Symbol:
PARK7
Name:
Parkinsonism associated deglycase
RGD ID:
1344212
HGNC Page
HGNC:16369
Description:
Enables several functions, including enzyme activator activity; enzyme binding activity; and transition metal ion binding activity. Involved in several processes, including negative regulation of apoptotic signaling pathway; regulation of protein modification process; and response to hydrogen peroxide. Located in several cellular components, including PML body; mitochondrion; and perinuclear region of cytoplasm. Implicated in Parkinson's disease; Parkinson's disease 7; Parkinsonism; cerebral infarction; and middle cerebral artery infarction.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
DJ-1; DJ1; epididymis secretory sperm binding protein Li 67p; FLJ27376; FLJ34360; FLJ92274; GATD2; HEL-S-67p; maillard deglycase; oncogene DJ1; Parkinson disease (autosomal recessive, early onset) 7; Parkinson disease protein 7; parkinson protein 7; protein/nucleic acid deglycase DJ-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Park7 (Parkinson disease (autosomal recessive, early onset) 7) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Park7 (Parkinsonism associated deglycase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Chinchilla lanigera (long-tailed chinchilla):
Park7 (Parkinsonism associated deglycase) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
PARK7 (Parkinsonism associated deglycase) NCBI
Ortholog
Canis lupus familiaris (dog):
PARK7 (Parkinsonism associated deglycase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Park7 (Parkinsonism associated deglycase) NCBI
Ortholog
Sus scrofa (pig):
PARK7 (Parkinsonism associated deglycase) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
PARK7 (Parkinsonism associated deglycase) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Park7 (Parkinsonism associated deglycase) NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Park7 (Parkinsonism associated deglycase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Park7 (Parkinson disease (autosomal recessive, early onset) 7)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
park7 (parkinson protein 7)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
djr-1.1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
DJ-1alpha
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
dj-1beta
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
djr-1.2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
park7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus laevis (African clawed frog):
park7.S
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
park7.L
Alliance
DIOPT (Xenbase)
Related Pseudogenes:
PARK7P1
PARK7P2
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 7,961,711 - 7,985,505 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 7,954,291 - 7,985,505 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 8,021,771 - 8,045,565 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 7,944,380 - 7,967,926 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 7,956,058 - 7,979,602 NCBI Celera 1 7,128,771 - 7,152,398 (+) NCBI Celera Cytogenetic Map 1 p36.23 NCBI HuRef 1 7,169,316 - 7,193,163 (+) NCBI HuRef CHM1_1 1 8,009,469 - 8,033,097 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 7,492,675 - 7,516,444 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
PARK7 Human (-)-epigallocatechin 3-gallate decreases expression ISO Park7 (Mus musculus) 6480464 epigallocatechin gallate results in decreased expression of PARK7 mRNA CTD PMID:25585349 PARK7 Human (1->4)-beta-D-glucan multiple interactions ISO Park7 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PARK7 mRNA CTD PMID:36331819 PARK7 Human (R,R,R)-alpha-tocopherol multiple interactions EXP 6480464 alpha-Tocopherol inhibits the reaction [Rotenone affects the localization of PARK7 protein] CTD PMID:16439141 PARK7 Human (S)-nicotine multiple interactions ISO Park7 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 PARK7 Human 1,2-dimethylhydrazine multiple interactions ISO Park7 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PARK7 mRNA CTD PMID:22206623 PARK7 Human 1-bromopropane decreases expression ISO Park7 (Rattus norvegicus) 6480464 1-bromopropane results in decreased expression of PARK7 protein CTD PMID:21925529 PARK7 Human 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases response to substance ISO Park7 (Mus musculus) 6480464 PARK7 protein results in decreased susceptibility to 1-Methyl-4-phenyl-1 more ... CTD PMID:15784737 PARK7 Human 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Park7 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 and PMID:22511790 PARK7 Human 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine increases expression ISO Park7 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 PARK7 Human 15-deoxy-Delta(12,14)-prostaglandin J2 multiple interactions ISO Park7 (Rattus norvegicus) 6480464 15-deoxy-delta(12 more ... CTD PMID:22245093 PARK7 Human 17beta-estradiol decreases expression ISO Park7 (Mus musculus) 6480464 Estradiol results in decreased expression of PARK7 mRNA CTD PMID:39298647 PARK7 Human 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression EXP 6480464 Metribolone results in increased expression of PARK7 protein CTD PMID:17152098 PARK7 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Park7 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PARK7 mRNA CTD PMID:21570461 PARK7 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Park7 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PARK7 mRNA CTD PMID:32109520 and PMID:34747641 PARK7 Human 2,6-dimethoxyphenol multiple interactions EXP 6480464 [pyrogallol 1 more ... CTD PMID:38598786 PARK7 Human 2-amino-14,16-dimethyloctadecan-3-ol decreases expression EXP 6480464 2-amino-14 and 16-dimethyloctadecan-3-ol results in decreased expression of PARK7 protein CTD PMID:32044396 PARK7 Human 3-chloropropane-1,2-diol increases expression ISO Park7 (Rattus norvegicus) 6480464 alpha-Chlorohydrin analog results in increased expression of PARK7 protein and alpha-Chlorohydrin results in increased expression of PARK7 protein CTD PMID:26072098 and PMID:26597043 PARK7 Human 3-chloropropane-1,2-diol increases oxidation ISO Park7 (Mus musculus) 6480464 alpha-Chlorohydrin results in increased oxidation of PARK7 protein CTD PMID:31712104 PARK7 Human 3-chloropropane-1,2-diol affects expression ISO Park7 (Rattus norvegicus) 6480464 alpha-Chlorohydrin affects the expression of PARK7 protein CTD PMID:26072098 PARK7 Human 4,4'-sulfonyldiphenol increases expression ISO Park7 (Mus musculus) 6480464 bisphenol S results in increased expression of PARK7 mRNA CTD PMID:39298647 PARK7 Human 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of PARK7 protein CTD PMID:34186270 PARK7 Human 4-phenylbutyric acid increases expression ISO Park7 (Rattus norvegicus) 6480464 4-phenylbutyric acid results in increased expression of PARK7 protein CTD PMID:21372141 PARK7 Human 4-phenylbutyric acid multiple interactions EXP 6480464 4-phenylbutyric acid inhibits the reaction [Rotenone results in increased expression of PARK7 protein] CTD PMID:17459145 PARK7 Human 4-phenylbutyric acid multiple interactions ISO Park7 (Mus musculus) 6480464 4-phenylbutyric acid inhibits the reaction [Rotenone results in increased expression of PARK7 protein] CTD PMID:17459145 PARK7 Human 4-phenylbutyric acid increases expression EXP 6480464 4-phenylbutyric acid results in increased expression of PARK7 mRNA and 4-phenylbutyric acid results in increased expression of PARK7 protein CTD PMID:21372141 PARK7 Human 4-phenylbutyric acid increases expression ISO Park7 (Mus musculus) 6480464 4-phenylbutyric acid results in increased expression of PARK7 protein CTD PMID:21372141 PARK7 Human 4-phenylbutyric acid multiple interactions ISO Park7 (Rattus norvegicus) 6480464 [4-phenylbutyric acid results in increased expression of PARK7 protein] which results in decreased susceptibility to Hydrogen Peroxide and [4-phenylbutyric acid results in increased expression of PARK7 protein] which results in decreased susceptibility to Oxidopamine CTD