Advanced Search (OLGA)

Gene: CAV3 (caveolin 3) Canis lupus familiaris

Subscribe to Updates

Analyze

Symbol:

CAV3

Name:

caveolin 3

RGD ID:

12413272

Description:

ENCODES a protein that exhibits enzyme binding (ortholog); molecular adaptor activity (ortholog); nitric-oxide synthase binding (ortholog); INVOLVED IN cell differentiation (ortholog); cellular response to ionomycin (ortholog); establishment of localization in cell (ortholog); PARTICIPATES IN platelet-derived growth factor signaling pathway; ASSOCIATED WITH Atrioventricular Septal Defect 2 (ortholog); Cardiomegaly (ortholog); cardiomyopathy (ortholog); FOUND IN caveola (ortholog); cell surface (ortholog); intercalated disc (ortholog)

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

caveolin-3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CAV3 (caveolin 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Cav3 (caveolin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):	Cav3 (caveolin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cav3 (caveolin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CAV3 (caveolin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cav3 (caveolin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CAV3 (caveolin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CAV3 (caveolin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cav3 (caveolin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline

Latest Assembly:

CanFam3.1 - Dog CanFam3.1 Assembly

Position:

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	9,384,901 - 9,398,055 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	9,384,901 - 9,401,196 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	9,418,382 - 9,431,544 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	9,414,987 - 9,428,087 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	9,414,987 - 9,428,087 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	9,136,869 - 9,150,024 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	9,481,732 - 9,494,836 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	9,455,880 - 9,468,982 (-)	NCBI		UU_Cfam_GSD_1.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CAV3	Dog	Experimental Autoimmune Encephalomyelitis	onset	ISO	Cav3 (Rattus norvegicus)	9068941	Protein:increased expression:spinal cord and astrocyte	RGD	PMID:15925413 and REF_RGD_ID:1582168
CAV3	Dog	muscular dystrophy	susceptibility	ISO	CAV3 (Homo sapiens)	9068941	DNA:missense mutation and deletion	RGD	PMID:9537420 and REF_RGD_ID:1599529
CAV3	Dog	myocardial infarction		ISO	Cav3 (Rattus norvegicus)	9068941	mRNA more ...	RGD	PMID:29438664 and REF_RGD_ID:126925221
CAV3	Dog	myocardial infarction		ISO	Cav3 (Rattus norvegicus)	9068941	Protein:increased expression:cytosol	RGD	PMID:12566108 and REF_RGD_ID:1599542

