD21 axis affects hepatocellular carcinoma radiosensitivity to ionizing radiation treatment through DNA damage repair signaling.	Wang J, etal., Cancer Sci. 2021 Feb;112(2):575-588. doi: 10.1111/cas.14751. Epub 2020 Dec 31.
14.	Correlation of invasion and metastasis of cancer cells, and expression of the RAD21 gene in oral squamous cell carcinoma.	Yamamoto G, etal., Virchows Arch. 2006 Apr;448(4):435-41. doi: 10.1007/s00428-005-0132-y. Epub 2006 Jan 14.
15.	Genomic and regulatory characteristics of significant transcription factors in colorectal cancer metastasis.	Zhou B and Guo R, Sci Rep. 2018 Dec 13;8(1):17836. doi: 10.1038/s41598-018-36168-8.

Additional References at PubMed

PMID:10375619	PMID:11590136	PMID:12477932	PMID:18499658	PMID:19468298	PMID:19946888	PMID:21111234	PMID:22419665	PMID:22628566	PMID:22780989	PMID:23242214	PMID:23920377
PMID:24797475	PMID:31505169

Genomics

Comparative Map Data

Rad21
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	85,177,715 - 85,204,657 (-)	NCBI		GRCr8
mRatBN7.2	7	83,287,867 - 83,314,810 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	83,287,870 - 83,314,817 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	85,183,451 - 85,210,398 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	87,384,656 - 87,411,603 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	87,211,563 - 87,238,505 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	91,511,755 - 91,538,673 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	91,511,756 - 91,538,673 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	92,155,546 - 92,182,749 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	88,267,648 - 88,294,703 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	7	80,164,565 - 80,191,459 (-)	NCBI		Celera
Cytogenetic Map	7	q31	NCBI

RAD21
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	8	116,845,934 - 116,874,776 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	8	116,845,934 - 116,874,776 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	8	117,858,173 - 117,887,015 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	8	117,927,355 - 117,956,182 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	8	117,927,354 - 117,956,182	NCBI
Celera	8	114,046,862 - 114,075,794 (-)	NCBI		Celera
Cytogenetic Map	8	q24.11	NCBI
HuRef	8	113,184,591 - 113,213,523 (-)	NCBI		HuRef
CHM1_1	8	117,898,409 - 117,927,335 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	8	117,974,085 - 118,002,938 (-)	NCBI		T2T-CHM13v2.0

Rad21
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	51,826,000 - 51,856,934 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	51,825,636 - 51,855,143 (-)	Ensembl		GRCm39 Ensembl
GRCm38	15	51,962,604 - 51,993,538 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	51,962,240 - 51,991,747 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	51,794,150 - 51,823,306 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	51,792,680 - 51,821,636 (-)	NCBI		MGSCv36	mm8
Celera	15	53,535,633 - 53,555,853 (-)	NCBI		Celera
Cytogenetic Map	15	C	NCBI
cM Map	15	19.54	NCBI

Rad21
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955417	22,941,479 - 22,966,837 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955417	22,941,549 - 22,966,395 (-)	NCBI	ChiLan1.0	ChiLan1.0

RAD21
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	7	134,252,362 - 134,281,273 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	8	109,767,758 - 109,796,718 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	8	113,520,456 - 113,549,339 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	8	116,063,503 - 116,092,421 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	8	116,063,503 - 116,092,421 (-)	Ensembl	panpan1.1		panPan2

RAD21
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	16,337,563 - 16,368,041 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	16,338,972 - 16,368,035 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	16,338,678 - 16,369,154 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	16,626,236 - 16,656,848 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	16,626,236 - 16,656,850 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	16,369,666 - 16,400,273 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	16,469,992 - 16,500,602 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	16,711,252 - 16,741,853 (-)	NCBI		UU_Cfam_GSD_1.0

