PARK7 (Parkinsonism associated deglycase)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: PARK7 (Parkinsonism associated deglycase) Sus scrofa

Analyze

Symbol:

PARK7

Name:

Parkinsonism associated deglycase

RGD ID:

14062451

Description:

ENCODES a protein that exhibits double-stranded DNA binding (ortholog); protein deglycase activity (ortholog); single-stranded DNA binding (ortholog); INVOLVED IN adult locomotory behavior (ortholog); aging (ortholog); cellular response to hypoxia (ortholog); PARTICIPATES IN Parkinson's disease pathway; transforming growth factor-beta signaling pathway; ASSOCIATED WITH amyotrophic lateral sclerosis-parkinsonism/dementia complex 1 (ortholog); cerebral infarction (ortholog); Chemical and Drug Induced Liver Injury (ortholog); FOUND IN axon (ortholog); cytoplasm (ortholog); cytosol (ortholog)

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

DJ-1 protein; Parkinson disease (autosomal recessive, early onset) 7; Parkinson disease protein 7; protein DJ-1; protein/nucleic acid deglycase DJ-1

RGD Orthologs

Human

Mouse

Rat

Chinchilla

Bonobo

Dog

Squirrel

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

Sscrofa11.1 - Pig Sscrofa11.1 Assembly

Position:

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	68,629,214 - 68,645,516 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	68,629,327 - 68,645,147 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	63,023,779 - 63,033,855 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

amyotrophic lateral sclerosis-parkinsonism/dementia complex 1 (ISO)

cerebral infarction (ISO)

Chemical and Drug Induced Liver Injury (ISO)

genetic disease (ISO)

hepatocellular carcinoma (ISO)

late onset Parkinson's disease (ISO)

maturity-onset diabetes of the young type 5 (ISO)

middle cerebral artery infarction (ISO)

motor neuron disease (ISO)

Nerve Degeneration (ISO)

Neurodevelopmental Disorders (ISO)

osteoporosis (ISO)

Parkinson's disease (ISO)

Parkinson's disease 2 (ISO)

Parkinson's disease 6 (ISO)

Parkinson's disease 7 (ISO)

Parkinsonism (ISO)

perinatal necrotizing enterocolitis (ISO)

Pulmonary Arterial Hypertension (ISO)

Reticulocytosis (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adult locomotory behavior (IEA,ISO)

aging (ISO)

autophagy (IEA)

cellular detoxification of aldehyde (IEA)

cellular detoxification of methylglyoxal (IEA)

cellular oxidant detoxification (IEA)

cellular response to glyoxal (IEA)

cellular response to hydrogen peroxide (IEA)

cellular response to hypoxia (ISO)

cellular response to lipopolysaccharide (ISO)

cellular response to oxidative stress (IEA)

cellular response to reactive oxygen species (IEA,ISO)

detection of oxidative stress (IEA)

detoxification of copper ion (IEA)

detoxification of hydrogen peroxide (IEA)

detoxification of mercury ion (IEA)

DNA repair (IEA)

dopamine uptake involved in synaptic transmission (IEA,ISO)

glucose homeostasis (IEA)

glutathione deglycation (IEA)

glycolate biosynthetic process (IBA,IEA)

glyoxal catabolic process (IEA)

glyoxal metabolic process (IBA,IEA)

guanine deglycation (IEA)

guanine deglycation, glyoxal removal (IBA,IEA)

guanine deglycation, methylglyoxal removal (IEA)

histone modification (IEA)

hydrogen peroxide metabolic process (IEA,ISO)

insulin secretion (IEA)

lactate biosynthetic process (IEA)

maternal process involved in female pregnancy (ISO)

membrane depolarization (IEA,ISO)

membrane hyperpolarization (IEA,ISO)

methylglyoxal catabolic process to lactate (IEA)

methylglyoxal metabolic process (IEA,ISO)

mitochondrion organization (IEA)

negative regulation of apoptotic process (ISO)

negative regulation of cell death (IEA)

negative regulation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway (IEA)

negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway (IEA)

negative regulation of extrinsic apoptotic signaling pathway (IEA)

negative regulation of gene expression (IEA)

negative regulation of hydrogen peroxide-induced cell death (IEA)

negative regulation of hydrogen peroxide-induced neuron death (IEA)

negative regulation of hydrogen peroxide-induced neuron intrinsic apoptotic signaling pathway (IEA)

negative regulation of neuron apoptotic process (IEA)

negative regulation of neuron death (IBA,IEA,ISO)

negative regulation of nitrosative stress-induced intrinsic apoptotic signaling pathway (IEA)