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CAV3	Dog	Atrioventricular Septal Defect 2		ISO	CAV3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Atrioventricular septal defect more ...	ClinVar	PMID:28492532
CAV3	Dog	cardiomyopathy		ISO	CAV3 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:09536092 more ...
CAV3	Dog	distal myopathy Tateyama type		ISO	CAV3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Distal myopathy and Tateyama type	ClinVar	PMID:09536092 more ...
CAV3	Dog	familial hypertrophic cardiomyopathy		ISO	CAV3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Primary familial hypertrophic cardiomyopathy	ClinVar	PMID:14672715 and PMID:15580566
CAV3	Dog	hypertrophic cardiomyopathy		ISO	CAV3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hypertrophic cardiomyopathy	ClinVar	PMID:15580566 more ...
CAV3	Dog	hypertrophic cardiomyopathy 1		ISO	CAV3 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:09536092 more ...
CAV3	Dog	hypertrophic cardiomyopathy 1		ISO	CAV3 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:09536092 more ...
CAV3	Dog	hypertrophic cardiomyopathy 1		ISO	CAV3 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:09536092 more ...
CAV3	Dog	hypertrophic cardiomyopathy 1		ISO	CAV3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hypertrophic cardiomyopathy 1	ClinVar	PMID:09536092 more ...
CAV3	Dog	isolated elevated serum creatine phosphokinase levels		ISO	CAV3 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:09536092 more ...
CAV3	Dog	Joubert syndrome 9		ISO	CAV3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Joubert syndrome 9	ClinVar
CAV3	Dog	limb-girdle muscular dystrophy		ISO	CAV3 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:09536092 more ...
CAV3	Dog	long QT syndrome		ISO	CAV3 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:09536092 more ...
CAV3	Dog	long QT syndrome		ISO	CAV3 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:09536092 more ...
CAV3	Dog	long QT syndrome		ISO	CAV3 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:09536092 more ...
CAV3	Dog	long QT syndrome 1		ISO	CAV3 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:09536092 more ...
CAV3	Dog	long QT syndrome 9		ISO	CAV3 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:09536092 more ...
CAV3	Dog	Neurodevelopmental Disorders		ISO	CAV3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
CAV3	Dog	rippling muscle disease 2		ISO	CAV3 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:09536092 more ...
CAV3	Dog	Romano-Ward Syndrome		ISO	CAV3 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:14672715 more ...
CAV3	Dog	sudden infant death syndrome		ISO	CAV3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: SUDDEN INFANT DEATH SYNDROME	ClinVar	PMID:12666119 more ...
CAV3	Dog	Tubular Aggregate Myopathies		ISO	CAV3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Myopathy with tubular aggregates	ClinVar	PMID:10227634 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CAV3	Dog	Cardiomegaly		ISO	CAV3 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:19299911
CAV3	Dog	Chromosome 3, Monosomy 3p25		ISO	CAV3 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:21082655
CAV3	Dog	congenital heart disease		ISO	CAV3 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:21082655
CAV3	Dog	Experimental Diabetes Mellitus		ISO	CAV3 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:18266981
CAV3	Dog	rippling muscle disease 1		ISO	CAV3 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:11431690 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CAV3	Dog	distal myopathy Tateyama type		ISO	CAV3 (Homo sapiens)	7240710		OMIM
CAV3	Dog	hypertrophic cardiomyopathy 1		ISO	CAV3 (Homo sapiens)	7240710		OMIM
CAV3	Dog	isolated elevated serum creatine phosphokinase levels		ISO	CAV3 (Homo sapiens)	7240710		OMIM
CAV3	Dog	long QT syndrome 9		ISO	CAV3 (Homo sapiens)	7240710		OMIM
CAV3	Dog	rippling muscle disease 2		ISO	CAV3 (Homo sapiens)	7240710		OMIM