Rad21
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	21,951,734 - 21,978,780 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936470	29,377,734 - 29,407,312 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936470	29,377,793 - 29,403,422 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RAD21
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	21,772,855 - 21,802,715 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	21,772,821 - 21,802,453 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	23,059,570 - 23,262,558 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RAD21
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	8	111,486,356 - 111,515,641 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	8	111,486,048 - 111,507,729 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666039	28,811,005 - 28,840,566 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rad21
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624763	15,131,005 - 15,158,155 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624763	15,131,106 - 15,157,512 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rad21
128 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	190
Count of miRNA genes:	149
Interacting mature miRNAs:	172
Transcripts:	ENSRNOT00000006209
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
2293667	Bss42	Bone structure and strength QTL 42	7.25	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	7	47651439	92651439	Rat
10053722	Scort27	Serum corticosterone level QTL 27	2.41	0.0083	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	43228750	88228750	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
2317035	Aia16	Adjuvant induced arthritis QTL 16	2.71		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	7	59238038	104238038	Rat
1300127	Srn1	Serum renin concentration QTL 1	3.87		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	7	29409683	84928080	Rat
2293678	Bss24	Bone structure and strength QTL 24	6.71	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	7	47651439	92651439	Rat
1358361	Sradr5	Stress Responsive Adrenal Weight QTL 5	5.55		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	7	43747012	108555253	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	69736356	112729554	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
2293685	Bmd21	Bone mineral density QTL 21	4.2	0.0003	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	7	47651439	92651439	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
634326	Hc3	Hypercalciuria QTL 3	2.1		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	7	42787314	87787314	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	80221299	109401111	Rat
2293696	Bmd32	Bone mineral density QTL 32	5.1	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	7	47651439	92651439	Rat
1300151	Bp181	Blood pressure QTL 181	3.36		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	7	53612714	103945643	Rat
1559283	Emca4	Estrogen-induced mammary cancer QTL 4	3.7		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	7	62004452	101773158	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
738030	Anxrr8	Anxiety related response QTL 8	4.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	46590070	91590070	Rat
1300149	Cm6	Cardiac mass QTL 6	4.09		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	7	43747099	102228765	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
2293707	Bss32	Bone structure and strength QTL 32	7.64	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	7	47651439	92651439	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
1641908	Teswt1	Testicular weight QTL 1	3.28		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	7	80221299	94811326	Rat
2293644	Bmd29	Bone mineral density QTL 29	5.4	0.0001	femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	7	47651439	92651439	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	68938720	113886318	Rat
2300178	Bmd54	Bone mineral density QTL 54	5.3	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	7	47651439	92651439	Rat
724537	Niddm52	Non-insulin dependent diabetes mellitus QTL 52		0.02	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	80221299	93595843	Rat
1298528	Bp169	Blood pressure QTL 169		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	61074194	106074194	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	44867533	89867533	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	80221299	112308525	Rat
1300132	Bp182	Blood pressure QTL 182	3.49		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	19654317	84928080	Rat
1576303	Ept7	Estrogen-induced pituitary tumorigenesis QTL 7	3.7		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	7	62004452	101773158	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	68938720	113886318	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	68938720	113886318	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	69736226	117455174	Rat

Markers in Region

RH131367

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	83,293,712 - 83,293,892 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	91,517,601 - 91,517,780	NCBI	Rnor6.0
Rnor_5.0	7	92,161,392 - 92,161,571	UniSTS	Rnor5.0
RGSC_v3.4	7	88,273,494 - 88,273,673	UniSTS	RGSC3.4
Celera	7	80,170,411 - 80,170,590	UniSTS
RH 3.4 Map	7	550.3	UniSTS
Cytogenetic Map	7	q31	UniSTS

RH137734

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	83,288,539 - 83,288,693 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	91,512,428 - 91,512,581	NCBI	Rnor6.0
Rnor_5.0	7	92,156,219 - 92,156,372	UniSTS	Rnor5.0
RGSC_v3.4	7	88,268,321 - 88,268,474	UniSTS	RGSC3.4
Celera	7	80,165,238 - 80,165,391	UniSTS
RH 3.4 Map	7	550.4	UniSTS
Cytogenetic Map	7	q31	UniSTS

RH134178

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	83,287,932 - 83,288,113 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	91,511,821 - 91,512,001	NCBI	Rnor6.0
Rnor_5.0	7	92,155,612 - 92,155,792	UniSTS	Rnor5.0
RGSC_v3.4	7	88,267,714 - 88,267,894	UniSTS	RGSC3.4
Celera	7	80,164,631 - 80,164,811	UniSTS
RH 3.4 Map	7	549.1	UniSTS
Cytogenetic Map	7	q31	UniSTS

RH139481

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	83,288,539 - 83,288,756 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	91,512,428 - 91,512,644	NCBI	Rnor6.0
Rnor_5.0	7	92,156,219 - 92,156,435	UniSTS	Rnor5.0
RGSC_v3.4	7	88,268,321 - 88,268,537	UniSTS	RGSC3.4
Celera	7	80,165,238 - 80,165,454	UniSTS
RH 3.4 Map	7	551.8	UniSTS
Cytogenetic Map	7	q31	UniSTS

AW530029

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	83,316,640 - 83,316,791 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	91,540,504 - 91,540,654	NCBI	Rnor6.0
Rnor_5.0	7	92,184,580 - 92,184,730	UniSTS	Rnor5.0
RGSC_v3.4	7	88,296,534 - 88,296,684	UniSTS	RGSC3.4
Celera	7	80,193,290 - 80,193,440	UniSTS
RH 3.4 Map	7	541.8	UniSTS
Cytogenetic Map	7	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025701	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC099200	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211608	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006209 ⟹ ENSRNOP00000006209

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	83,287,870 - 83,314,817 (-)	Ensembl
Rnor_6.0 Ensembl	7	91,511,756 - 91,538,673 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116638 ⟹ ENSRNOP00000095133

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	83,288,697 - 83,314,805 (-)	Ensembl

RefSeq Acc Id:

NM_001025701 ⟹ NP_001020872

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	85,177,715 - 85,204,657 (-)	NCBI
mRatBN7.2	7	83,287,867 - 83,314,810 (-)	NCBI
Rnor_6.0	7	91,511,755 - 91,538,673 (-)	NCBI
Rnor_5.0	7	92,155,546 - 92,182,749 (-)	NCBI
RGSC_v3.4	7	88,267,648 - 88,294,703 (-)	RGD
Celera	7	80,164,565 - 80,191,459 (-)	RGD

Sequence:

show sequence

CGGCAGCCATCTTGTTTGTTTGAGTGAATCGGAAAGGAGGCGGCGGCCGTGGCGGTGGCGGGAG
CAACTCCGAGGCTACACCGCACAAGGGCTCCCCCTTTCCCCGCCCCCTCCCCCGACCCTTTCCC
CCCTCCCCGGGCCACCCACCCCTCCCAGCTCCCCGCAGAGATACAGGTTTCTTTTTATTTCATA
GCAAATAAGAAAAATGTTCTACGCACATTTTGTCCTCAGCAAACGAGGGCCTCTGGCCAAAATT
TGGCTGGCGGCCCATTGGGACAAGAAGCTAACCAAAGCCCATGTGTTTGAGTGTAACTTAGAAA
GCAGTGTGGAAAGTATCATCTCACCTAAGGTGAAGATGGCGCTGCGGACGTCAGGACACCTCCT
CCTGGGCGTAGTCCGCATCTATCACAGGAAAGCCAAATACCTCCTCGCGGACTGTAATGAAGCA
TTTATTAAAATAAAGATGGCTTTTCGGCCAGGTGTTGTCGATCTACCTGAGGAAAATCGGGAAG
CGGCTTATAATGCCATTACTTTACCTGAGGAATTTCACGATTTTGACCAGCCACTGCCAGACTT
AGATGACATTGACGTCGCCCAGCAGTTCAGCTTGAACCAGAGCAGAGTAGAAGAGATAACCATG
AGAGAAGAAGTTGGGAACATCAGTATCCTACAGGAAAATGACTTCGGTGACTTTGGAATGGATG
ACCGTGAAATCATGAGAGAAGGCAGTGCTTTCGAGGATGACGACATGTTAGTGAGCACCAGTGC
TTCCAACCTCCTCCTAGAGCCTGAGCAGAGCACCAGCAACCTGAATGAAAAGATTAACCATTTA
GAGTATGAGGACCAGTACAAAGATGATAACTTTGGAGAAGGCAATGATGGTGGTATATTGGACG
ACAAACTTATAAGTAATAATGACGGTGGCATCTTTGACGACCCCCCTGCCTTGTCTGAGACGGG
GGTCATGTTGCCAGAGCAGCCTGCACACGATGATATGGATGAGGATGACAATGGCTCGTTGGGT
GGGCCTGATAGTCCTGACTCTGTGGATCCTGTTGAACCAATGCCAACCATGACTGATCAGACAA
CACTCGTCCCAAATGAGGAAGAAGCTTTTGCATTGGAGCCCATTGATATAACTGTCAAAGAAAC
AAAAGCCAAGAGGAAGAGGAAGCTGATTGTTGACAGTGTCAAGGAATTGGATAGTAAGACAATT
AGAGCCCAACTCAGTGATTACTCTGATATTGTTACAACTCTGGACCTGGCCCCGCCCACCAAGA
AGCTGATGATGTGGAAAGAGACGGGAGGGGTGGAGAAGCTCTTCTCCTTACCAGCGCAGCCATT
GTGGAATAACCGACTACTGAAGCTCTTTACACGCTGCCTTACTCCACTTGTACCAGAAGACCTT
AGGAAAAGAAGGAAAGGGGGAGAGGCAGATAATCTGGATGAGTTCCTCAAAGAGTTCGAGAACC
CAGAGGTCCCCCGAGAGGAGCAGCAGCCGCAGCCACAGCAGCAGCAGGCGCAGCGTGACGTCAT
TGATGAGCCCATTATAGAAGAGCCAAGCCGCCTTCAGGACTCAGTGATGGAGGCCAGCAGAACA
AACATAGAAGAGTCGGCCATGCCTCCACCACCCCCTCAGGGAGTTAAGCGAAAAGCCGGGCAAG
TAGACCCGGAGCCTGCGATTCCTCCTCAGCAGGTAGAGCAAATGGAAATACCACCAGTAGAACT
TCCCCCAGAAGAACCTCCCAATATCTGTCAGCTGATACCGGAGTTAGAGCTTCTACCAGAAAAG
GAGAAGGAGAAAGAGAAGGAGAAGGAGGAGGAAGAAGAGGAGGAGGATGAAGATGCTTCAGGGG
GTGATCAGGATCAAGAGGAAAGGAGATGGAACAAAAGGACTCAGCAGATGCTTCATGGTCTTCA
GCGAGCTCTTGCTAAAACTGGAGCAGAGTCGATCAGTTTGCTTGAGCTATGTCGAAACACAAAC
CGAAAGCAGGCAGCAGCAAAGTTCTACAGCTTTTTGGTTCTTAAAAAGCAGCAAGCCATCGAGC
TCACACAGGAAGAGCCGTACAGTGACATCATTGCAACACCTGGACCAAGGTTCCACATCATCTG
AGGAGCTAGACGCTTTAGAGCTAGTGTTAACTCACTAGGACGTACAAATTGCCCCATGTGTAGG
GCACCAGAACCCTTTAAGGAAGTTTTTAGATTTTTGTTTGTACAAAATCTTTGCCTTTTCTTTC
TTCATTTTTTTCCCCCAGTGTTTCTAATTTTGTCGACCATCTTTTAAGGGAAACTGCTTATTTG
GGTTGGGTTTGTATTCCTGGAGAAGACAGTACCCCCAAGAACCCAGAAGACTTTTAACAGTTCA
GAGCAGATGTGTGCAATATTGGTGCATGTAAGAATATGGAGTAACAGTCAAAAGTCCCCATTTT
TATGTTAGTTTTCCATTACTTTGTTTAAAAGAAAAACCTGCCTAGGAAAATGCCTGACACTTTA
AGAACTGTGGTTTGAGTCCCTTGACAGGAAGAGAAAAATGTCTTCCCATCAGTGAAACCAACAG
TCTGGTTAACCACTGTACCTGGGGATAGTATGTGAGGCATCGTGCTTGTCTTCTTGATCATGTT
TTAAAGTAAGTCAGTTCATAATGAGCAAGAACTTGTGAGTTTGTGCTGACTGATCCTCTTCGAC
TATTATGTTCTGAAATCATTCCGTGACTCTTAGGAACTCTGACGCTAGTGCAGCTCAGAATGAC
AGACTTCTGCAGTGGCGGGACTCCTCAAGGGCTGCAGATCGCTTTCTCAAAGGTGTCTGGATGT
TTGCTTGAGTAATGAGATCATGAAAATAGAAATTCCCCTGCCTGCTGAAGGGCAAACCAATGAG
AAACTACCCCAGATTGACTTCCTTTAAGCAAACAGTGCTGTAAAAACTAATGGCTTCTCTGATA
TTTATTATAAATGTTAGTACTGAGCTTCCAATGCTGCACACTCCTGTGTTTGAAACTATTTTAA
TAACTTTGCAACTGTAATCCTGTATCAGTTTCCTATAATTTAAATGGAAAAAAACATCCTAATA
AAGGCTTTATTATTAACAGACCAGATAGTACCAGAAATTATGTGACTATATAAATATCAAAACG
TGTTCACTTTGTAGGACAAAATTATGTTGAAAGTTCTAGCTTAAGTGTTGGCACTTTTATGGGG
GGGAAATCAGTTTTAAAACTAAGACTTCCATGTATACCCAGTAATTTAAAATTATGTGAAATAT
TTTAAATTTGTGAACTCGTAATTACTATTTTAATGATTGAGCTTCTCGAGAATGGTAAGTGTAT
AGATGCTCTTGCGGTTTCTTTTCAGTAAGACGTGCCTGGAAACCATGGATCCCCTTTGTAAAAA
GACACTGTAGATAATTGAATGTTGATTATAGAAAGGCCATTAGTTTCTTGTTACACATTTTGTT
AGTCCAGTTTTTGTCGCTTATTGGGTTTAATATTGTTCTTGAAAATAGTCAATGCTATGTTATG
TATAACTTTTCTAATAAAAGTTGTGTTTCAAGCTGTAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001020872	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH99200	(Get FASTA)	NCBI Sequence Viewer
	EDM16276	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006209
	ENSRNOP00000006209.6
	ENSRNOP00000095133.1

RefSeq Acc Id:

NP_001020872 ⟸ NM_001025701

- UniProtKB:

Q4KLH7 (UniProtKB/TrEMBL), A0A8I6ANZ0 (UniProtKB/TrEMBL), F7EK71 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVV
RIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENREAAYNAITLPEEFHDFDQPLPDLDDID
VAQQFSLNQSRVEEITMREEVGNISILQENDFGDFGMDDREIMREGSAFEDDDMLVSTSASNLL
LEPEQSTSNLNEKINHLEYEDQYKDDNFGEGNDGGILDDKLISNNDGGIFDDPPALSETGVMLP
EQPAHDDMDEDDNGSLGGPDSPDSVDPVEPMPTMTDQTTLVPNEEEAFALEPIDITVKETKAKR
KRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSLPAQPLWNNR
LLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEFENPEVPREEQQPQPQQQQAQRDVIDEPI
IEEPSRLQDSVMEASRTNIEESAMPPPPPQGVKRKAGQVDPEPAIPPQQVEQMEIPPVELPPEE
PPNICQLIPELELLPEKEKEKEKEKEEEEEEEDEDASGGDQDQEERRWNKRTQQMLHGLQRALA
KTGAESISLLELCRNTNRKQAAAKFYSFLVLKKQQAIELTQEEPYSDIIATPGPRFHII

hide sequence

Ensembl Acc Id:

ENSRNOP00000006209 ⟸ ENSRNOT00000006209

Ensembl Acc Id:

ENSRNOP00000095133 ⟸ ENSRNOT00000116638

Protein Domains

Rad21/Rec8-like protein C-terminal eukaryotic Rad21/Rec8-like protein N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4KLH7-F1-model_v2	AlphaFold	Q4KLH7	1-635	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695323

Promoter ID:

EPDNEW_R5848

Type:

initiation region

Name:

Rad21_1

Description:

RAD21 cohesin complex component

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	91,538,660 - 91,538,720	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1594529	AgrOrtholog
BioCyc Gene	G2FUF-33427	BioCyc
Ensembl Genes	ENSRNOG00000004420	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000006209	ENTREZGENE
	ENSRNOT00000006209.6	UniProtKB/TrEMBL
	ENSRNOT00000116638.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.10.580	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7384021	IMAGE-MGC_LOAD
InterPro	NXP1_M-like	UniProtKB/TrEMBL
	Rad21/Rec8-like	UniProtKB/TrEMBL
	Rad21/Rec8_C	UniProtKB/TrEMBL
	Rad21_Rec8_N	UniProtKB/TrEMBL
	ScpA-like_C	UniProtKB/TrEMBL
	WH_DNA-bd_sf	UniProtKB/TrEMBL
KEGG Report	rno:314949	UniProtKB/TrEMBL
MGC_CLONE	MGC:116373	IMAGE-MGC_LOAD
NCBI Gene	314949	ENTREZGENE
PANTHER	DOUBLE-STRAND-BREAK REPAIR PROTEIN RAD21 HOMOLOG	UniProtKB/TrEMBL
	PTHR12585	UniProtKB/TrEMBL
Pfam	Rad21_Rec8	UniProtKB/TrEMBL
	Rad21_Rec8_N	UniProtKB/TrEMBL
PhenoGen	Rad21	PhenoGen
RatGTEx	ENSRNOG00000004420	RatGTEx
Superfamily-SCOP	SSF46785	UniProtKB/TrEMBL
UniProt	A0A8I6ANZ0	ENTREZGENE, UniProtKB/TrEMBL
	F7EK71	ENTREZGENE, UniProtKB/TrEMBL
	Q4KLH7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-07-01	Rad21	RAD21 cohesin complex component	Rad21	RAD21 homolog (S. pombe)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-06	Rad21	RAD21 homolog (S. pombe)	MGC116373	similar to HR21spA	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	MGC116373	similar to HR21spA			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)