negative regulation of NMDA glutamate receptor activity (ISO)

negative regulation of oxidative stress-induced cell death (IEA)

negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway (IEA,ISO)

negative regulation of oxidative stress-induced neuron death (IEA)

negative regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway (IEA)

negative regulation of proteasomal ubiquitin-dependent protein catabolic process (IEA)

negative regulation of protein acetylation (IEA)

negative regulation of protein binding (IEA)

negative regulation of protein catabolic process (IEA)

negative regulation of protein export from nucleus (IEA)

negative regulation of protein K48-linked deubiquitination (IEA)

negative regulation of protein kinase activity (IEA)

negative regulation of protein phosphorylation (IEA)

negative regulation of protein sumoylation (IEA)

negative regulation of protein ubiquitination (IEA)

negative regulation of reactive oxygen species biosynthetic process (IEA)

negative regulation of smooth muscle cell migration (ISO)

negative regulation of TRAIL-activated apoptotic signaling pathway (IEA)

negative regulation of ubiquitin-protein transferase activity (IEA)

negative regulation of ubiquitin-specific protease activity (IEA)

negative regulation of vascular associated smooth muscle cell proliferation (ISO)

peptidyl-arginine deglycation (IEA)

peptidyl-cysteine deglycation (IEA)

peptidyl-lysine deglycation (IEA)

positive regulation of acute inflammatory response to antigenic stimulus (IEA)

positive regulation of androgen receptor activity (IEA)

positive regulation of DNA-binding transcription factor activity (IEA)

positive regulation of dopamine biosynthetic process (IEA)

positive regulation of fertilization (ISO)

positive regulation of gene expression (IEA)

positive regulation of interleukin-8 production (IEA)

positive regulation of L-dopa biosynthetic process (IEA)

positive regulation of L-dopa decarboxylase activity (IEA)

positive regulation of mitochondrial electron transport, NADH to ubiquinone (IEA)

positive regulation of NAD(P)H oxidase activity (IEA)

positive regulation of oxidative phosphorylation uncoupler activity (IEA)

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway (IEA,ISO)

positive regulation of peptidyl-serine phosphorylation (IEA)

positive regulation of protein localization to nucleus (IEA)

positive regulation of protein-containing complex assembly (IEA)

positive regulation of pyrroline-5-carboxylate reductase activity (IEA)

positive regulation of reactive oxygen species biosynthetic process (IEA,ISO)

positive regulation of superoxide dismutase activity (IEA)

positive regulation of transcription by RNA polymerase II (IEA)

positive regulation of transcription regulatory region DNA binding (IEA)

positive regulation of tyrosine 3-monooxygenase activity (IEA)

protein deglycation, glyoxal removal (IBA,IEA)

protein deglycation, methylglyoxal removal (IEA,ISO)

protein deglycosylation (IEA,ISO)

protein stabilization (IEA)

proteolysis (IEA)

regulation of androgen receptor signaling pathway (IEA)

regulation of histone acetylation (IEA)

regulation of histone ubiquitination (IEA)

regulation of inflammatory response (IEA)

regulation of mitochondrial membrane potential (IEA)

regulation of neuron apoptotic process (IEA)

regulation of TRAIL production (ISO)

response to hydrogen peroxide (IEA,ISO)

response to oxidative stress (IBA,IEA,ISO)

response to xenobiotic stimulus (ISO)

single fertilization (IEA)

spermatogenesis (ISO)

synaptic transmission, dopaminergic (IEA,ISO)

Cellular Component

axon (ISO)

cell body (IEA)

chromatin (IEA)

cytoplasm (IBA,IEA)

cytoplasm (ISO)

cytosol (IBA)

cytosol (IEA)

cytosol (ISO)

endoplasmic reticulum (IEA)

membrane raft (IEA)

membrane raft (IEA,ISO)

mitochondrial intermembrane space (IEA)

mitochondrial matrix (IEA)

mitochondrion (IBA,IEA)

mitochondrion (IEA)

neuron projection (IEA)

nucleoplasm (IEA)

nucleus (IBA)

nucleus (IBA,IEA)

nucleus (ISO)

perinuclear region of cytoplasm (IEA)

plasma membrane (IEA)

PML body (IEA)

presynapse (IEA)

sperm head (ISO)

synapse (IEA)

Molecular Function

copper ion binding (IEA)

cupric ion binding (IEA)

cuprous ion binding (IEA)

cytokine binding (IEA)

DNA-binding transcription factor binding (IEA)

double-stranded DNA binding (ISO)

enzyme binding (IEA)

glyoxalase (glycolic acid-forming) activity (IEA)

identical protein binding (IEA)

kinase binding (IEA)