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CAV3	Dog	actin filament organization	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	calcium ion transport	acts_upstream_of	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	cardiac muscle cell development	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	cardiac muscle hypertrophy	acts_upstream_of	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	caveola assembly	involved_in	IBA	MGI:102709 more ...	150520179		GO_Central	GO_REF:0000033
CAV3	Dog	caveola assembly	acts_upstream_of_or_within	IEA	UniProtKB:P51637 more ...	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	caveola assembly	involved_in	IEA	InterPro:IPR001612	150520179		InterPro	GO_REF:0000002
CAV3	Dog	cell differentiation		ISO	Cav3 (Rattus norvegicus)	9068941		RGD	PMID:16135403 and REF_RGD_ID:1599539
CAV3	Dog	cell differentiation	involved_in	IBA	MGI:102709 more ...	150520179		GO_Central	GO_REF:0000033
CAV3	Dog	cellular response to ionomycin		ISO	Cav3 (Rattus norvegicus)	9068941		RGD	PMID:15725944 and REF_RGD_ID:1599540
CAV3	Dog	cholesterol homeostasis	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	cytoplasmic microtubule organization	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	detection of muscle stretch	involved_in	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	endocytosis	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	establishment of localization in cell	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	establishment of localization in cell	acts_upstream_of	ISO	Cav3 (Mus musculus)	9068941	PMID:21084288	MGI	PMID:21084288
CAV3	Dog	glucose homeostasis	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	heart trabecula formation	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	MAPK cascade	acts_upstream_of	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	membrane raft organization	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	myoblast fusion	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	myotube differentiation	acts_upstream_of	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	myotube differentiation	acts_upstream_of_or_within	ISO	Cav3 (Mus musculus)	9068941	PMID:21182936	MGI	PMID:21182936
CAV3	Dog	negative regulation of calcium ion transport	acts_upstream_of_or_within	IEA	UniProtKB:P51637 more ...	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	negative regulation of cardiac muscle hypertrophy	involved_in	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	negative regulation of cardiac muscle hypertrophy	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	negative regulation of cell growth involved in cardiac muscle cell development		ISO	Cav3 (Rattus norvegicus)	9068941		RGD	PMID:21170593 and REF_RGD_ID:6784534
CAV3	Dog	negative regulation of cell size	involved_in	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	negative regulation of MAPK cascade	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	negative regulation of MAPK cascade	involved_in	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	negative regulation of membrane depolarization during cardiac muscle cell action potential	involved_in	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	negative regulation of nitric-oxide synthase activity	acts_upstream_of_or_within	ISO	MGI:2180562	9068941	PMID:11159934	MGI	PMID:11159934
CAV3	Dog	negative regulation of potassium ion transmembrane transport	involved_in	ISO	Cav3 (Rattus norvegicus)	9068941	PMID:22879586	BHF-UCL	PMID:22879586 and REF_RGD_ID:8553349
CAV3	Dog	negative regulation of protein kinase activity	acts_upstream_of_or_within	ISO	Cav3 (Mus musculus)	9068941	PMID:14600260	MGI	PMID:14600260
CAV3	Dog	negative regulation of sarcomere organization	involved_in	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	nucleus localization	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	plasma membrane organization	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	plasma membrane repair	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	positive regulation of caveolin-mediated endocytosis	involved_in	ISO	Cav3 (Rattus norvegicus)	9068941	PMID:22879586	BHF-UCL	PMID:22879586 and REF_RGD_ID:8553349
CAV3	Dog	positive regulation of cell population proliferation		ISO	Cav3 (Rattus norvegicus)	9068941		RGD	PMID:21508095 and REF_RGD_ID:6784533
CAV3	Dog	positive regulation of cytosolic calcium ion concentration		ISO	Cav3 (Rattus norvegicus)	9068941		RGD	PMID:16318846 and REF_RGD_ID:1599533
CAV3	Dog	positive regulation of microtubule polymerization		ISO	Cav3 (Rattus norvegicus)	9068941		RGD	PMID:16480946 and REF_RGD_ID:1582162
CAV3	Dog	positive regulation of myotube differentiation	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	protein localization	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	protein localization to plasma membrane	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	regulation of branching involved in mammary gland duct morphogenesis	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	regulation of calcium ion import	involved_in	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	regulation of calcium ion transport	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	regulation of cardiac muscle cell action potential involved in regulation of contraction	involved_in	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	regulation of cardiac muscle contraction	involved_in	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	regulation of cytosolic calcium ion concentration	involved_in	IBA	PANTHER:PTN000090202 and UniProtKB:Q03135	150520179		GO_Central	GO_REF:0000033
CAV3	Dog	regulation of heart contraction	involved_in	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	regulation of heart rate	involved_in	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	regulation of membrane depolarization during cardiac muscle cell action potential	involved_in	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	regulation of membrane potential	involved_in	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	regulation of membrane potential	involved_in	IBA	MGI:107570 more ...	150520179		GO_Central	GO_REF:0000033
CAV3	Dog	regulation of membrane potential	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	regulation of nerve growth factor receptor activity	acts_upstream_of_or_within	ISO	CAV3 (Homo sapiens)	9068941	PMID:20472890	MGI	PMID:20472890
CAV3	Dog	regulation of p38MAPK cascade	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	regulation of signal transduction by receptor internalization	acts_upstream_of_or_within	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	regulation of skeletal muscle contraction	involved_in	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	regulation of sodium ion transmembrane transport	involved_in	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	regulation of transforming growth factor beta receptor signaling pathway	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	regulation of ventricular cardiac muscle cell membrane depolarization	involved_in	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	regulation of ventricular cardiac muscle cell membrane repolarization	involved_in	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	response to hypoxia		ISO	Cav3 (Rattus norvegicus)	9068941		RGD	PMID:29438664 and REF_RGD_ID:126925221
CAV3	Dog	response to ischemia		ISO	Cav3 (Rattus norvegicus)	9068941		RGD	PMID:29438664 and REF_RGD_ID:126925221
CAV3	Dog	triglyceride metabolic process	acts_upstream_of_or_within	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	ventricular cardiac muscle cell action potential	involved_in	ISO	Cav3 (Rattus norvegicus)	9068941	PMID:22879586	BHF-UCL	PMID:22879586 and REF_RGD_ID:8553349