PMID:21372141 PARK7 Human 6-propyl-2-thiouracil decreases expression ISO Park7 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of PARK7 mRNA CTD PMID:24780913 PARK7 Human amiodarone increases expression ISO Park7 (Mus musculus) 6480464 Amiodarone results in increased expression of PARK7 mRNA CTD PMID:24489787 PARK7 Human ammonium chloride affects expression ISO Park7 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of PARK7 mRNA CTD PMID:16483693 PARK7 Human amphetamine affects response to substance ISO Park7 (Mus musculus) 6480464 PARK7 protein affects the susceptibility to Amphetamine CTD PMID:15784737 PARK7 Human arsane multiple interactions EXP 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of PARK7 mRNA and [Copper co-treated with [arsenic trichloride results in increased abundance of Arsenic]] results in decreased expression of PARK7 mRNA CTD PMID:35809665 PARK7 Human arsenic atom multiple interactions EXP 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of PARK7 mRNA and [Copper co-treated with [arsenic trichloride results in increased abundance of Arsenic]] results in decreased expression of PARK7 mRNA CTD PMID:35809665 PARK7 Human arsenic trichloride multiple interactions EXP 6480464 [arsenic trichloride results in increased abundance of Arsenic] which results in decreased expression of PARK7 mRNA and [Copper co-treated with [arsenic trichloride results in increased abundance of Arsenic]] results in decreased expression of PARK7 mRNA CTD PMID:35809665 PARK7 Human arsenite(3-) increases expression ISO Park7 (Mus musculus) 6480464 arsenite results in increased expression of PARK7 protein CTD PMID:37955338 PARK7 Human arsenite(3-) multiple interactions EXP 6480464 arsenite promotes the reaction [G3BP1 protein binds to PARK7 mRNA] CTD PMID:32406909 PARK7 Human astemizole increases expression ISO Park7 (Rattus norvegicus) 6480464 Astemizole results in increased expression of PARK7 mRNA CTD PMID:20221588 PARK7 Human benomyl decreases activity EXP 6480464 Benomyl results in decreased activity of PARK7 protein CTD PMID:36842454 PARK7 Human benzene decreases expression EXP 6480464 Benzene results in decreased expression of PARK7 mRNA CTD PMID:16188089 PARK7 Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of PARK7 5' UTR CTD PMID:27901495 PARK7 Human benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of PARK7 mRNA CTD PMID:34332006 PARK7 Human beta-lapachone decreases expression EXP 6480464 beta-lapachone results in decreased expression of PARK7 mRNA CTD PMID:38218311 PARK7 Human bis(2-ethylhexyl) phthalate increases expression ISO Park7 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PARK7 mRNA CTD PMID:33754040 PARK7 Human bisphenol A affects localization ISO Park7 (Mus musculus) 6480464 bisphenol A affects the localization of PARK7 protein CTD PMID:23037695 PARK7 Human bisphenol A decreases expression ISO Park7 (Mus musculus) 6480464 bisphenol A results in decreased expression of PARK7 mRNA CTD PMID:35598803 PARK7 Human bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PARK7 gene CTD PMID:31601247 PARK7 Human bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PARK7 protein CTD PMID:33670352 and PMID:37567409 PARK7 Human bisphenol A decreases expression ISO Park7 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of PARK7 mRNA CTD PMID:33296240 PARK7 Human bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PARK7 mRNA CTD PMID:30903817 PARK7 Human bisphenol A multiple interactions EXP 6480464 bisphenol A promotes the reaction [PARK7 protein binds to ESR1 protein] CTD PMID:27156127 PARK7 Human bisphenol A increases expression ISO Park7 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of PARK7 mRNA CTD PMID:25181051 PARK7 Human bisphenol AF increases expression EXP 6480464 bisphenol AF results in increased expression of PARK7 protein CTD PMID:34186270 PARK7 Human bisphenol F decreases expression ISO Park7 (Mus musculus) 6480464 bisphenol F results in decreased expression of PARK7 mRNA CTD PMID:38685157 PARK7 Human bromobenzene affects binding ISO Park7 (Rattus norvegicus) 6480464 bromobenzene metabolite binds to PARK7 protein CTD PMID:17305373 PARK7 Human butyric acid increases expression EXP 6480464 Butyric Acid results in increased expression of PARK7 mRNA and Butyric Acid results in increased expression of PARK7 protein CTD PMID:21372141 PARK7 Human butyric acid increases expression ISO Park7 (Rattus norvegicus) 6480464 Butyric Acid results in increased expression of PARK7 protein CTD PMID:21372141 PARK7 Human butyric acid increases expression ISO Park7 (Mus musculus) 6480464 Butyric Acid results in increased expression of PARK7 protein CTD PMID:21372141 PARK7 Human cadmium atom multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PARK7 mRNA CTD PMID:35301059 PARK7 Human cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of PARK7 protein CTD PMID:24419708 PARK7 Human cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PARK7 mRNA CTD PMID:35301059 PARK7 Human cannabidiol multiple interactions EXP 6480464 [Cuprizone co-treated with Cannabidiol] results in decreased expression of PARK7 protein CTD PMID:34122009 PARK7 Human captan decreases activity EXP 6480464 Captan results in decreased activity of PARK7 protein CTD PMID:36842454 PARK7 Human CCCP multiple interactions ISO Park7 (Mus musculus) 6480464 PARK7 gene mutant form promotes the reaction [Carbonyl Cyanide m-Chlorophenyl Hydrazone affects the localization of PRKN protein] CTD PMID:22872702 PARK7 Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to PARK7 gene] CTD PMID:28238834 PARK7 Human chlorpyrifos increases expression ISO Park7 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of PARK7 mRNA CTD PMID:29156651 PARK7 Human chlorpyrifos decreases expression ISO Park7 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of PARK7 mRNA CTD PMID:37019170 PARK7 Human chromium trinitrate increases expression ISO Park7 (Mus musculus) 6480464 chromium nitrate results in increased expression of PARK7 protein CTD PMID:22144121 PARK7 Human chromium(6+) affects expression ISO Park7 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of PARK7 mRNA CTD PMID:28472532 PARK7 Human cisplatin multiple interactions ISO Park7 (Mus musculus) 6480464 [Cisplatin co-treated with Lutein] results in decreased expression of PARK7 mRNA more ... CTD PMID:24865317 and PMID:36965608 PARK7 Human cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of PARK7 protein CTD PMID:25450742 PARK7 Human cisplatin decreases expression ISO Park7 (Mus musculus) 6480464 Cisplatin results in decreased expression of PARK7 mRNA and Cisplatin results in decreased expression of PARK7 protein CTD PMID:21151649 more ... PARK7 Human clozapine increases expression ISO Park7 (Mus musculus) 6480464 Clozapine results in increased expression of PARK7 mRNA CTD PMID:14647396 PARK7 Human cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of PARK7 mRNA CTD PMID:19376846 PARK7 Human copper atom affects binding EXP 6480464 Copper binds to PARK7 protein CTD PMID:23792957 PARK7 Human copper atom multiple interactions EXP 6480464 [Copper co-treated with [arsenic trichloride results in increased abundance of Arsenic]] results in decreased expression of PARK7 mRNA CTD PMID:35809665 PARK7 Human copper(0) affects binding EXP 6480464 Copper binds to PARK7 protein CTD PMID:23792957 PARK7 Human copper(0) multiple interactions EXP 6480464 [Copper co-treated with [arsenic trichloride results in increased abundance of Arsenic]] results in decreased expression of PARK7 mRNA CTD PMID:35809665 PARK7 Human crocidolite asbestos affects expression EXP 6480464 Asbestos and Crocidolite affects the expression of PARK7 mRNA CTD PMID:17331233 PARK7 Human Cuprizon increases expression ISO Park7 (Rattus norvegicus) 6480464 Cuprizone results in increased expression of PARK7 mRNA CTD PMID:27523638 PARK7 Human Cuprizon multiple interactions EXP 6480464 [Cuprizone co-treated with Cannabidiol] results in decreased expression of PARK7 protein CTD PMID:34122009 PARK7 Human DDE decreases activity EXP 6480464 Dichlorodiphenyl Dichloroethylene results in decreased activity of PARK7 protein CTD PMID:36842454 PARK7 Human dexamethasone decreases expression ISO Park7 (Mus musculus) 6480464 Dexamethasone results in decreased expression of PARK7 protein CTD PMID:33567340 PARK7 Human diazinon decreases expression ISO Park7 (Rattus norvegicus) 6480464 Diazinon results in decreased expression of PARK7 mRNA CTD PMID:21968025 PARK7 Human diazinon decreases activity EXP 6480464 Diazinon results in decreased activity of PARK7 protein CTD PMID:36842454 PARK7 Human dibenziodolium multiple interactions ISO Park7 (Mus musculus) 6480464 diphenyleneiodonium inhibits the reaction [Lipopolysaccharides results in increased expression of PARK7 protein] CTD PMID:11811539 PARK7 Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of PARK7 mRNA CTD PMID:37042841 PARK7 Human dibutyl phthalate decreases expression ISO Park7 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of PARK7 mRNA CTD PMID:21266533 PARK7 Human dicrotophos decreases expression EXP 6480464 dicrotophos results in decreased expression of PARK7 mRNA CTD PMID:28302478 PARK7 Human Dienochlor decreases activity EXP 6480464 dienochlor results in decreased activity of PARK7 protein CTD PMID:36842454 PARK7 Human disodium selenite increases expression EXP 6480464 Sodium Selenite results in increased expression of PARK7 mRNA CTD PMID:18175754 PARK7 Human dithianon multiple interactions EXP 6480464 dithianone results in decreased activity of and results in increased oxidation of PARK7 protein CTD PMID:36842454 PARK7 Human diuron decreases expression EXP 6480464 Diuron results in decreased expression of PARK7 mRNA CTD PMID:35967413 PARK7 Human doxorubicin decreases response to substance EXP 6480464 PARK7 protein results in decreased susceptibility to Doxorubicin CTD PMID:24675091 PARK7 Human enzyme inhibitor multiple interactions EXP 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of PARK7 protein CTD PMID:23301498 PARK7 Human fenazaquin increases response to substance ISO Park7 (Mus musculus) 6480464 PARK7 mutant form results in increased susceptibility to fenazaquin CTD PMID:21219333 PARK7 Human fenpyroximate decreases response to substance ISO Park7 (Mus musculus) 6480464 PARK7 protein results in decreased susceptibility to fenpyroximate CTD PMID:21219333 PARK7 Human flavonoids decreases expression ISO Park7 (Rattus norvegicus) 6480464 Flavonoids results in decreased expression of PARK7 mRNA CTD PMID:18035473 PARK7 Human folic acid multiple interactions ISO Park7 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PARK7 mRNA CTD PMID:22206623 PARK7 Human folpet decreases activity EXP 6480464 folpet results in decreased activity of PARK7 protein CTD PMID:36842454 PARK7 Human formetanate decreases activity EXP 6480464 formetanate results in decreased activity of PARK7 protein CTD PMID:36842454 PARK7 Human furfural multiple interactions EXP 6480464 [pyrogallol 1 more ... CTD PMID:38598786 PARK7 Human gamma-hexachlorocyclohexane decreases activity EXP 6480464 Hexachlorocyclohexane results in decreased activity of PARK7 protein CTD PMID:36842454 PARK7 Human Garcinol multiple interactions EXP 6480464 garcinol inhibits the reaction [1-Methyl-4-phenylpyridinium results in decreased expression of PARK7 protein] CTD PMID:36629037 PARK7 Human glutathione increases abundance EXP 6480464 PARK7 protein results in increased abundance of Glutathione CTD PMID:18331584 PARK7 Human glyphosate increases expression ISO Park7 (Mus musculus) 6480464 Glyphosate results in increased expression of PARK7 protein CTD PMID:36173347 PARK7 Human haloperidol increases expression ISO Park7 (Mus musculus) 6480464 Haloperidol results in increased expression of PARK7 mRNA CTD PMID:14647396 PARK7 Human heparin increases expression ISO Park7 (Rattus norvegicus) 6480464 Heparin results in increased expression of PARK7 protein CTD PMID:17488504 PARK7 Human hydralazine multiple interactions EXP 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of PARK7 mRNA CTD PMID:17183730 PARK7 Human hydrogen peroxide increases expression EXP 6480464 Hydrogen Peroxide results in increased expression of PARK7 protein CTD PMID:11811539 PARK7 Human hydrogen peroxide affects metabolic processing ISO Park7 (Mus musculus) 6480464 PARK7 protein affects the metabolism of Hydrogen Peroxide CTD PMID:24936441 PARK7 Human hydrogen peroxide multiple interactions ISO Park7 (Mus musculus) 6480464 PRKN gene mutant form inhibits the reaction [Hydrogen Peroxide affects the localization of PARK7 protein] CTD PMID:22872702 PARK7 Human hydrogen peroxide affects localization ISO Park7 (Mus musculus) 6480464 Hydrogen Peroxide affects the localization of PARK7 protein CTD PMID:22872702 PARK7 Human hydrogen peroxide multiple interactions ISO Park7 (Rattus norvegicus) 6480464 [4-phenylbutyric acid results in increased expression of PARK7 protein] which results in decreased susceptibility to Hydrogen Peroxide CTD PMID:21372141 PARK7 Human hydrogen peroxide decreases response to substance EXP 6480464 PARK7 protein results in decreased susceptibility to Hydrogen Peroxide CTD PMID:18377993 PARK7 Human inulin multiple interactions ISO Park7 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of PARK7 mRNA CTD PMID:36331819 PARK7 Human isoniazide affects expression ISO Park7 (Mus musculus) 6480464 Isoniazid affects the expression of PARK7 mRNA CTD PMID:24848797 PARK7 Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of PARK7 protein CTD PMID:32959892 PARK7 Human lactacystin decreases response to substance EXP 6480464 PARK7 protein results in decreased susceptibility to lactacystin CTD PMID:18331584 PARK7 Human lipopolysaccharide multiple interactions ISO Park7 (Mus musculus) 6480464 diphenyleneiodonium inhibits the reaction [Lipopolysaccharides results in increased expression of PARK7 protein] more ... CTD PMID:11811539 and PMID:26691871 PARK7 Human lipopolysaccharide increases expression ISO Park7 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of PARK7 protein CTD PMID:11811539 PARK7 Human lipopolysaccharide affects localization ISO Park7 (Mus musculus) 6480464 Lipopolysaccharides affects the localization of PARK7 protein CTD PMID:19063952 PARK7 Human lutein multiple interactions ISO Park7 (Mus musculus) 6480464 [Cisplatin co-treated with Lutein] results in decreased expression of PARK7 mRNA CTD PMID:24865317 PARK7 Human LY294002 multiple interactions ISO Park7 (Rattus norvegicus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [manganese chloride results in decreased expression of PARK7 protein] CTD PMID:22245093 PARK7 Human mancozeb multiple interactions EXP 6480464 mancozeb results in decreased activity of and results in increased oxidation of PARK7 protein CTD PMID:36842454 PARK7 Human maneb decreases activity EXP 6480464 Maneb results in decreased activity of PARK7 protein CTD PMID:36842454 PARK7 Human maneb multiple interactions EXP 6480464 3-(4-(morpholin-4-yl)-7H-pyrrolo(2 more ... CTD PMID:34897981 and PMID:36842454 PARK7 Human manganese atom decreases expression ISO Park7 (Rattus norvegicus) 6480464 Manganese results in decreased expression of PARK7 protein CTD PMID:20798247 PARK7 Human manganese(0) decreases expression ISO Park7 (Rattus norvegicus) 6480464 Manganese results in decreased expression of PARK7 protein CTD PMID:20798247 PARK7 Human manganese(II) chloride multiple interactions ISO Park7 (Rattus norvegicus) 6480464 15-deoxy-delta(12 more ... CTD PMID:22245093 PARK7 Human manganese(II) chloride decreases expression ISO Park7 (Rattus norvegicus) 6480464 manganese chloride results in decreased expression of PARK7 mRNA and manganese chloride results in decreased expression of PARK7 protein CTD PMID:20798247 and PMID:22245093 PARK7 Human meloxicam multiple interactions EXP 6480464 meloxicam inhibits the reaction [Paraquat promotes the reaction [Quinones binds to PARK7 protein]] CTD PMID:20851755 PARK7 Human mercury atom increases expression EXP 6480464 Mercury results in increased expression of PARK7 mRNA CTD PMID:16823088 PARK7 Human mercury atom affects binding EXP 6480464 Mercury binds to PARK7 protein CTD PMID:23792957 PARK7 Human mercury(0) increases expression EXP 6480464 Mercury results in increased expression of PARK7 mRNA CTD PMID:16823088 PARK7 Human mercury(0) affects binding EXP 6480464 Mercury binds to PARK7 protein CTD PMID:23792957 PARK7 Human N,N-diethyl-m-toluamide multiple interactions ISO Park7 (Rattus norvegicus) 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of PARK7 mRNA CTD PMID:28659758 PARK7 Human N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [3-(2-hydroxy-4-(1 more ... CTD PMID:18377993 more ... PARK7 Human N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO Park7 (Rattus norvegicus) 6480464 PARK7 protein affects the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of HSPA1A protein] CTD PMID:18331584 PARK7 Human N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions EXP 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [Paraquat results in increased sulfation of and results in increased oxidation of PARK7 protein] CTD PMID:26409479 PARK7 Human N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal decreases response to substance EXP 6480464 PARK7 protein results in decreased susceptibility to benzyloxycarbonylleucyl-leucyl-leucine aldehyde CTD PMID:18331584 PARK7 Human N-methyl-4-phenylpyridinium increases expression ISO Park7 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of PARK7 mRNA CTD PMID:26558463 PARK7 Human N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of PARK7 protein CTD PMID:36629037 PARK7 Human N-methyl-4-phenylpyridinium multiple interactions EXP 6480464 garcinol inhibits the reaction [1-Methyl-4-phenylpyridinium results in decreased expression of PARK7 protein] CTD PMID:36629037 PARK7 Human N-nitrosomorpholine decreases expression ISO Park7 (Rattus norvegicus) 6480464 N-nitrosomorpholine results in decreased expression of PARK7 protein CTD PMID:19716841 PARK7 Human nicotine multiple interactions ISO Park7 (Mus musculus) 6480464 [Nicotine co-treated with 1-Methyl-4-phenyl-1 more ... CTD PMID:20230807 PARK7 Human nitrates multiple interactions ISO Park7 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PARK7 mRNA CTD PMID:35964746 PARK7 Human ouabain affects response to substance ISO Park7 (Mus musculus) 6480464 PARK7 affects the susceptibility to Ouabain CTD PMID:16624565 PARK7 Human oxamyl decreases activity EXP 6480464 oxamyl results in decreased activity of PARK7 protein CTD PMID:36842454 PARK7 Human oxidopamine increases expression ISO Park7 (Rattus norvegicus) 6480464 Oxidopamine results in increased expression of PARK7 mRNA CTD PMID:25129099 PARK7 Human oxidopamine increases expression EXP 6480464 Oxidopamine results in increased expression of PARK7 mRNA and Oxidopamine results in increased expression of PARK7 protein CTD PMID:18377993 PARK7 Human oxidopamine affects localization EXP 6480464 Oxidopamine affects the localization of PARK7 protein CTD PMID:18377993 PARK7 Human oxidopamine multiple interactions EXP 6480464 Oxidopamine promotes the reaction [Quinones binds to PARK7 protein] CTD PMID:20851755 PARK7 Human oxidopamine decreases response to substance EXP 6480464 PARK7 protein results in decreased susceptibility to Oxidopamine CTD PMID:18377993 PARK7 Human oxidopamine multiple interactions ISO Park7 (Rattus norvegicus) 6480464 [4-phenylbutyric acid results in increased expression of PARK7 protein] which results in decreased susceptibility to Oxidopamine more ... CTD PMID:21372141 and PMID:25129099 PARK7 Human p-menthan-3-ol decreases expression EXP 6480464 Menthol results in decreased expression of PARK7 protein CTD PMID:26760959 PARK7 Human paracetamol affects expression ISO Park7 (Mus musculus) 6480464 Acetaminophen affects the expression of PARK7 mRNA CTD PMID:17562736 PARK7 Human paracetamol increases secretion ISO Park7 (Mus musculus) 6480464 Acetaminophen results in increased secretion of PARK7 protein CTD PMID:24038040 PARK7 Human paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PARK7 mRNA CTD PMID:25704631 PARK7 Human paraquat increases expression EXP 6480464 Paraquat results in increased expression of PARK7 protein and Paraquat results in increased expression of PARK7 protein alternative form CTD PMID:11697128 more ... PARK7 Human paraquat decreases expression ISO Park7 (Mus musculus) 6480464 Paraquat results in decreased expression of PARK7 mRNA CTD PMID:36108500 PARK7 Human paraquat decreases activity EXP 6480464 Paraquat results in decreased activity of PARK7 protein CTD PMID:36842454 PARK7 Human paraquat increases response to substance ISO Park7 (Mus musculus) 6480464 PARK7 protein results in increased susceptibility to Paraquat CTD PMID:21300143 PARK7 Human paraquat multiple interactions EXP 6480464 3-(4-(morpholin-4-yl)-7H-pyrrolo(2 more ... CTD PMID:20851755 more ... PARK7 Human paraquat multiple interactions ISO Park7 (Mus musculus) 6480464 PARK7 gene mutant form affects the reaction [Paraquat affects the expression of NFE2L2 protein] more ... CTD PMID:17823202 and PMID:21300143 PARK7 Human perfluorododecanoic acid decreases expression ISO Park7 (Rattus norvegicus) 6480464 perfluorododecanoic acid results in decreased expression of PARK7 protein CTD PMID:19854247 PARK7 Human perfluorooctane-1-sulfonic acid multiple interactions ISO Park7 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PARK7 mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of PARK7 mRNA CTD PMID:36331819 PARK7 Human permethrin multiple interactions ISO Park7 (Rattus norvegicus) 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of PARK7 mRNA CTD PMID:28659758 PARK7 Human phlorizin increases expression ISO Park7 (Mus musculus) 6480464 Phlorhizin results in increased expression of PARK7 mRNA CTD PMID:22538082 PARK7 Human pirimiphos-methyl decreases activity EXP 6480464 pirimiphos methyl results in decreased activity of PARK7 protein CTD PMID:36842454 PARK7 Human potassium chromate increases expression ISO Park7 (Mus musculus) 6480464 potassium chromate(VI) results in increased expression of PARK7 protein CTD PMID:22144121 PARK7 Human propineb decreases activity EXP 6480464 propineb results in decreased activity of PARK7 protein CTD PMID:36842454 PARK7 Human prostaglandin E2 multiple interactions ISO Park7 (Mus musculus) 6480464 PARK7 gene mutant form inhibits the reaction [Lipopolysaccharides results in increased secretion of Dinoprostone] and SB 203580 promotes the reaction [PARK7 gene mutant form inhibits the reaction [Lipopolysaccharides results in increased secretion of Dinoprostone]] CTD PMID:26691871 PARK7 Human pyridaben decreases response to substance ISO Park7 (Mus musculus) 6480464 PARK7 protein results in decreased susceptibility to pyridaben CTD PMID:21219333 PARK7 Human Pyridostigmine bromide multiple interactions ISO Park7 (Rattus norvegicus) 6480464 [Pyridostigmine Bromide co-treated with DEET co-treated with Permethrin] results in increased expression of PARK7 mRNA CTD PMID:28659758 PARK7 Human pyrimidifen increases expression EXP 6480464 pyrimidifen results in increased expression of PARK7 mRNA CTD PMID:33512557 PARK7 Human quercetin multiple interactions ISO Park7 (Rattus norvegicus) 6480464 Quercetin inhibits the reaction [aluminum lactate results in decreased expression of PARK7 protein] CTD PMID:26493151 PARK7 Human quercetin 3-O-beta-D-glucofuranoside multiple interactions ISO Park7 (Rattus norvegicus) 6480464 isoquercitrin inhibits the reaction [Oxidopamine results in increased expression of PARK7 mRNA] CTD PMID:25129099 PARK7 Human quercetin 3-O-beta-D-glucopyranoside multiple interactions ISO Park7 (Rattus norvegicus) 6480464 isoquercitrin inhibits the reaction [Oxidopamine results in increased expression of PARK7 mRNA] CTD PMID:25129099 PARK7 Human raloxifene increases expression ISO Park7 (Mus musculus) 6480464 Raloxifene Hydrochloride results in increased expression of PARK7 mRNA CTD PMID:33269387 PARK7 Human resmethrin decreases activity EXP 6480464 resmethrin results in decreased activity of PARK7 protein CTD PMID:36842454 PARK7 Human rotenone multiple interactions EXP 6480464 4-phenylbutyric acid inhibits the reaction [Rotenone results in increased expression of PARK7 protein] more ... CTD PMID:16439141 more ... PARK7 Human rotenone multiple interactions ISO Park7 (Rattus norvegicus) 6480464 Bibenzyls inhibits the reaction [Rotenone results in decreased expression of PARK7 protein] more ... CTD PMID:28245986 PARK7 Human rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of PARK7 protein CTD PMID:28245986 PARK7 Human rotenone decreases expression ISO Park7 (Rattus norvegicus) 6480464 Rotenone results in decreased expression of PARK7 mRNA and Rotenone results in decreased expression of PARK7 protein CTD PMID:28245986 and PMID:32392329 PARK7 Human rotenone increases response to substance ISO Park7 (Mus musculus) 6480464 PARK7 mutant form results in increased susceptibility to Rotenone CTD PMID:21219333 PARK7 Human rotenone decreases response to substance ISO Park7 (Rattus norvegicus) 6480464 PARK7 protein results in decreased susceptibility to Rotenone CTD PMID:22898350 PARK7 Human rotenone affects response to substance EXP 6480464 PARK7 protein affects the susceptibility to Rotenone CTD PMID:20940149 and PMID:26739068 PARK7 Human rotenone increases expression EXP 6480464 Rotenone results in increased expression of PARK7 mRNA and Rotenone results in increased expression of PARK7 protein CTD PMID:17459145 more ... PARK7 Human rotenone decreases response to substance EXP 6480464 PARK7 protein results in decreased susceptibility to Rotenone CTD PMID:18331584 more ... PARK7 Human rotenone increases oxidation ISO Park7 (Rattus norvegicus) 6480464 Rotenone results in increased oxidation of PARK7 protein CTD PMID:16439141 PARK7 Human rotenone increases expression ISO Park7 (Mus musculus) 6480464 Rotenone results in increased expression of PARK7 mRNA and Rotenone results in increased expression of PARK7 protein CTD PMID:17459145 and PMID:26806867 PARK7 Human rotenone affects localization ISO Park7 (Rattus norvegicus) 6480464 Rotenone affects the localization of PARK7 protein CTD PMID:16439141 PARK7 Human rotenone affects localization ISO Park7 (Mus musculus) 6480464 Rotenone affects the localization of PARK7 protein CTD PMID:19063952 PARK7 Human rotenone decreases response to substance ISO Park7 (Mus musculus) 6480464 PARK7 protein results in decreased susceptibility to Rotenone CTD PMID:18930142 PARK7 Human rotenone affects response to substance ISO Park7 (Mus musculus) 6480464 PARK7 affects the susceptibility to Rotenone CTD PMID:16624565 PARK7 Human rotenone multiple interactions ISO Park7 (Mus musculus) 6480464 4-phenylbutyric acid inhibits the reaction [Rotenone results in increased expression of PARK7 protein] CTD PMID:17459145 PARK7 Human rotenone affects localization EXP 6480464 Rotenone affects the localization of PARK7 protein CTD PMID:16439141 more ... PARK7 Human rutin multiple interactions ISO Park7 (Rattus norvegicus) 6480464 Rutin inhibits the reaction [Oxidopamine results in increased expression of PARK7 mRNA] CTD PMID:25129099 PARK7 Human sarin decreases expression EXP 6480464 Sarin results in decreased expression of PARK7 mRNA CTD PMID:19522546 PARK7 Human sarin decreases expression ISO Park7 (Rattus norvegicus) 6480464 Sarin results in decreased expression of PARK7 protein CTD PMID:28973502 PARK7 Human SB 203580 multiple interactions ISO Park7 (Mus musculus) 6480464 SB 203580 promotes the reaction [PARK7 gene mutant form inhibits the reaction [Lipopolysaccharides results in increased secretion of Dinoprostone]] and SB 203580 promotes the reaction [PARK7 gene mutant form inhibits the reaction [Lipopolysaccharides results in increased secretion of TNF protein]] CTD PMID:26691871 PARK7 Human silver atom increases expression ISO Park7 (Mus musculus) 6480464 Silver results in increased expression of PARK7 mRNA CTD PMID:19429238 PARK7 Human silver(0) increases expression ISO Park7 (Mus musculus) 6480464 Silver results in increased expression of PARK7 mRNA CTD PMID:19429238 PARK7 Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of PARK7 mRNA CTD PMID:38568856 PARK7 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of PARK7 mRNA CTD PMID:34032870 PARK7 Human sodium chloride multiple interactions EXP 6480464 [Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of PARK7 protein more ... CTD PMID:38598786 PARK7 Human superoxide multiple interactions ISO Park7 (Mus musculus) 6480464 PARK7 protein affects the reaction [Paraquat results in increased abundance of Superoxides] CTD PMID:21300143 PARK7 Human T-2 toxin affects expression ISO Park7 (Rattus norvegicus) 6480464 T-2 Toxin affects the expression of PARK7 protein CTD PMID:26141394 PARK7 Human tetrachloromethane decreases expression ISO Park7 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of PARK7 mRNA CTD PMID:31150632 PARK7 Human thapsigargin increases expression ISO Park7 (Rattus norvegicus) 6480464 Thapsigargin results in increased expression of PARK7 protein CTD PMID:35544339 PARK7 Human thioacetamide decreases expression ISO Park7 (Rattus norvegicus) 6480464 Thioacetamide results in decreased expression of PARK7 mRNA CTD PMID:34492290 PARK7 Human thiram decreases expression EXP 6480464 Thiram results in decreased expression of PARK7 mRNA CTD PMID:38568856 PARK7 Human thiram decreases activity EXP 6480464 Thiram results in decreased activity of PARK7 protein CTD PMID:36842454 PARK7 Human toluene affects expression ISO Park7 (Rattus norvegicus) 6480464 Toluene affects the expression of PARK7 mRNA CTD PMID:21827849 PARK7 Human trans-piceid multiple interactions EXP 6480464 [PRKN protein affects the susceptibility to polydatin] which results in increased expression of PARK7 protein and polydatin inhibits the reaction [Rotenone results in increased expression of PARK7 protein] CTD PMID:31926197 PARK7 Human Tri-allate decreases activity EXP 6480464 Triallate results in decreased activity of PARK7 protein CTD PMID:36842454 PARK7 Human Tributyltin oxide decreases expression ISO Park7 (Mus musculus) 6480464 bis(tri-n-butyltin)oxide results in decreased expression of PARK7 mRNA CTD PMID:22434021 PARK7 Human tungsten increases expression ISO Park7 (Mus musculus) 6480464 Tungsten results in increased expression of PARK7 mRNA CTD PMID:30912803 PARK7 Human valproic acid multiple interactions EXP 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of PARK7 mRNA CTD PMID:17183730 PARK7 Human valproic acid affects expression ISO Park7 (Mus musculus) 6480464 Valproic Acid affects the expression of PARK7 mRNA CTD PMID:17292431 PARK7 Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of PARK7 mRNA CTD PMID:25979313 PARK7 Human vinclozolin decreases expression ISO Park7 (Rattus norvegicus) 6480464 vinclozolin results in decreased expression of PARK7 mRNA CTD PMID:23034163 PARK7 Human vorinostat decreases expression EXP 6480464 vorinostat results in decreased expression of PARK7 protein CTD PMID:20543569 PARK7 Human zineb decreases activity EXP 6480464 Zineb results in decreased activity of PARK7 protein CTD PMID:36842454 PARK7 Human ziram decreases activity EXP 6480464 Ziram results in decreased activity of PARK7 protein CTD PMID:36842454
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) (R,R,R)-alpha-tocopherol (EXP) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 1-bromopropane (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 15-deoxy-Delta(12,14)-prostaglandin J2 (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,6-dimethoxyphenol (EXP) 2-amino-14,16-dimethyloctadecan-3-ol (EXP) 3-chloropropane-1,2-diol (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-phenylbutyric acid (EXP,ISO) 6-propyl-2-thiouracil (ISO) amiodarone (ISO) ammonium chloride (ISO) amphetamine (ISO) arsane (EXP) arsenic atom (EXP) arsenic trichloride (EXP) arsenite(3-) (EXP,ISO) astemizole (ISO) benomyl (EXP) benzene (EXP) benzo[a]pyrene (EXP) beta-lapachone (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (EXP) bisphenol F (ISO) bromobenzene (ISO) butyric acid (EXP,ISO) cadmium atom (EXP) cadmium dichloride (EXP) cannabidiol (EXP) captan (EXP) CCCP (ISO) CGP 52608 (EXP) chlorpyrifos (ISO) chromium trinitrate (ISO) chromium(6+) (ISO) cisplatin (EXP,ISO) clozapine (ISO) cobalt dichloride (EXP) copper atom (EXP) copper(0) (EXP) crocidolite asbestos (EXP) Cuprizon (EXP,ISO) DDE (EXP) dexamethasone (ISO) diazinon (EXP,ISO) dibenziodolium (ISO) Dibutyl phosphate (EXP) dibutyl phthalate (ISO) dicrotophos (EXP) Dienochlor (EXP) disodium selenite (EXP) dithianon (EXP) diuron (EXP) doxorubicin (EXP) enzyme inhibitor (EXP) fenazaquin (ISO) fenpyroximate (ISO) flavonoids (ISO) folic acid (ISO) folpet (EXP) formetanate (EXP) furfural (EXP) gamma-hexachlorocyclohexane (EXP) Garcinol (EXP) glutathione (EXP) glyphosate (ISO) haloperidol (ISO) heparin (ISO) hydralazine (EXP) hydrogen peroxide (EXP,ISO) inulin (ISO) isoniazide (ISO) ivermectin (EXP) lactacystin (EXP) lipopolysaccharide (ISO) lutein (ISO) LY294002 (ISO) mancozeb (EXP) maneb (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) meloxicam (EXP) mercury atom (EXP) mercury(0) (EXP) N,N-diethyl-m-toluamide (ISO) N-acetyl-L-cysteine (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (EXP,ISO) N-methyl-4-phenylpyridinium (EXP,ISO) N-nitrosomorpholine (ISO) nicotine (ISO) nitrates (ISO) ouabain (ISO) oxamyl (EXP) oxidopamine (EXP,ISO) p-menthan-3-ol (EXP) paracetamol (EXP,ISO) paraquat (EXP,ISO) perfluorododecanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) permethrin (ISO) phlorizin (ISO) pirimiphos-methyl (EXP) potassium chromate (ISO) propineb (EXP) prostaglandin E2 (ISO) pyridaben (ISO) Pyridostigmine bromide (ISO) pyrimidifen (EXP) quercetin (ISO) quercetin 3-O-beta-D-glucofuranoside (ISO) quercetin 3-O-beta-D-glucopyranoside (ISO) raloxifene (ISO) resmethrin (EXP) rotenone (EXP,ISO) rutin (ISO) sarin (EXP,ISO) SB 203580 (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (EXP) sodium chloride (EXP) superoxide (ISO) T-2 toxin (ISO) tetrachloromethane (ISO) thapsigargin (ISO) thioacetamide (ISO) thiram (EXP) toluene (ISO) trans-piceid (EXP) Tri-allate (EXP) Tributyltin oxide (ISO) tungsten (ISO) valproic acid (EXP,ISO) vinclozolin (ISO) vorinostat (EXP) zineb (EXP) ziram (EXP)
Biological Process
adult locomotory behavior (IEA) androgen receptor signaling pathway (IMP) autophagy (IEA) cellular detoxification of aldehyde (IDA) cellular detoxification of methylglyoxal (IDA) cellular oxidant detoxification (IEA) cellular response to glyoxal (IDA,IEA) cellular response to hydrogen peroxide (IMP) cellular response to hypoxia (ISO) cellular response to lipopolysaccharide (ISO) cellular response to oxidative stress (IDA,IEA,IMP) cellular response to reactive oxygen species (IEA) detection of oxidative stress (IEA) detoxification of copper ion (IEA,IMP) detoxification of hydrogen peroxide (IDA) detoxification of mercury ion (IEA) DNA damage response (IEA) DNA repair (IDA,IEA) dopamine uptake involved in synaptic transmission (IEA) glucose homeostasis (IEA,ISS) glycolate biosynthetic process (IBA,IDA,IEA) glyoxal catabolic process (IEA) glyoxal metabolic process (IBA,IDA,IEA) guanine deglycation (IDA) guanine deglycation, glyoxal removal (IDA) guanine deglycation, methylglyoxal removal (IDA) hydrogen peroxide metabolic process (IDA,IEA) inflammatory response (IEA) insulin secretion (IEA,ISS) lactate biosynthetic process (IDA) maternal process involved in female pregnancy (ISO) membrane depolarization (IEA) membrane hyperpolarization (IEA) methylglyoxal catabolic process to lactate (IDA) methylglyoxal metabolic process (IDA) mitochondrion organization (IEA,ISS) negative regulation of cellular process (ISO) negative regulation of death-inducing signaling complex assembly (IMP) negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway (IEA,IGI) negative regulation of extrinsic apoptotic signaling pathway (IMP) negative regulation of gene expression (IDA) negative regulation of hydrogen peroxide-induced neuron intrinsic apoptotic signaling pathway (IEA,IGI) negative regulation of intrinsic apoptotic signaling pathway in response to hydrogen peroxide (IDA,IEA) negative regulation of neuron apoptotic process (IDA) negative regulation of nitrosative stress-induced intrinsic apoptotic signaling pathway (IDA) negative regulation of NMDA glutamate receptor activity (ISO) negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway (IDA,IEA) negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway (IDA,IEA,IMP) negative regulation of proteasomal ubiquitin-dependent protein catabolic process (IDA) negative regulation of protein catabolic process (IEA) negative regulation of protein export from nucleus (IGI) negative regulation of protein K48-linked deubiquitination (IDA) negative regulation of protein sumoylation (IDA) negative regulation of protein ubiquitination (IDA,IEA) negative regulation of reactive oxygen species biosynthetic process (IEA,ISS) negative regulation of smooth muscle cell migration (ISO) negative regulation of TRAIL-activated apoptotic signaling pathway (IMP) negative regulation of vascular associated smooth muscle cell proliferation (ISO) positive regulation of acute inflammatory response to antigenic stimulus (IEA,ISS) positive regulation of autophagy of mitochondrion (NAS) positive regulation of dopamine biosynthetic process (IC,IDA) positive regulation of fertilization (ISO) positive regulation of gene expression (IEA,TAS) positive regulation of interleukin-8 production (IDA) positive regulation of L-dopa biosynthetic process (IMP) positive regulation of mitochondrial electron transport, NADH to ubiquinone (IEA,IMP) positive regulation of NAD(P)H oxidase activity (ISO) positive regulation of oxidative phosphorylation uncoupler activity (ISO) positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway (IEA) positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IMP) positive regulation of protein localization to nucleus (IDA,IMP) positive regulation of protein-containing complex assembly (IDA) positive regulation of reactive oxygen species biosynthetic process (IEA) positive regulation of reactive oxygen species metabolic process (IDA) positive regulation of transcription by RNA polymerase II (IDA,IEA,IGI,IMP) protein repair (IDA) protein stabilization (IDA,IEA,IMP) proteolysis (IEA) Ras protein signal transduction (TAS) regulation of androgen receptor signaling pathway (IDA) regulation of inflammatory response (IEA,ISS) regulation of mitochondrial membrane potential (IMP) regulation of neuron apoptotic process (IDA) regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway (IDA) regulation of supramolecular fiber organization (TAS) regulation of synaptic vesicle endocytosis (IEA) regulation of TRAIL production (IMP) removal of superoxide radicals (IDA) response to hydrogen peroxide (IEA) response to oxidative stress (IBA,IEA,ISO) response to xenobiotic stimulus (ISO) single fertilization (IEA) spermatogenesis (ISO) synaptic transmission, dopaminergic (IEA)
Cellular Component
adherens junction (HDA) axon (ISO,ISS) cell body (IEA) chromatin (IDA) cytoplasm (IBA,IDA,IEA) cytosol (IDA,IEA,IMP,TAS) endoplasmic reticulum (IDA,IEA) extracellular exosome (HDA) membrane (IEA) membrane raft (IEA) mitochondrial intermembrane space (IEA) mitochondrial matrix (IEA) mitochondrion (HTP,IBA,IDA,IEA,IMP) neuron projection (IEA) nucleoplasm (IDA,TAS) nucleus (HDA,IBA,IDA,IEA) perinuclear region of cytoplasm (IDA) plasma membrane (IEA) PML body (IDA) sperm head (ISO) synaptic vesicle (IEA)
1.
The Parkinson's disease gene DJ-1 is also a key regulator of stroke-induced damage.
Aleyasin H, etal., Proc Natl Acad Sci U S A. 2007 Nov 20;104(47):18748-53. doi: 10.1073/pnas.0709379104. Epub 2007 Nov 14.
2.
Neuroprotective function of DJ-1 in Parkinson's disease.
Ariga H, etal., Oxid Med Cell Longev. 2013;2013:683920. doi: 10.1155/2013/683920. Epub 2013 May 16.
3.
Phenotypic characterization of recessive gene knockout rat models of Parkinson's disease.
Dave KD, etal., Neurobiol Dis. 2014 Oct;70:190-203. doi: 10.1016/j.nbd.2014.06.009. Epub 2014 Jun 24.
4.
Up-regulation of caveolin-1 by DJ-1 attenuates rat pulmonary arterial hypertension by inhibiting TGFβ/Smad signaling pathway.
Gao W, etal., Exp Cell Res. 2017 Dec 1;361(1):192-198. doi: 10.1016/j.yexcr.2017.10.019. Epub 2017 Oct 22.
5.
GOAs Human GO annotations
GOA_HUMAN data from the GO Consortium
6.
Protection against dopaminergic neurodegeneration in Parkinson's disease-model animals by a modulator of the oxidized form of DJ-1, a wild-type of familial Parkinson's disease-linked PARK7.
Inden M, etal., J Pharmacol Sci. 2011;117(3):189-203. Epub 2011 Oct 29.
7.
PARK7 DJ-1 protects against degeneration of nigral dopaminergic neurons in Parkinson's disease rat model.
Inden M, etal., Neurobiol Dis. 2006 Oct;24(1):144-58. Epub 2006 Jul 24.
8.
L166P mutant DJ-1, causative for recessive Parkinson's disease, is degraded through the ubiquitin-proteasome system.
Miller DW, etal., J Biol Chem. 2003 Sep 19;278(38):36588-95. Epub 2003 Jul 8.
9.
DJ-1-binding compounds prevent oxidative stress-induced cell death and movement defect in Parkinson's disease model rats.
Miyazaki S, etal., J Neurochem. 2008 Jun 1;105(6):2418-34. doi: 10.1111/j.1471-4159.2008.05327.x.
10.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
11.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
RGD HPO Phenotype Annotation Pipeline
RGD automated import pipeline for human HPO-to-gene-to-disease annotations
15.
Rotenone-induced parkinsonism elicits behavioral impairments and differential expression of parkin, heat shock proteins and caspases in the rat.
Sonia Angeline M, etal., Neuroscience. 2012 Sep 18;220:291-301. doi: 10.1016/j.neuroscience.2012.06.021. Epub 2012 Jun 16.
16.
Regulation of dopamine presynaptic markers and receptors in the striatum of DJ-1 and Pink1 knockout rats.
Sun J, etal., Neurosci Lett. 2013 Dec 17;557 Pt B:123-8. doi: 10.1016/j.neulet.2013.10.034. Epub 2013 Oct 22.
17.
DJ-1 protects against neurodegeneration caused by focal cerebral ischemia and reperfusion in rats.
Yanagisawa D, etal., J Cereb Blood Flow Metab. 2008 Mar;28(3):563-78. doi: 10.1038/sj.jcbfm.9600553. Epub 2007 Sep 19.
PARK7 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 7,961,711 - 7,985,505 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 7,954,291 - 7,985,505 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 8,021,771 - 8,045,565 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 7,944,380 - 7,967,926 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 7,956,058 - 7,979,602 NCBI Celera 1 7,128,771 - 7,152,398 (+) NCBI Celera Cytogenetic Map 1 p36.23 NCBI HuRef 1 7,169,316 - 7,193,163 (+) NCBI HuRef CHM1_1 1 8,009,469 - 8,033,097 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 7,492,675 - 7,516,444 (+) NCBI T2T-CHM13v2.0
Park7 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 150,981,590 - 150,994,378 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 150,981,590 - 150,998,894 (-) Ensembl GRCm39 Ensembl GRCm38 4 150,897,133 - 150,909,921 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 150,897,133 - 150,914,437 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 150,271,242 - 150,284,030 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 149,740,942 - 149,753,650 (-) NCBI MGSCv36 mm8 Celera 4 153,174,297 - 153,187,100 (-) NCBI Celera Cytogenetic Map 4 E2 NCBI cM Map 4 81.52 NCBI
Park7 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 166,636,551 - 166,659,825 (-) NCBI GRCr8 mRatBN7.2 5 161,353,718 - 161,376,993 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 161,353,719 - 161,376,970 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 164,071,138 - 164,094,398 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 165,887,564 - 165,910,960 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 165,849,775 - 165,873,035 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 167,982,438 - 168,004,724 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 167,982,439 - 168,004,724 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 171,559,202 - 171,582,476 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 168,050,149 - 168,061,616 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 168,060,336 - 168,071,804 (-) NCBI Celera 5 159,607,648 - 159,630,713 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
Park7 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955486 4,969,497 - 4,985,885 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955486 4,974,130 - 4,985,927 (-) NCBI ChiLan1.0 ChiLan1.0
PARK7 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 220,243,225 - 220,268,293 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 218,884,515 - 218,908,146 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 6,722,260 - 6,745,915 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 7,969,265 - 7,993,271 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 7,969,280 - 7,993,271 (+) Ensembl panpan1.1 panPan2
PARK7 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 61,576,219 - 61,592,325 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 61,576,069 - 61,592,303 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 61,584,413 - 61,601,125 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 61,791,984 - 61,808,701 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 61,792,439 - 61,808,700 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 61,791,244 - 61,807,961 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 61,656,017 - 61,672,730 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 62,059,399 - 62,076,120 (+) NCBI UU_Cfam_GSD_1.0
Park7 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 31,937,508 - 31,951,577 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936623 2,422,833 - 2,436,817 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936623 2,422,780 - 2,436,817 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PARK7 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 68,629,214 - 68,645,516 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 68,629,327 - 68,645,147 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 63,023,779 - 63,033,855 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PARK7 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 123,776,084 - 123,808,031 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 123,776,297 - 123,798,434 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666054 27,810,002 - 27,834,129 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Park7
.
Predicted Target Of
Count of predictions: 991 Count of miRNA genes: 459 Interacting mature miRNAs: 490 Transcripts: ENST00000338639, ENST00000377488, ENST00000377491, ENST00000377493, ENST00000460192, ENST00000465354, ENST00000469225, ENST00000493373, ENST00000493678, ENST00000497113 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298451 OSTEAR17_H Osteoarthritis QTL 17 (human) 2.4 0.0004 Joint/bone inflammation osteoarthritis 11 1 25188105 Human 597375966 GWAS1472040_H ulcerative colitis QTL GWAS1472040 (human) 5e-09 ulcerative colitis 1 7961913 7961914 Human 597092435 GWAS1188509_H Crohn's disease QTL GWAS1188509 (human) 5e-09 intestine integrity trait (VT:0010554) 1 7962137 7962138 Human 597376573 GWAS1472647_H inflammatory bowel disease QTL GWAS1472647 (human) 1e-15 inflammatory bowel disease 1 7961913 7961914 Human 597161567 GWAS1257641_H gut microbiome measurement QTL GWAS1257641 (human) 2e-08 gut microbiome measurement 1 7969741 7969742 Human 407061034 GWAS710010_H stroke QTL GWAS710010 (human) 0.0000002 stroke 1 7982766 7982767 Human 1298463 BP9_H Blood pressure QTL 9 (human) 3.9 Blood pressure hypertension susceptibility 1 1 25188105 Human 1643380 BW316_H Body weight QTL 316 (human) 2.62 0.0002 Body weight BMI 1 7585503 33585503 Human 597021371 GWAS1117445_H Crohn's disease QTL GWAS1117445 (human) 0.000003 intestine integrity trait (VT:0010554) 1 7962137 7962138 Human 597021498 GWAS1117572_H ulcerative colitis QTL GWAS1117572 (human) 4e-09 ulcerative colitis 1 7962137 7962138 Human 1576329 MYI9_H Myocardial infarction susceptibility QTL 9 (human) 12 Myocardial infarction susceptibility early-onset 1 7585503 33585503 Human 406954451 GWAS603427_H ankylosing spondylitis, psoriasis, ulcerative colitis, Crohn's disease, sclerosing cholangitis QTL GWAS603427 (human) 9e-14 intestine integrity trait (VT:0010554) 1 7962137 7962138 Human 597290730 GWAS1386804_H Crohn's disease QTL GWAS1386804 (human) 1e-08 intestine integrity trait (VT:0010554) 1 7969449 7969450 Human 597093346 GWAS1189420_H ulcerative colitis QTL GWAS1189420 (human) 6e-14 ulcerative colitis 1 7962137 7962138 Human 597021058 GWAS1117132_H inflammatory bowel disease QTL GWAS1117132 (human) 1e-12 inflammatory bowel disease 1 7962137 7962138 Human 1576325 MYI1_H Myocardial infarction susceptibility QTL 1 (human) 11.68 1e-12 Myocardial infarction susceptibility early-onset 1 7585503 33585503 Human 597177861 GWAS1273935_H protein dj-1 measurement QTL GWAS1273935 (human) 1e-26 protein dj-1 measurement 1 7961718 7961719 Human
SHGC-74169
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 8,045,159 - 8,045,283 UniSTS GRCh37 GRCh37 12 49,989,841 - 49,989,970 UniSTS GRCh37 Build 36 1 7,967,746 - 7,967,870 RGD NCBI36 Celera 1 7,152,215 - 7,152,339 RGD Celera 12 48,784,301 - 48,784,430 UniSTS Cytogenetic Map 12 q13.12 UniSTS Cytogenetic Map 1 p36.23 UniSTS HuRef 12 47,020,693 - 47,020,822 UniSTS HuRef 1 7,192,980 - 7,193,104 UniSTS GeneMap99-GB4 RH Map 1 32.73 UniSTS Whitehead-RH Map 1 24.9 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2253
4974
1726
2351
6
624
1951
465
2270
7306
6472
53
3734
1
852
1744
1617
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000338639 ⟹ ENSP00000340278
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 7,961,711 - 7,985,505 (+) Ensembl
Ensembl Acc Id:
ENST00000377488 ⟹ ENSP00000366708
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 7,961,969 - 7,985,111 (+) Ensembl
Ensembl Acc Id:
ENST00000377491 ⟹ ENSP00000366711
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 7,961,894 - 7,985,250 (+) Ensembl
Ensembl Acc Id:
ENST00000377493 ⟹ ENSP00000466242
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 7,961,701 - 7,985,281 (+) Ensembl
Ensembl Acc Id:
ENST00000460192
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 7,961,663 - 7,971,048 (+) Ensembl
Ensembl Acc Id:
ENST00000465354
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 7,961,748 - 7,971,521 (+) Ensembl
Ensembl Acc Id:
ENST00000469225 ⟹ ENSP00000466756
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 7,965,351 - 7,985,282 (+) Ensembl
Ensembl Acc Id:
ENST00000493373 ⟹ ENSP00000465404
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 7,954,291 - 7,985,052 (+) Ensembl
Ensembl Acc Id:
ENST00000493678 ⟹ ENSP00000418770
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 7,961,692 - 7,985,505 (+) Ensembl
Ensembl Acc Id:
ENST00000497113
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 7,962,767 - 7,971,957 (+) Ensembl
RefSeq Acc Id:
NM_001123377 ⟹ NP_001116849
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 7,961,711 - 7,985,505 (+) NCBI GRCh37 1 8,021,714 - 8,045,342 (+) NCBI HuRef 1 7,169,316 - 7,193,163 (+) ENTREZGENE CHM1_1 1 8,009,469 - 8,033,097 (+) NCBI T2T-CHM13v2.0 1 7,492,675 - 7,516,444 (+) NCBI
Sequence:
GCGTTCATTTTCAGCCTGGTGTGGGGCTTGTAAACATATAACATAAAAATGGCTTCCAAAAGAGCTCTGGTCATCCTGGCTAAAGGAGCAGAGGAAATGGAGACGGTCATCCCTGTAGATGTCATGAG
hide sequence
RefSeq Acc Id:
NM_007262 ⟹ NP_009193
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 7,961,711 - 7,985,505 (+) NCBI GRCh37 1 8,021,714 - 8,045,342 (+) ENTREZGENE GRCh37 1 8,021,714 - 8,045,342 (+) NCBI Build 36 1 7,944,380 - 7,967,926 (+) NCBI Archive HuRef 1 7,169,316 - 7,193,163 (+) ENTREZGENE CHM1_1 1 8,009,469 - 8,033,097 (+) NCBI T2T-CHM13v2.0 1 7,492,675 - 7,516,444 (+) NCBI
Sequence:
GCGTTCATTTTCAGCCTGGTGTGGGGTGAGTGGTACCCAACGGGCCGGGGCGCCGCGTCCGCAG
hide sequence
RefSeq Acc Id:
XM_005263424 ⟹ XP_005263481
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 7,961,711 - 7,985,505 (+) NCBI GRCh37 1 8,021,714 - 8,045,342 (+) NCBI
Sequence:
CGCCCTCGCTTCCGGCCTCCCAGTCGGGCCCTGTCGCTGGCGTTGGATTTGACTGACCGCCAGC
hide sequence
RefSeq Acc Id:
XM_054334046 ⟹ XP_054190021
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 1 7,492,680 - 7,516,444 (+) NCBI
RefSeq Acc Id:
NP_009193 ⟸ NM_007262
- UniProtKB:
Q99497 (UniProtKB/Swiss-Prot), Q7LFU2 (UniProtKB/Swiss-Prot), Q6DR95 (UniProtKB/Swiss-Prot), B2R4Z1 (UniProtKB/Swiss-Prot), O14805 (UniProtKB/Swiss-Prot), V9HWC2 (UniProtKB/TrEMBL)
- Sequence:
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPL
hide sequence
RefSeq Acc Id:
NP_001116849 ⟸ NM_001123377
- UniProtKB:
Q99497 (UniProtKB/Swiss-Prot), Q7LFU2 (UniProtKB/Swiss-Prot), Q6DR95 (UniProtKB/Swiss-Prot), O14805 (UniProtKB/Swiss-Prot), B2R4Z1 (UniProtKB/Swiss-Prot), V9HWC2 (UniProtKB/TrEMBL)
- Sequence:
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKE
hide sequence
RefSeq Acc Id:
XP_005263481 ⟸ XM_005263424
- Peptide Label:
isoform X1
- UniProtKB:
Q99497 (UniProtKB/Swiss-Prot), Q7LFU2 (UniProtKB/Swiss-Prot), Q6DR95 (UniProtKB/Swiss-Prot), O14805 (UniProtKB/Swiss-Prot), B2R4Z1 (UniProtKB/Swiss-Prot), V9HWC2 (UniProtKB/TrEMBL)
- Sequence:
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPL
hide sequence
Ensembl Acc Id:
ENSP00000418770 ⟸ ENST00000493678
Ensembl Acc Id:
ENSP00000465404 ⟸ ENST00000493373
Ensembl Acc Id:
ENSP00000466756 ⟸ ENST00000469225
Ensembl Acc Id:
ENSP00000366708 ⟸ ENST00000377488
Ensembl Acc Id:
ENSP00000366711 ⟸ ENST00000377491
Ensembl Acc Id:
ENSP00000466242 ⟸ ENST00000377493
Ensembl Acc Id:
ENSP00000340278 ⟸ ENST00000338639
RefSeq Acc Id:
XP_054190021 ⟸ XM_054334046
- Peptide Label:
isoform X1
- UniProtKB:
Q99497 (UniProtKB/Swiss-Prot), Q7LFU2 (UniProtKB/Swiss-Prot), Q6DR95 (UniProtKB/Swiss-Prot), O14805 (UniProtKB/Swiss-Prot), B2R4Z1 (UniProtKB/Swiss-Prot), V9HWC2 (UniProtKB/TrEMBL)
RGD ID: 6786189 Promoter ID: HG_KWN:501 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, K562, Lymphoblastoid, NB4 Transcripts: OTTHUMT00000003580 Position: Human Assembly Chr Position (strand) Source Build 36 1 7,936,566 - 7,937,066 (+) MPROMDB
RGD ID: 6786222 Promoter ID: HG_KWN:502 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: ENST00000377488, ENST00000377491, NM_007262, OTTHUMT00000003577, OTTHUMT00000003583, UC001AOV.2, UC001AOW.2 Position: Human Assembly Chr Position (strand) Source Build 36 1 7,943,919 - 7,944,419 (+) MPROMDB
RGD ID: 6851138 Promoter ID: EP73366 Type: initiation region Name: HS_PARK7 Description: Parkinson disease (autosomal recessive, early onset) 7. SO ACC ID: SO:0000170 Source: EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: NEDO full length human cDNA sequencing project.; Oligo-capping Position: Human Assembly Chr Position (strand) Source Build 36 1 7,944,348 - 7,944,408 EPD
RGD ID: 6853972 Promoter ID: EPDNEW_H151 Type: initiation region Name: PARK7_2 Description: Parkinsonism associated deglycase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H152 Experiment Methods: Single-end sequencing.; Paired-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 1 7,954,198 - 7,954,258 EPDNEW
RGD ID: 6853974 Promoter ID: EPDNEW_H152 Type: initiation region Name: PARK7_1 Description: Parkinsonism associated deglycase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H151 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 1 7,961,711 - 7,961,771 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-18
PARK7
Parkinsonism associated deglycase
PARK7
parkinson protein 7
Symbol and/or name change
5135510 APPROVED
2011-07-27
PARK7
parkinson protein 7
PARK7
Parkinson disease (autosomal recessive, early onset) 7
Symbol and/or name change
5135510 APPROVED