L-dopa decarboxylase activator activity (IEA)

mercury ion binding (IEA)

mRNA binding (IEA)

nuclear androgen receptor binding (IEA)

oxidoreductase activity, acting on peroxide as acceptor (IBA,IEA)

oxygen sensor activity (IEA)

peptidase activity (IEA)

peroxiredoxin activity (IEA)

protein binding (ISO)

protein deglycase activity (IBA,IEA,ISO)

protein homodimerization activity (IEA)

protein-containing complex binding (IEA)

scaffold protein binding (IEA)

signaling receptor binding (IEA)

single-stranded DNA binding (ISO)

small protein activating enzyme binding (IEA)

superoxide dismutase copper chaperone activity (IEA)

transcription coactivator activity (IEA)

tyrosine 3-monooxygenase activator activity (IEA)

ubiquitin-like protein conjugating enzyme binding (IEA)

ubiquitin-specific protease binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

Parkinson's disease pathway (ISO)

transforming growth factor-beta signaling pathway (ISO)

References

Additional References at PubMed

PMID:14681463	PMID:17145712	PMID:17268184

Genomics

Comparative Map Data

PARK7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	68,629,214 - 68,645,516 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	68,629,327 - 68,645,147 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	63,023,779 - 63,033,855 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PARK7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	7,961,711 - 7,985,505 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	1	7,954,291 - 7,985,505 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	8,021,771 - 8,045,565 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	7,944,380 - 7,967,926 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	7,956,058 - 7,979,602	NCBI
Celera	1	7,128,771 - 7,152,398 (+)	NCBI		Celera
Cytogenetic Map	1	p36.23	NCBI
HuRef	1	7,169,316 - 7,193,163 (+)	NCBI		HuRef
CHM1_1	1	8,009,469 - 8,033,097 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	7,492,675 - 7,516,444 (+)	NCBI		T2T-CHM13v2.0

Park7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	150,981,590 - 150,994,378 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	150,981,590 - 150,998,894 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	150,897,133 - 150,909,921 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	150,897,133 - 150,914,437 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	150,271,242 - 150,284,030 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	149,740,942 - 149,753,650 (-)	NCBI		MGSCv36	mm8
Celera	4	153,174,297 - 153,187,100 (-)	NCBI		Celera
Cytogenetic Map	4	E2	NCBI

Park7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	161,353,718 - 161,376,993 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	161,353,719 - 161,376,970 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	164,071,138 - 164,094,398 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	165,887,564 - 165,910,960 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	165,849,775 - 165,873,035 (-)	NCBI	Rnor_WKY
Rnor_6.0	5	167,982,438 - 168,004,724 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	167,982,439 - 168,004,724 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	171,559,202 - 171,582,476 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	168,050,149 - 168,061,616 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	168,060,336 - 168,071,804 (-)	NCBI
Celera	5	159,607,648 - 159,630,713 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

Park7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955486	4,969,497 - 4,985,885 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955486	4,974,130 - 4,985,927 (-)	NCBI	ChiLan1.0	ChiLan1.0

PARK7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	1	7,969,265 - 7,993,271 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	7,969,280 - 7,993,271 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	1	6,722,260 - 6,745,915 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

PARK7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	61,576,219 - 61,592,325 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	61,576,069 - 61,592,303 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	61,584,413 - 61,601,125 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	61,791,984 - 61,808,701 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	61,792,439 - 61,808,700 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	61,791,244 - 61,807,961 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	61,656,017 - 61,672,730 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	62,059,399 - 62,076,120 (+)	NCBI		UU_Cfam_GSD_1.0

Park7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	31,937,508 - 31,951,577 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936623	2,422,833 - 2,436,817 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936623	2,422,780 - 2,436,817 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PARK7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	123,776,084 - 123,808,031 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	123,776,297 - 123,798,434 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666054	27,810,002 - 27,834,129 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Park7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624818	3,900,917 - 3,911,042 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624818	3,900,917 - 3,915,457 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	hemolymphoid system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system
High
Medium	10	4	3	5	2	23	2	3	3
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001078663	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AEMK02000044	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK240101	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK392039	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK392979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ007624	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ008987	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ010670	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ088662	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FP104566	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GFLN01005931	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSSSCT00000003756 ⟹ ENSSSCP00000003670

RefSeq Status:

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1 Ensembl	6	68,629,214 - 68,645,516 (+)	Ensembl

RefSeq Acc Id:

ENSSSCT00000067984 ⟹ ENSSSCP00000063731

RefSeq Status:

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1 Ensembl	6	68,629,214 - 68,645,516 (+)	Ensembl