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CAV3	Dog	caveola		ISO	Cav3 (Rattus norvegicus)	9068941		RGD	PMID:16135403 more ...
CAV3	Dog	caveola	located_in	IEA	UniProtKB-SubCell:SL-0035	150520179		UniProt	GO_REF:0000044
CAV3	Dog	caveola	located_in	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	cell surface		ISO	Cav3 (Rattus norvegicus)	9068941		RGD	PMID:12649076 and REF_RGD_ID:1299267
CAV3	Dog	dystrophin-associated glycoprotein complex	part_of	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	endoplasmic reticulum	located_in	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	focal adhesion	located_in	IBA	MGI:102709 more ...	150520179		GO_Central	GO_REF:0000033
CAV3	Dog	Golgi apparatus	located_in	IEA	UniProtKB-KW:KW-0333	150520179		UniProt	GO_REF:0000043
CAV3	Dog	Golgi membrane	located_in	IEA	UniProtKB-SubCell:SL-0134	150520179		UniProt	GO_REF:0000044
CAV3	Dog	intercalated disc	located_in	ISO	Cav3 (Rattus norvegicus)	9068941		RGD	PMID:15961389 and REF_RGD_ID:1598749
CAV3	Dog	intracellular membrane-bounded organelle	located_in	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	membrane	located_in	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	membrane	located_in	IEA	UniProtKB-KW:KW-0472	150520179		UniProt	GO_REF:0000043
CAV3	Dog	membrane raft	located_in	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	neuromuscular junction		ISO	Cav3 (Rattus norvegicus)	9068941		RGD	PMID:12923236 and REF_RGD_ID:1600290
CAV3	Dog	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	150520179		UniProt	GO_REF:0000043
CAV3	Dog	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	150520179		UniProt	GO_REF:0000044
CAV3	Dog	plasma membrane	located_in	IEA	ARBA:ARBA00027801	150520179		UniProt	GO_REF:0000117
CAV3	Dog	plasma membrane	located_in	IEA	UniProtKB:P51637 more ...	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	protein-containing complex		ISO	Cav3 (Rattus norvegicus)	9068941		RGD	PMID:12649076 more ...
CAV3	Dog	sarcolemma		ISO	Cav3 (Rattus norvegicus)	9068941		RGD	PMID:16501018 and REF_RGD_ID:1599531
CAV3	Dog	sarcolemma	located_in	IEA	UniProtKB:P51637 more ...	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	sarcolemma	located_in	IEA	UniProtKB-SubCell:SL-0238	150520179		UniProt	GO_REF:0000044
CAV3	Dog	T-tubule		ISO	Cav3 (Rattus norvegicus)	9068941		RGD	PMID:16501018 and REF_RGD_ID:1599531
CAV3	Dog	T-tubule	located_in	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	vesicle	located_in	ISO	Cav3 (Rattus norvegicus)	9068941	PMID:11884374	BHF-UCL	PMID:11884374 and REF_RGD_ID:8553403
CAV3	Dog	Z disc	located_in	ISO	Cav3 (Rattus norvegicus)	9068941		RGD	PMID:15980179 and REF_RGD_ID:1600288

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CAV3	Dog	alpha-tubulin binding	enables	IEA	UniProtKB:P51637 and ensembl:ENSMUSP00000074922	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	calcium channel regulator activity	enables	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	connexin binding	enables	IEA	UniProtKB:P51637 more ...	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	enzyme binding		ISO	Ptgs2 (Rattus norvegicus)	9068941		RGD	PMID:16479074 and REF_RGD_ID:1600265
CAV3	Dog	molecular adaptor activity		ISO	Cav3 (Rattus norvegicus)	9068941		RGD	PMID:15961389 and REF_RGD_ID:1598749
CAV3	Dog	molecular adaptor activity	enables	IBA	MGI:102709 more ...	150520179		GO_Central	GO_REF:0000033
CAV3	Dog	molecular adaptor activity	enables	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	nitric-oxide synthase binding		ISO	Nos3 (Rattus norvegicus)	9068941		RGD	PMID:15007069 more ...
CAV3	Dog	potassium channel inhibitor activity	enables	ISO	Cav3 (Rattus norvegicus)	9068941	PMID:22879586	BHF-UCL	PMID:22879586 and REF_RGD_ID:8553349
CAV3	Dog	protein binding	enables	ISO	PR:P15208	9068941	PMID:16455755	MGI	PMID:16455755
CAV3	Dog	protein binding	enables	ISO	PR:P11531	9068941	PMID:8663016	MGI	PMID:8663016
CAV3	Dog	protein binding	enables	ISO	UniProtKB:Q01815	9068941	PMID:24952909	IntAct	PMID:24952909
CAV3	Dog	protein binding	enables	ISO	UniProtKB:P18762 and UniProtKB:Q01815	9068941	PMID:16648270	IntAct	PMID:16648270
CAV3	Dog	protein binding	enables	ISO	UniProtKB:Q5SUG4 and UniProtKB:Q6PE92	9068941	PMID:21084288	IntAct	PMID:21084288
CAV3	Dog	protein binding	enables	ISO	UniProtKB:Q9ES83	9068941	PMID:24066022	UniProt	PMID:24066022
CAV3	Dog	protein binding	enables	ISO	PR:P51637 and UniProtKB:P51638	9068941	PMID:10988290	MGI	PMID:10988290
CAV3	Dog	protein binding	enables	ISO	UniProtKB:O95810 more ...	9068941	PMID:24567387	UniProt	PMID:24567387
CAV3	Dog	protein binding	enables	ISO	UniProtKB:Q8N0V3 and UniProtKB:Q96AL5	9068941	PMID:32296183	IntAct	PMID:32296183
CAV3	Dog	protein binding	enables	ISO	UniProtKB:Q5BKX8	9068941	PMID:26497963	UniProt	PMID:26497963
CAV3	Dog	protein binding	enables	ISO	PR:Q61762 and PR:Q811D0	9068941	PMID:15277200	MGI	PMID:15277200
CAV3	Dog	protein binding	enables	ISO	UniProtKB:Q14118	9068941	PMID:10988290	UniProt	PMID:10988290
CAV3	Dog	protein binding	enables	ISO	PR:Q9ESD7	9068941	PMID:20405035	MGI	PMID:20405035
CAV3	Dog	protein binding	enables	ISO	PR:Q9ET78	9068941	PMID:15541368	MGI	PMID:15541368
CAV3	Dog	protein binding		ISO	Kcnj11 (Rattus norvegicus)	9068941		RGD	PMID:20332621 and REF_RGD_ID:7296942
CAV3	Dog	protein binding	enables	ISO	UniProtKB:Q6NZI2	9068941	PMID:19726876 more ...	IntAct	PMID:19726876 more ...
CAV3	Dog	protein binding		ISO	Slc2a4 (Rattus norvegicus)	9068941		RGD	PMID:17277024 and REF_RGD_ID:1600213
CAV3	Dog	protein binding		ISO	LOC689314 (Rattus norvegicus)	9068941		RGD	PMID:17069850 and REF_RGD_ID:1599530
CAV3	Dog	protein binding		ISO	Adora1 (Rattus norvegicus) and Kcnj11 (Rattus norvegicus)	9068941		RGD	PMID:19181933 and REF_RGD_ID:7297041
CAV3	Dog	protein binding		ISO	Cav2 (Rattus norvegicus)	9068941		RGD	PMID:12649076 and REF_RGD_ID:1299267
CAV3	Dog	protein binding		ISO	Vdr (Rattus norvegicus)	9068941		RGD	PMID:20015453 and REF_RGD_ID:4889912
CAV3	Dog	protein binding	enables	ISO	UniProtKB:Q8NE08	9068941	PMID:32814053	IntAct	PMID:32814053
CAV3	Dog	protein binding		ISO	Akap6 (Rattus norvegicus)	9068941		RGD	PMID:20224290 and REF_RGD_ID:6902941
CAV3	Dog	protein binding	enables	ISO	UniProtKB:P0DOE7	9068941	PMID:25556234	IntAct	PMID:25556234
CAV3	Dog	protein binding	enables	ISO	PR:P05480	9068941	PMID:14600260	MGI	PMID:14600260
CAV3	Dog	protein binding	enables	ISO	PR:Q1XH17 and PR:Q9ESD7	9068941	PMID:19380584	MGI	PMID:19380584
CAV3	Dog	protein-containing complex binding	enables	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	sodium channel regulator activity	enables	IEA	UniProtKB:P56539 and ensembl:ENSP00000341940	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	transmembrane transporter binding	enables	IEA	UniProtKB:P51637 more ...	150520179		Ensembl	GO_REF:0000107
CAV3	Dog	transmembrane transporter binding	enables	IBA	MGI:107570 more ...	150520179		GO_Central	GO_REF:0000033

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CAV3	Dog	platelet-derived growth factor signaling pathway		ISO	CAV3 (Homo sapiens)	9068941		PID	PID:200162

PMID:22301074	PMID:30032202

CAV3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	9,384,901 - 9,398,055 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	9,384,901 - 9,401,196 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	9,418,382 - 9,431,544 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	9,414,987 - 9,428,087 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	9,414,987 - 9,428,087 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	9,136,869 - 9,150,024 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	9,481,732 - 9,494,836 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	9,455,880 - 9,468,982 (-)	NCBI		UU_Cfam_GSD_1.0

CAV3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	8,733,802 - 8,746,758 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	8,733,802 - 8,841,808 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	8,775,488 - 8,788,444 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	8,750,496 - 8,763,451 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	8,750,495 - 8,763,450	NCBI
Celera	3	8,710,271 - 8,723,238 (+)	NCBI		Celera
Cytogenetic Map	3	p25.3	NCBI
HuRef	3	8,709,553 - 8,722,499 (+)	NCBI		HuRef
CHM1_1	3	8,725,885 - 8,738,871 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	8,724,971 - 8,737,928 (+)	NCBI		T2T-CHM13v2.0

Cav3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	112,436,466 - 112,449,833 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	112,436,466 - 112,449,833 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	112,459,505 - 112,472,872 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	112,459,505 - 112,472,872 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	112,409,499 - 112,422,866 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	112,425,278 - 112,438,649 (+)	NCBI		MGSCv36	mm8
Celera	6	114,297,536 - 114,310,896 (+)	NCBI		Celera
Cytogenetic Map	6	E3	NCBI
cM Map	6	52.26	NCBI

Cav3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	147,137,993 - 147,153,967 (+)	NCBI		GRCr8
mRatBN7.2	4	145,582,168 - 145,598,142 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	145,582,060 - 145,598,137 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	150,974,343 - 150,990,337 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	146,755,146 - 146,771,143 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	145,376,415 - 145,392,431 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	144,382,945 - 144,398,919 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	144,382,945 - 144,398,917 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	207,683,202 - 207,699,176 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	148,294,428 - 148,310,380 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	148,539,268 - 148,555,221 (+)	NCBI
Celera	4	134,152,488 - 134,168,462 (+)	NCBI		Celera
Cytogenetic Map	4	q41	NCBI

Cav3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955561	325,944 - 335,914 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955561	326,008 - 335,911 (+)	NCBI	ChiLan1.0	ChiLan1.0

CAV3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	8,744,068 - 8,760,421 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	8,748,826 - 8,765,179 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	8,684,829 - 8,697,731 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	8,928,069 - 8,940,942 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	8,928,069 - 8,940,942 (+)	Ensembl	panpan1.1		panPan2

Cav3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404942	14,631,527 - 14,644,827 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936602	4,264,889 - 4,278,161 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936602	4,264,896 - 4,278,160 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CAV3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	65,117,795 - 65,131,273 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	65,117,868 - 65,130,886 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	72,400,156 - 72,412,174 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CAV3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	44,726,597 - 44,740,456 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	44,727,624 - 44,740,459 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	121,826,639 - 121,839,504 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cav3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624731	3,347,984 - 3,364,581 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624731	3,348,172 - 3,363,772 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in CAV3
178 total Variants

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

adipose tissue	alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	reproductive system	respiratory system
3	2	5	11	12	9	2	4	2	1	21	17	8	13	7


RefSeq Transcripts	NM_001287073	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AAEX04000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CO668259	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DN383911	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ195099	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAAHUQ010000232	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAAQRD010000058	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAAUVH010000291	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	REHQ01000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSCAFT00000008956 ⟹ ENSCAFP00000008308

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
CanFam3.1 Ensembl	20	9,384,901 - 9,401,196 (-)	Ensembl

Ensembl Acc Id:

ENSCAFT00845018664 ⟹ ENSCAFP00845014569

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
ROS_Cfam_1.0 Ensembl	20	9,414,987 - 9,428,087 (-)	Ensembl

RefSeq Acc Id:

NM_001287073 ⟹ NP_001274002

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
CanFam3.1	20	9,384,901 - 9,398,055 (-)	NCBI
Dog10K_Boxer_Tasha	20	9,418,382 - 9,431,544 (-)	NCBI
ROS_Cfam_1.0	20	9,414,987 - 9,428,087 (-)	NCBI
UMICH_Zoey_3.1	20	9,136,869 - 9,150,024 (-)	NCBI
UNSW_CanFamBas_1.0	20	9,481,732 - 9,494,836 (-)	NCBI
UU_Cfam_GSD_1.0	20	9,455,880 - 9,468,982 (-)	NCBI

Sequence:

show sequence

GACCGTGTCCCTGGCCCGAGCCTTTTCAGCCCCGCCGGCCACACGGCACAGGTCCCCTCCTGCGGCCCCCAGCCCCGCGATGATGGCCGAAGAGCACACAGACCTGGAGGCCCAGATCGTCAAGGACA
TCCACTTCAAGGAGATCGACCTGGTGAACCGAGACCCCAAGAACATCAACGAGGACATAGTGAAGGTGGATTTCGAAGACGTGATCGCAGAGCCTGTGGGCACGTACAGTTTTGACGGCGTGTGGAAA
GTGAGCTACACCACCTTCACCGTCTCCAAGTACTGGTGCTACCGCCTGCTGTCCACGCTGCTGGGGGTCCCGCTGGCCCTGCTCTGGGGCTTCCTGTTCGCCTGCATCTCTTTCTGCCACATCTGGGC
GGTGGTGCCATGCATTAAGAGCTACCTGATTGAGATCCAGTGCATCAGCCACATCTACTCCCTCTGCATCCGTACCTTCTGCAACCCGCTCTTTGCCGCCCTGGGCCAGATCTGCAGCAACATCAAGG
TGATGCTGCGGAAGGAAGTGTAAAGCCAGGTGGGGGCGAGGGGGGTGGCCGGGCAGGGGGAGTCAGGCCAGGCTGGCCCCCCACGGCACTGCTCCATGGGCCTGCTGGTGAGCGCTTGCTCTTTAGGG
ACTGCTATTTCCCCCCCAAGACACACAGTTTAGGGAAGCAAGCAAGAAAAGAGCCCTGCCACAGAAGCACAGTGGCCCTTCACTCTGCCCCCTACCCCACCTAGATGCCTCCGTGACCGGGCATGAGG
AACGATAATTTGCTAAGAGGCAGCTACTGCAAGTCTTTGCATTCACTTGTACTGTAACAGCATAAACCAGCACTCGGTTCCCACCTGGGGTCAACCCATCCGTGCATGCCACCCGGGAAAGCTACCAG
TGACTCTTGGCATTAGAAGGGTGGCTCCAATAAACGGTTTCGGTTGCATTTCGGGAA

hide sequence


Protein RefSeqs	NP_001274002	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	ABA40756	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSCAFP00000008308.5
	ENSCAFP00030015518.1
	ENSCAFP00040041209.1
	ENSCAFP00845014569
	ENSCAFP00845014569.1

RefSeq Acc Id:	NP_001274002 ⟸ NM_001287073
- UniProtKB:	Q3HTT5 (UniProtKB/TrEMBL), A0A8C0TW67 (UniProtKB/TrEMBL), A0A8C0QY57 (UniProtKB/TrEMBL), A0A8I3NGG6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MMAEEHTDLEAQIVKDIHFKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTF CNPLFAALGQICSNIKVMLRKEV hide sequence

Ensembl Acc Id:

ENSCAFP00000008308 ⟸ ENSCAFT00000008956

Ensembl Acc Id:

ENSCAFP00845014569 ⟸ ENSCAFT00845018664

RGD ID:

13686796

Promoter ID:

EPDNEW_C4864

Type:

single initiation site

Name:

CAV3_1

Description:

caveolin 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Dog Assembly	Chr	Position (strand)	Source
CanFam3.1	20	9,398,034 - 9,398,094	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSCAFG00000005557	Ensembl, UniProtKB/TrEMBL
	ENSCAFG00030009598	UniProtKB/TrEMBL
	ENSCAFG00040025323	UniProtKB/TrEMBL
	ENSCAFG00845010595	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSCAFT00000008956.5	UniProtKB/TrEMBL
	ENSCAFT00030017771.1	UniProtKB/TrEMBL
	ENSCAFT00040047206.1	UniProtKB/TrEMBL
	ENSCAFT00845018664	ENTREZGENE
	ENSCAFT00845018664.1	UniProtKB/TrEMBL
InterPro	Caveolin	UniProtKB/TrEMBL
	Caveolin_CS	UniProtKB/TrEMBL
KEGG Report	cfa:484671	UniProtKB/TrEMBL
NCBI Gene	CAV3	ENTREZGENE
PANTHER	PTHR10844	UniProtKB/TrEMBL
	PTHR10844:SF16	UniProtKB/TrEMBL
Pfam	Caveolin	UniProtKB/TrEMBL
PROSITE	CAVEOLIN	UniProtKB/TrEMBL
UniProt	A0A8C0QY57	ENTREZGENE
	A0A8C0TW67	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I3NGG6	ENTREZGENE, UniProtKB/TrEMBL
	Q3HTT5	ENTREZGENE, UniProtKB/TrEMBL
VGNC ID	VGNC:38753	ENTREZGENE

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - PID (archival)