RefSeq Acc Id:

NM_001078663 ⟹ NP_001072131

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Pig Assembly	Chr	Position (strand)	Source
Sscrofa11.1	6	68,629,327 - 68,645,147 (+)	NCBI

Sequence:

show sequence

CGAGGTTCAGTTAAGTCTTCAGAAAATACAACATAAGAATGGCTTCTAAAAGGGCTCTGGTCAT
CCTGGCTAAAGGAGCAGAGGAGATGGAGACGGTTATTCCTGTAGATGTCATGAGACGAGCTGGA
ATTAAGGTCACCGTTGCAGGCCTGGCTGGAAAAGATCCGGTGCAGTGTAGCCGTGATGTTGTCA
TTTGTCCCGACGCCAGCCTGGAAGATGCCAAAAAAGAGGGACCTTATGACGTGGTGGTTCTGCC
GGGAGGCAATCTGGGTGCACAGAATTTATCGGAGTCTGCTGCTGTGAAGGACATCCTGAAGGAG
CAGGAGAAGAGGAAGGGCCTCATAGCAGCCATCTGTGCAGGTCCCACGGCTCTGTTGGCTCATG
AGATCGGTTTTGGAAGCAAAGTTACGACGCACCCACTTGCTAAAGACAAGATGATGAACGGAAG
TCATTACAGCTACTCAGAGAATCGCGTGGAAAAGGACGGTCTGATCCTCACCAGCCGGGGGCCC
GGAACCAGCTTCGAGTTTGCTCTGGCCATTGTTGAGGCCCTGGCCGGCAAGGAGGTGGCCGACC
AAGTGAAGGCCCCGCTTGTTCTGAGAGACTAGAGCCGAGCGGGCTGCCCGGAACCCCTCCCG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001072131	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAY56774	(Get FASTA)	NCBI Sequence Viewer
	AAY57853	(Get FASTA)	NCBI Sequence Viewer
	AAY63803	(Get FASTA)	NCBI Sequence Viewer
	AAZ65829	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001072131 ⟸ NM_001078663
- UniProtKB:	Q0R678 (UniProtKB/TrEMBL), A0A4X1W8H4 (UniProtKB/TrEMBL), F1RII4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKE GPYDVVVLPGGNLGAQNLSESAAVKDILKEQEKRKGLIAAICAGPTALLAHEIGFGSKVTTHPL AKDKMMNGSHYSYSENRVEKDGLILTSRGPGTSFEFALAIVEALAGKEVADQVKAPLVLRD hide sequence

RefSeq Acc Id:

ENSSSCP00000003670 ⟸ ENSSSCT00000003756

RefSeq Acc Id:

ENSSSCP00000063731 ⟸ ENSSSCT00000067984

Protein Domains

DJ-1/PfpI

Additional Information

External Database Links

Database	Acc Id	Source(s)
Ensembl Genes	ENSSSCG00000003385	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
	ENSSSCG00005015519	UniProtKB/TrEMBL
	ENSSSCG00015020664	UniProtKB/TrEMBL
	ENSSSCG00025075678	UniProtKB/TrEMBL
	ENSSSCG00030070123	UniProtKB/TrEMBL
	ENSSSCG00035037263	UniProtKB/TrEMBL
	ENSSSCG00040043649	UniProtKB/TrEMBL
	ENSSSCG00045031280	UniProtKB/TrEMBL
	ENSSSCG00050069783	UniProtKB/TrEMBL
	ENSSSCG00055004521	UniProtKB/TrEMBL
	ENSSSCG00060036368	UniProtKB/TrEMBL
	ENSSSCG00065066860	UniProtKB/TrEMBL
	ENSSSCG00070029540	UniProtKB/TrEMBL
Ensembl Protein	ENSSSCP00000003670	ENTREZGENE
	ENSSSCP00000003670.3	UniProtKB/TrEMBL
	ENSSSCP00000063731.1	UniProtKB/TrEMBL
	ENSSSCP00005014767.1	UniProtKB/TrEMBL
	ENSSSCP00005014794.1	UniProtKB/TrEMBL
	ENSSSCP00015010839.1	UniProtKB/TrEMBL
	ENSSSCP00015010859.1	UniProtKB/TrEMBL
	ENSSSCP00015010906.1	UniProtKB/TrEMBL
	ENSSSCP00025046452.1	UniProtKB/TrEMBL
	ENSSSCP00025046468.1	UniProtKB/TrEMBL
	ENSSSCP00030045185.1	UniProtKB/TrEMBL
	ENSSSCP00030045199.1	UniProtKB/TrEMBL
	ENSSSCP00035019785.1	UniProtKB/TrEMBL
	ENSSSCP00035019787.1	UniProtKB/TrEMBL
	ENSSSCP00040024581.1	UniProtKB/TrEMBL
	ENSSSCP00040024617.1	UniProtKB/TrEMBL
	ENSSSCP00045037098.1	UniProtKB/TrEMBL
	ENSSSCP00045037164.1	UniProtKB/TrEMBL
	ENSSSCP00050040991.1	UniProtKB/TrEMBL
	ENSSSCP00050040993.1	UniProtKB/TrEMBL
	ENSSSCP00055007065.1	UniProtKB/TrEMBL
	ENSSSCP00055007070.1	UniProtKB/TrEMBL
	ENSSSCP00060021100.1	UniProtKB/TrEMBL
	ENSSSCP00060021102.1	UniProtKB/TrEMBL
	ENSSSCP00065040175.1	UniProtKB/TrEMBL
	ENSSSCP00065040178.1	UniProtKB/TrEMBL
	ENSSSCP00070050548.1	UniProtKB/TrEMBL
	ENSSSCP00070050549.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSSSCT00000003756	ENTREZGENE
	ENSSSCT00000003756.5	UniProtKB/TrEMBL
	ENSSSCT00000067984.2	UniProtKB/TrEMBL
	ENSSSCT00005024507.1	UniProtKB/TrEMBL
	ENSSSCT00005024545.1	UniProtKB/TrEMBL
	ENSSSCT00015027664.1	UniProtKB/TrEMBL
	ENSSSCT00015027733.1	UniProtKB/TrEMBL
	ENSSSCT00015027858.1	UniProtKB/TrEMBL
	ENSSSCT00025104485.1	UniProtKB/TrEMBL
	ENSSSCT00025104508.1	UniProtKB/TrEMBL
	ENSSSCT00030098165.1	UniProtKB/TrEMBL
	ENSSSCT00030098192.1	UniProtKB/TrEMBL
	ENSSSCT00035049421.1	UniProtKB/TrEMBL
	ENSSSCT00035049425.1	UniProtKB/TrEMBL
	ENSSSCT00040058743.1	UniProtKB/TrEMBL
	ENSSSCT00040058808.1	UniProtKB/TrEMBL
	ENSSSCT00045053343.1	UniProtKB/TrEMBL
	ENSSSCT00045053446.1	UniProtKB/TrEMBL
	ENSSSCT00050095172.1	UniProtKB/TrEMBL
	ENSSSCT00050095176.1	UniProtKB/TrEMBL
	ENSSSCT00055008922.1	UniProtKB/TrEMBL
	ENSSSCT00055008928.1	UniProtKB/TrEMBL
	ENSSSCT00060049289.1	UniProtKB/TrEMBL
	ENSSSCT00060049292.1	UniProtKB/TrEMBL
	ENSSSCT00065091779.1	UniProtKB/TrEMBL
	ENSSSCT00065091790.1	UniProtKB/TrEMBL
	ENSSSCT00070059367.1	UniProtKB/TrEMBL
	ENSSSCT00070059368.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.880	UniProtKB/TrEMBL
InterPro	Class_I_gatase-like	UniProtKB/TrEMBL
	DJ-1	UniProtKB/TrEMBL
	DJ-1/PfpI	UniProtKB/TrEMBL
KEGG Report	ssc:780404	UniProtKB/TrEMBL
NCBI Gene	PARK7	ENTREZGENE
PANTHER	PARKINSON DISEASE PROTEIN 7 HOMOLOG	UniProtKB/TrEMBL
	PROTEIN/NUCLEIC ACID DEGLYCASE DJ-1-RELATED	UniProtKB/TrEMBL
Pfam	DJ-1_PfpI	UniProtKB/TrEMBL
Superfamily-SCOP	SSF52317	UniProtKB/TrEMBL
TIGRFAMs	not_thiJ	UniProtKB/TrEMBL
UniProt	A0A4X1W8H4	ENTREZGENE, UniProtKB/TrEMBL
	A0A4X1W9T4_PIG	UniProtKB/TrEMBL
	A0A5G2QIK1_PIG	UniProtKB/TrEMBL
	A0RZB0_PIG	UniProtKB/TrEMBL
	F1RII4	ENTREZGENE
	Q0R678	ENTREZGENE, UniProtKB/TrEMBL
	Q3SCI7_PIG	UniProtKB/TrEMBL
	Q45XP8_PIG	UniProtKB/TrEMBL
UniProt Secondary	F1RII4	UniProtKB/TrEMBL
VGNC ID	VGNC:91181	ENTREZGENE

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations