Symbol:
Tlr9
Name:
toll-like receptor 9
RGD ID:
631352
Description:
Enables unmethylated CpG binding activity. Involved in several processes, including cellular response to lipopolysaccharide; microglial cell activation; and toll-like receptor signaling pathway. Predicted to be located in apical plasma membrane; basolateral plasma membrane; and cytoplasmic vesicle. Predicted to be active in early endosome membrane; endoplasmic reticulum; and plasma membrane. Biomarker of acute necrotizing pancreatitis; mastitis; and perinatal necrotizing enterocolitis. Human ortholog(s) of this gene implicated in several diseases, including allergic bronchopulmonary aspergillosis; cystic fibrosis; glomerulonephritis (multiple); hepatitis B; and lung disease (multiple). Orthologous to human TLR9 (toll like receptor 9); PARTICIPATES IN Toll-like receptor signaling pathway; Chagas disease pathway; malaria pathway; INTERACTS WITH 2,4,6-trinitrobenzenesulfonic acid; acrylamide; alpha-Zearalanol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TLR9 (toll like receptor 9) RGD
RGD
Mus musculus (house mouse):
Tlr9 (toll-like receptor 9) RGD
RGD
Chinchilla lanigera (long-tailed chinchilla):
Tlr9 (toll like receptor 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TLR9 (toll like receptor 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TLR9 (toll like receptor 9) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
TLR9 (toll like receptor 9)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tlr9 (toll-like receptor 9)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tlr9 (toll-like receptor 9)
Alliance
DIOPT (OMA|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
lron-15
Alliance
DIOPT (Hieranoid|InParanoid)
Drosophila melanogaster (fruit fly):
CG7896
Alliance
DIOPT (Hieranoid|InParanoid)
Drosophila melanogaster (fruit fly):
chp
Alliance
DIOPT (Hieranoid|InParanoid)
Xenopus tropicalis (tropical clawed frog):
tlr9
Alliance
DIOPT (OMA|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 115,743,407 - 115,747,523 (+) NCBI GRCr8 mRatBN7.2 8 106,864,680 - 106,868,796 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 106,864,680 - 106,868,796 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 112,489,116 - 112,493,226 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 110,688,285 - 110,692,395 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 108,531,077 - 108,535,188 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 114,916,122 - 114,920,171 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 114,916,122 - 114,920,171 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 114,279,020 - 114,283,069 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 8 106,185,754 - 106,189,869 (+) NCBI Celera Cytogenetic Map 8 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tlr9 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO Tlr9 (Mus musculus) 6480464 epigallocatechin gallate inhibits the reaction [Paraquat results in increased expression of TLR9 protein] CTD PMID:27890776 Tlr9 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO TLR9 (Homo sapiens) 6480464 epigallocatechin gallate inhibits the reaction [Paraquat results in increased expression of TLR9 protein] CTD PMID:27890776 Tlr9 Rat 1,2-dimethylhydrazine decreases expression ISO Tlr9 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of TLR9 mRNA CTD PMID:22206623 Tlr9 Rat 17beta-estradiol increases expression ISO Tlr9 (Mus musculus) 6480464 Estradiol results in increased expression of TLR9 mRNA CTD PMID:28811679 Tlr9 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Tlr9 (Mus musculus) 6480464 Tetrachlorodibenzodioxin inhibits the reaction [[CpG ODN 1826 binds to and results in increased activity of TLR9 protein] results in increased secretion of [IL12A protein binds to IL12B protein]] more ... CTD PMID:21097750 Tlr9 Rat 2,4,6-trinitrobenzenesulfonic acid multiple interactions EXP 6480464 oxymatrine inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of TLR9 protein] and Sulfasalazine inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of TLR9 protein] CTD PMID:35290143 Tlr9 Rat 2,4,6-trinitrobenzenesulfonic acid increases expression EXP 6480464 Trinitrobenzenesulfonic Acid results in increased expression of TLR9 protein CTD PMID:35290143 Tlr9 Rat 4-aminobenzhydrazide multiple interactions ISO TLR9 (Homo sapiens) 6480464 4-aminobenzhydrazide inhibits the reaction [hydroxyhydroquinone results in decreased expression of TLR9 mRNA] CTD PMID:24530881 Tlr9 Rat 5-fluorouracil increases secretion ISO Tlr9 (Mus musculus) 6480464 Fluorouracil results in increased secretion of TLR9 protein CTD PMID:32314717 Tlr9 Rat 5-fluorouracil multiple interactions ISO Tlr9 (Mus musculus) 6480464 Hydroxychloroquine inhibits the reaction [Fluorouracil results in increased secretion of TLR9 protein] CTD PMID:32314717 Tlr9 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of TLR9 mRNA CTD PMID:28959563 Tlr9 Rat aldehydo-D-glucose multiple interactions ISO Tlr9 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of TLR9 mRNA CTD PMID:37567420 Tlr9 Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of TLR9 mRNA CTD PMID:35163327 Tlr9 Rat Ammothamnine multiple interactions EXP 6480464 oxymatrine inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of TLR9 protein] CTD PMID:35290143 Tlr9 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of TLR9 mRNA CTD PMID:30779732 Tlr9 Rat benzene-1,2,4-triol multiple interactions ISO TLR9 (Homo sapiens) 6480464 4-aminobenzhydrazide inhibits the reaction [hydroxyhydroquinone results in decreased expression of TLR9 mRNA] CTD PMID:24530881 Tlr9 Rat benzene-1,2,4-triol decreases expression ISO TLR9 (Homo sapiens) 6480464 hydroxyhydroquinone results in decreased expression of TLR9 mRNA CTD PMID:24530881 Tlr9 Rat benzo[a]pyrene increases mutagenesis ISO TLR9 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of TLR9 gene CTD PMID:25435355 Tlr9 Rat benzo[a]pyrene affects methylation ISO TLR9 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of TLR9 promoter CTD PMID:27901495 Tlr9 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TLR9 mRNA CTD PMID:25181051 Tlr9 Rat bisphenol A increases expression ISO Tlr9 (Mus musculus) 6480464 bisphenol A results in increased expression of TLR9 mRNA CTD PMID:32156529 Tlr9 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TLR9 mRNA CTD PMID:30816183 more ... Tlr9 Rat bisphenol A decreases methylation ISO Tlr9 (Mus musculus) 6480464 bisphenol A results in decreased methylation of TLR9 promoter CTD PMID:27312807 Tlr9 Rat buta-1,3-diene decreases expression ISO Tlr9 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of TLR9 mRNA CTD PMID:29038090 Tlr9 Rat cadmium dichloride decreases expression ISO TLR9 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of TLR9 mRNA CTD PMID:38382870 Tlr9 Rat cadmium dichloride increases expression ISO TLR9 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of TLR9 mRNA CTD PMID:38568856 Tlr9 Rat CGP 52608 multiple interactions ISO TLR9 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TLR9 gene] CTD PMID:28238834 Tlr9 Rat chloroquine multiple interactions ISO TLR9 (Homo sapiens) 6480464 Chloroquine inhibits the reaction [CpG ODN 2006 results in increased activity of TLR9 protein] more ... CTD PMID:21398612 and PMID:24273604 Tlr9 Rat chloroquine decreases expression ISO TLR9 (Homo sapiens) 6480464 Chloroquine results in decreased expression of TLR9 protein CTD PMID:24273604 Tlr9 Rat chloroquine multiple interactions EXP 6480464 Chloroquine inhibits the reaction [[Diethylnitrosamine co-treated with N-nitrosomorpholine] results in increased expression of TLR9 protein] CTD PMID:24990399 Tlr9 Rat chloroquine decreases activity ISO Tlr9 (Mus musculus) 6480464 Chloroquine results in decreased activity of TLR9 protein CTD PMID:22595112 Tlr9 Rat chloroquine increases expression ISO TLR9 (Homo sapiens) 6480464 Chloroquine results in increased expression of TLR9 mRNA CTD PMID:24273604 Tlr9 Rat cisplatin multiple interactions ISO TLR9 (Homo sapiens) 6480464 [CPG-oligonucleotide results in decreased expression of TLR9 mRNA] which results in decreased susceptibility to Cisplatin CTD PMID:21823020 Tlr9 Rat cyclophosphamide multiple interactions ISO Tlr9 (Mus musculus) 6480464 Cyclophosphamide inhibits the reaction [Paraquat results in increased expression of TLR9 mRNA] and Fungal Polysaccharides inhibits the reaction [Cyclophosphamide results in increased expression of TLR9 protein] CTD PMID:29753871 and PMID:36031164 Tlr9 Rat cyclophosphamide increases expression ISO Tlr9 (Mus musculus) 6480464 Cyclophosphamide results in increased expression of TLR9 protein CTD PMID:29753871 Tlr9 Rat D-glucose multiple interactions ISO Tlr9 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of TLR9 mRNA CTD PMID:37567420 Tlr9 Rat dexamethasone multiple interactions ISO Tlr9 (Mus musculus) 6480464 Dexamethasone inhibits the reaction [Paraquat results in increased expression of TLR9 mRNA] CTD PMID:36031164 Tlr9 Rat dibutyl phthalate increases expression ISO Tlr9 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of TLR9 mRNA CTD PMID:21266533 Tlr9 Rat dimethylarsinic acid multiple interactions ISO Tlr9 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of TLR9 mRNA CTD PMID:34876320 Tlr9 Rat dioxygen multiple interactions ISO TLR9 (Homo sapiens) 6480464 Chloroquine inhibits the reaction [Oxygen deficiency results in increased expression of TLR9 mRNA] more ... CTD PMID:24273604 Tlr9 Rat dioxygen increases expression ISO TLR9 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of TLR9 mRNA CTD PMID:24273604 Tlr9 Rat ethion increases expression ISO Tlr9 (Mus musculus) 6480464 ethion results in increased expression of TLR9 mRNA CTD PMID:30225615 Tlr9 Rat ethion multiple interactions ISO Tlr9 (Mus musculus) 6480464 [ethion co-treated with Lipopolysaccharides] results in increased expression of TLR9 mRNA and [ethion co-treated with Lipopolysaccharides] results in increased expression of TLR9 protein CTD PMID:30225615 Tlr9 Rat fructose multiple interactions ISO Tlr9 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of TLR9 mRNA CTD PMID:37567420 Tlr9 Rat fulvestrant decreases expression ISO Tlr9 (Mus musculus) 6480464 fulvestrant results in decreased expression of TLR9 mRNA CTD PMID:28811679 Tlr9 Rat glucose multiple interactions ISO Tlr9 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of TLR9 mRNA CTD PMID:37567420 Tlr9 Rat glyphosate multiple interactions ISO Tlr9 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Glyphosate] results in increased expression of TLR9 mRNA CTD PMID:37567420 Tlr9 Rat hydroxychloroquine multiple interactions ISO Tlr9 (Mus musculus) 6480464 Hydroxychloroquine inhibits the reaction [Fluorouracil results in increased secretion of TLR9 protein] CTD PMID:32314717 Tlr9 Rat hydroxychloroquine decreases expression ISO TLR9 (Homo sapiens) 6480464 Hydroxychloroquine results in decreased expression of TLR9 protein CTD PMID:22513098 Tlr9 Rat Kukoamine B multiple interactions ISO Tlr9 (Mus musculus) 6480464 kukoamine B inhibits the reaction [Lipopolysaccharides results in increased expression of TLR9 mRNA] CTD PMID:21108626 Tlr9 Rat lead diacetate increases expression ISO Tlr9 (Mus musculus) 6480464 lead acetate results in increased expression of TLR9 mRNA CTD PMID:20542052 Tlr9 Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of TLR9 mRNA CTD PMID:35283115 Tlr9 Rat lipopolysaccharide increases expression ISO TLR9 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of TLR9 mRNA CTD PMID:22130863 Tlr9 Rat lipopolysaccharide increases expression ISO Tlr9 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of TLR9 mRNA and Lipopolysaccharides results in increased expression of TLR9 protein CTD PMID:21108626 and PMID:30225615 Tlr9 Rat lipopolysaccharide multiple interactions ISO Tlr9 (Mus musculus) 6480464 [ethion co-treated with Lipopolysaccharides] results in increased expression of TLR9 mRNA more ... CTD PMID:21108626 and PMID:30225615 Tlr9 Rat lipopolysaccharide multiple interactions EXP 6480464 [Lipopolysaccharides co-treated with Titanium] results in decreased expression of TLR9 mRNA CTD PMID:21308757 Tlr9 Rat mangiferin decreases expression ISO Tlr9 (Mus musculus) 6480464 mangiferin results in decreased expression of TLR9 mRNA CTD PMID:15135318 Tlr9 Rat melatonin multiple interactions ISO TLR9 (Homo sapiens) 6480464 Melatonin inhibits the reaction [Paraquat results in increased expression of TLR9 protein] CTD PMID:37028639 Tlr9 Rat methamphetamine decreases expression ISO Tlr9 (Mus musculus) 6480464 Methamphetamine results in decreased expression of TLR9 mRNA CTD PMID:32768653 Tlr9 Rat methylarsonic acid multiple interactions ISO Tlr9 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of TLR9 mRNA CTD PMID:34876320 Tlr9 Rat N-ethyl-N-nitrosourea increases mutagenesis ISO Tlr9 (Mus musculus) 6480464 Ethylnitrosourea results in increased mutagenesis of TLR9 gene CTD PMID:16724327 Tlr9 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with N-nitrosomorpholine] results in increased expression of TLR9 protein and Chloroquine inhibits the reaction [[Diethylnitrosamine co-treated with N-nitrosomorpholine] results in increased expression of TLR9 protein] CTD PMID:24990399 Tlr9 Rat N-nitrosomorpholine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with N-nitrosomorpholine] results in increased expression of TLR9 protein and Chloroquine inhibits the reaction [[Diethylnitrosamine co-treated with N-nitrosomorpholine] results in increased expression of TLR9 protein] CTD PMID:24990399 Tlr9 Rat nitrates multiple interactions ISO Tlr9 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of TLR9 mRNA CTD PMID:35964746 Tlr9 Rat o-anisidine affects expression ISO TLR9 (Homo sapiens) 6480464 2-anisidine affects the expression of TLR9 mRNA CTD PMID:28089782 Tlr9 Rat ozone decreases expression ISO Tlr9 (Mus musculus) 6480464 Ozone results in decreased expression of TLR9 mRNA CTD PMID:26342085 Tlr9 Rat ozone multiple interactions ISO Tlr9 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of TLR9 mRNA CTD PMID:34911549 Tlr9 Rat ozone increases expression ISO TLR9 (Homo sapiens) 6480464 Ozone results in increased expression of TLR9 mRNA CTD PMID:23665308 Tlr9 Rat paracetamol multiple interactions ISO Tlr9 (Mus musculus) 6480464 TLR9 protein affects the reaction [Acetaminophen results in increased expression of IL1B mRNA] CTD PMID:19164858 Tlr9 Rat paracetamol affects expression ISO Tlr9 (Mus musculus) 6480464 Acetaminophen affects the expression of TLR9 mRNA CTD PMID:17562736 Tlr9 Rat paracetamol increases response to substance ISO Tlr9 (Mus musculus) 6480464 TLR9 protein results in increased susceptibility to Acetaminophen CTD PMID:19164858 Tlr9 Rat paraquat increases expression ISO Tlr9 (Mus musculus) 6480464 Paraquat results in increased expression of TLR9 mRNA and Paraquat results in increased expression of TLR9 protein CTD PMID:25304964 more ... Tlr9 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of TLR9 mRNA CTD PMID:32680482 Tlr9 Rat paraquat multiple interactions ISO TLR9 (Homo sapiens) 6480464 [BNIP3 protein co-treated with PINK1 protein] affects the reaction [Paraquat results in increased expression of TLR9 protein] more ... CTD PMID:27890776 more ... Tlr9 Rat paraquat multiple interactions ISO Tlr9 (Mus musculus) 6480464 Cyclophosphamide inhibits the reaction [Paraquat results in increased expression of TLR9 mRNA] more ... CTD PMID:27890776 more ... Tlr9 Rat paraquat increases expression ISO TLR9 (Homo sapiens) 6480464 Paraquat results in increased expression of TLR9 mRNA and Paraquat results in increased expression of TLR9 protein CTD PMID:27890776 more ... Tlr9 Rat pentachlorophenol increases expression ISO Tlr9 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of TLR9 mRNA CTD PMID:23892564 Tlr9 Rat phenytoin multiple interactions ISO Tlr9 (Mus musculus) 6480464 [Phenytoin co-treated with Buthionine Sulfoximine] results in decreased expression of TLR9 mRNA CTD PMID:23986454 Tlr9 Rat phenytoin decreases expression ISO Tlr9 (Mus musculus) 6480464 Phenytoin results in decreased expression of TLR9 mRNA CTD PMID:23986454 Tlr9 Rat pirinixic acid decreases expression ISO Tlr9 (Mus musculus) 6480464 pirinixic acid results in decreased expression of TLR9 mRNA CTD PMID:23811191 Tlr9 Rat progesterone increases expression ISO Tlr9 (Mus musculus) 6480464 Progesterone results in increased expression of TLR9 mRNA and Progesterone results in increased expression of TLR9 protein CTD PMID:21549006 Tlr9 Rat rotenone increases expression ISO TLR9 (Homo sapiens) 6480464 Rotenone results in increased expression of TLR9 mRNA CTD PMID:29955902 Tlr9 Rat S-butyl-DL-homocysteine (S,R)-sulfoximine multiple interactions ISO Tlr9 (Mus musculus) 6480464 [Phenytoin co-treated with Buthionine Sulfoximine] results in decreased expression of TLR9 mRNA CTD PMID:23986454 Tlr9 Rat sodium arsenate multiple interactions ISO Tlr9 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of TLR9 mRNA CTD PMID:34876320 Tlr9 Rat sodium arsenite multiple interactions ISO Tlr9 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of TLR9 mRNA CTD PMID:34876320 Tlr9 Rat sulfasalazine multiple interactions EXP 6480464 Sulfasalazine inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of TLR9 protein] CTD PMID:35290143 Tlr9 Rat tamoxifen decreases expression ISO Tlr9 (Mus musculus) 6480464 Tamoxifen results in decreased expression of TLR9 mRNA CTD PMID:28811679 Tlr9 Rat Theaflavin 3,3'-digallate affects expression ISO TLR9 (Homo sapiens) 6480464 theaflavin-3 and 3'-digallate affects the expression of TLR9 mRNA CTD PMID:34925699 Tlr9 Rat titanium atom multiple interactions EXP 6480464 [Lipopolysaccharides co-treated with Titanium] results in decreased expression of TLR9 mRNA CTD PMID:21308757 Tlr9 Rat titanium dioxide increases expression ISO Tlr9 (Mus musculus) 6480464 titanium dioxide results in increased expression of TLR9 mRNA CTD PMID:29264374 Tlr9 Rat triptonide increases expression ISO Tlr9 (Mus musculus) 6480464 triptonide results in increased expression of TLR9 mRNA CTD PMID:33045310 Tlr9 Rat tungsten decreases expression ISO Tlr9 (Mus musculus) 6480464 Tungsten results in decreased expression of TLR9 mRNA CTD PMID:30912803 Tlr9 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of TLR9 mRNA CTD PMID:18629315
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-trinitrobenzenesulfonic acid (EXP) 4-aminobenzhydrazide (ISO) 5-fluorouracil (ISO) acrylamide (EXP) aldehydo-D-glucose (ISO) alpha-Zearalanol (EXP) Ammothamnine (EXP) amphetamine (EXP) benzene-1,2,4-triol (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) buta-1,3-diene (ISO) cadmium dichloride (ISO) CGP 52608 (ISO) chloroquine (EXP,ISO) cisplatin (ISO) cyclophosphamide (ISO) D-glucose (ISO) dexamethasone (ISO) dibutyl phthalate (ISO) dimethylarsinic acid (ISO) dioxygen (ISO) ethion (ISO) fructose (ISO) fulvestrant (ISO) glucose (ISO) glyphosate (ISO) hydroxychloroquine (ISO) Kukoamine B (ISO) lead diacetate (ISO) lidocaine (EXP) lipopolysaccharide (EXP,ISO) mangiferin (ISO) melatonin (ISO) methamphetamine (ISO) methylarsonic acid (ISO) N-ethyl-N-nitrosourea (ISO) N-nitrosodiethylamine (EXP) N-nitrosomorpholine (EXP) nitrates (ISO) o-anisidine (ISO) ozone (ISO) paracetamol (ISO) paraquat (EXP,ISO) pentachlorophenol (ISO) phenytoin (ISO) pirinixic acid (ISO) progesterone (ISO) rotenone (ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sulfasalazine (EXP) tamoxifen (ISO) Theaflavin 3,3'-digallate (ISO) titanium atom (EXP) titanium dioxide (ISO) triptonide (ISO) tungsten (ISO) vinclozolin (EXP)
Biological Process
activation of innate immune response (IEA,ISO) canonical NF-kappaB signal transduction (IBA,IEA,ISO) cellular response to chloroquine (IEA,ISO) cellular response to lipopolysaccharide (IEP) cellular response to metal ion (IEP) defense response to Gram-negative bacterium (IEA) defense response to other organism (IEA) defense response to virus (IBA,IEA,IMP,ISO) detection of molecule of bacterial origin (IEA,ISO) immune response (IEA,ISO) immune system process (IEA) inflammatory response (IEA) innate immune response (IEA,ISO) maintenance of gastrointestinal epithelium (IEA,ISO) male gonad development (IEP) microglial cell activation (IDA) MyD88-dependent toll-like receptor signaling pathway (IEA,ISO) negative regulation of ATPase-coupled calcium transmembrane transporter activity (ISO) negative regulation of ERK1 and ERK2 cascade (IEA,ISO) pattern recognition receptor signaling pathway (IEA) positive regulation of autophagy (IDA) positive regulation of B cell activation (IEA,ISO) positive regulation of B cell proliferation (IEA,ISO) positive regulation of canonical NF-kappaB signal transduction (IEA,ISO) positive regulation of chemokine production (IEA,ISO) positive regulation of cytokine production (IEA,ISO) positive regulation of gene expression (IEA,ISO) positive regulation of granulocyte macrophage colony-stimulating factor production (IEA,ISO) positive regulation of immunoglobulin production (IEA,ISO) positive regulation of inflammatory response (ISO) positive regulation of interferon-alpha production (IEA,ISO) positive regulation of interferon-beta production (IEA,ISO) positive regulation of interleukin-10 production (IEA,ISO) positive regulation of interleukin-12 production (IEA,ISO) positive regulation of interleukin-18 production (IEA,ISO) positive regulation of interleukin-6 production (IBA,IEA,ISO) positive regulation of interleukin-8 production (IEA,ISO) positive regulation of intestinal epithelial cell development (IEA,ISO) positive regulation of intracellular signal transduction (IEA) positive regulation of JNK cascade (IEA,ISO) positive regulation of MAPK cascade (IEA,ISO) positive regulation of non-canonical NF-kappaB signal transduction (IEA) positive regulation of toll-like receptor 9 signaling pathway (IEA,ISO) positive regulation of transcription by RNA polymerase II (IEA,ISO) positive regulation of tumor necrosis factor production (IEA,ISO) positive regulation of type I interferon production (IEA) positive regulation of type II interferon production (IEA,ISO) regulation of B cell activation (IEA,ISO) regulation of B cell differentiation (IEA,ISO) regulation of dendritic cell cytokine production (IEA,ISO) regulation of inflammatory response (IEA,ISO) regulation of protein phosphorylation (ISO) response to virus (IEA,ISO) signal transduction (IEA) toll-like receptor 9 signaling pathway (IEA,ISO) toll-like receptor signaling pathway (IBA,IDA,IEA,ISO)
Cellular Component
apical plasma membrane (IEA,ISO) basolateral plasma membrane (IEA,ISO) cytoplasm (IEA,ISO) cytoplasmic vesicle (IEA) early endosome membrane (IEA,ISO) early phagosome (IEA,ISO) endolysosome (IEA,ISO) endoplasmic reticulum (IEA,ISO) endoplasmic reticulum membrane (IEA) endosome (IEA,ISO) lysosome (IEA,ISO) phagocytic vesicle (IEA,ISO) plasma membrane (IBA,IEA,ISO)
1.
Toll-like receptor 9 acts at an early stage in host defence against pneumococcal infection.
Albiger B, etal., Cell Microbiol. 2007 Mar;9(3):633-44. Epub 2006 Sep 27.
2.
TLR9 Mediates Remote Liver Injury following Severe Renal Ischemia Reperfusion.
Bakker PJ, etal., PLoS One. 2015 Sep 11;10(9):e0137511. doi: 10.1371/journal.pone.0137511. eCollection 2015.
3.
TLR4 links podocytes with the innate immune system to mediate glomerular injury.
Banas MC, etal., J Am Soc Nephrol. 2008 Apr;19(4):704-13. doi: 10.1681/ASN.2007040395. Epub 2008 Feb 6.
4.
Hepatic expression of toll-like receptors 3, 4, and 9 in primary biliary cirrhosis and chronic hepatitis C.
Benias PC, etal., Clin Res Hepatol Gastroenterol. 2012 Oct;36(5):448-54. doi: 10.1016/j.clinre.2012.07.001. Epub 2012 Sep 29.
5.
Involvement of renal tubular Toll-like receptor 9 in the development of tubulointerstitial injury in systemic lupus.
Benigni A, etal., Arthritis Rheum. 2007 May;56(5):1569-78.
6.
Influence of perineurial cells and Toll-like receptors 2 and 9 on Herpes simplex type 1 entry to the central nervous system in rat encephalitis.
Bereczky-Veress B, etal., PLoS One. 2010 Aug 27;5(8):e12350.
7.
Comparative proteomics study reveals that bacterial CpG motifs induce tumor cell autophagy in vitro and in vivo.
Bertin S, etal., Mol Cell Proteomics. 2008 Jul 15.
8.
Toll-like receptor 9 regulates the lung macrophage phenotype and host immunity in murine pneumonia caused by Legionella pneumophila.
Bhan U, etal., Infect Immun. 2008 Jul;76(7):2895-904. Epub 2008 Apr 21.
9.
TLR9 is required for protective innate immunity in Gram-negative bacterial pneumonia: role of dendritic cells.
Bhan U, etal., J Immunol. 2007 Sep 15;179(6):3937-46.
10.
Cooperative interactions between TLR4 and TLR9 regulate interleukin 23 and 17 production in a murine model of gram negative bacterial pneumonia.
Bhan U, etal., PLoS One. 2010 Mar 26;5(3):e9896.
11.
Identification of Toll-like receptors in the rat (Rattus norvegicus): messenger RNA expression in the male reproductive tract under conditions of androgen variation.
Biswas B, etal., Am J Reprod Immunol. 2009 Oct;62(4):243-52. Epub 2009 Aug 24.
12.
A TLR2 polymorphism is associated with type 1 diabetes and allergic asthma.
Bjornvold M, etal., Genes Immun. 2009 Mar;10(2):181-7. Epub 2009 Jan 15.
13.
Expression of Toll-like receptors in healthy and allergic conjunctiva.
Bonini S, etal., Ophthalmology. 2005 Sep;112(9):1528; discussion 1548-9.
14.
Differential regulation of Toll-like receptor mRNAs in experimental murine central nervous system infections.
Bottcher T, etal., Neurosci Lett. 2003 Jun 19;344(1):17-20.
15.
TLR2, TLR4 and TLR9 are differentially modulated in liver lethally injured from BALB/c and C57BL/6 mice during Trypanosoma cruzi acute infection.
Carrera-Silva EA, etal., Mol Immunol. 2008 Aug;45(13):3580-8. doi: 10.1016/j.molimm.2008.05.004. Epub 2008 Jun 18.
16.
Polymorphisms in Toll-like receptor genes and susceptibility to infections in allogeneic stem cell transplantation.
Carvalho A, etal., Exp Hematol. 2009 Sep;37(9):1022-9. Epub 2009 Jun 17.
17.
Polymorphisms in toll-like receptor genes and susceptibility to pulmonary aspergillosis.
Carvalho A, etal., J Infect Dis. 2008 Feb 15;197(4):618-21.
18.
Blockade of TLR9 signaling in B cells impaired anti-dsDNA antibody production in mice induced by activated syngenic lymphocyte-derived DNA immunization.
Chen M, etal., Mol Immunol. 2011 Jul;48(12-13):1532-9. doi: 10.1016/j.molimm.2011.04.016. Epub 2011 May 18.
19.
Toll-like receptor 9 polymorphisms and Hepatitis B virus clearance in Moroccan chronic carriers.
Chihab H, etal., Gene. 2019 Mar 1;687:212-218. doi: 10.1016/j.gene.2018.11.041. Epub 2018 Nov 16.
20.
Toll-like receptor 7 and TLR9 dictate autoantibody specificity and have opposing inflammatory and regulatory roles in a murine model of lupus.
Christensen SR, etal., Immunity. 2006 Sep;25(3):417-28.
21.
Toll-like receptor expression on peripheral blood mononuclear cells in asthmatics; implications for asthma management.
Chun E, etal., J Clin Immunol. 2010 May;30(3):459-64. Epub 2010 Jan 14.
22.
Hepatitis C may enhance key amplifiers of psoriasis.
Chun K, etal., J Eur Acad Dermatol Venereol. 2017 Apr;31(4):672-678. doi: 10.1111/jdv.13578. Epub 2016 May 17.
23.
Direct evidence that toll-like receptor 9 (TLR9) functionally binds plasmid DNA by specific cytosine-phosphate-guanine motif recognition.
Cornelie S, etal., J Biol Chem 2004 Apr 9;279(15):15124-9. Epub 2004 Jan 20.
24.
Both bone marrow-derived and non-bone marrow-derived cells contribute to AIM2 and NLRP3 inflammasome activation in a MyD88-dependent manner in dietary steatohepatitis.
Csak T, etal., Liver Int. 2014 Oct;34(9):1402-13. doi: 10.1111/liv.12537. Epub 2014 Apr 17.
25.
Association between toll-like receptor expression and human papillomavirus type 16 persistence.
Daud II, etal., Int J Cancer. 2011 Feb 15;128(4):879-86. doi: 10.1002/ijc.25400.
26.
Expression of TLR4 and TLR9 mRNA in Lewis rats with experimental allergic neuritis.
Deng YN and Zhou WB, Neuroimmunomodulation. 2007;14(6):337-43. Epub 2008 Apr 23.
27.
Human lung cancer cells express functionally active Toll-like receptor 9.
Droemann D, etal., Respir Res. 2005 Jan 4;6:1.
28.
Evaluation of neonatal Toll-like receptors 3 (c.1377C/T) and 9 (G2848A) gene polymorphisms in HBV intrauterine transmission susceptibility.
Gao Y, etal., Epidemiol Infect. 2015 Jul;143(9):1868-75. doi: 10.1017/S0950268814002921. Epub 2014 Nov 12.
29.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
30.
A multi-centre study of candidate genes for wheeze and allergy: the International Study of Asthma and Allergies in Childhood Phase 2.
Genuneit J, etal., Clin Exp Allergy. 2009 Dec;39(12):1875-88.
31.
Systemic inflammation and liver injury following hemorrhagic shock and peripheral tissue trauma involve functional TLR9 signaling on bone marrow-derived cells and parenchymal cells.
Gill R, etal., Shock. 2011 Feb;35(2):164-70. doi: 10.1097/SHK.0b013e3181eddcab.
32.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
33.
Combinations of TLR and NOD2 ligands stimulate rat microglial P2X4R expression.
Guo LH, etal., Biochem Biophys Res Commun. 2006 Oct 27;349(3):1156-62. Epub 2006 Sep 1.
34.
Dysregulation of innate immune receptors on neutrophils in chronic granulomatous disease.
Hartl D, etal., J Allergy Clin Immunol. 2008 Feb;121(2):375-382.e9. Epub 2007 Dec 26.
35.
Effects of oligodeoxynucleotide with CCT repeats on chronic graft versus host disease induced experimental lupus nephritis in mice.
He C, etal., Clin Immunol. 2011 Sep;140(3):300-6. doi: 10.1016/j.clim.2011.04.016. Epub 2011 May 4.
36.
Therapeutic effect of leflunomide on the development of experimental lupus nephritis in mice.
He C, etal., Rheumatol Int. 2012 Mar;32(3):633-8. doi: 10.1007/s00296-010-1630-z. Epub 2010 Dec 3.
37.
Toll-like receptors and their adaptors are regulated in macrophages after phagocytosis of lipopolysaccharide-coated titanium particles.
Hirayama T, etal., J Orthop Res. 2011 Feb 9. doi: 10.1002/jor.21369.
38.
A novel small-molecule enantiomeric analogue of traditional (-)-morphinans has specific TLR9 antagonist properties and reduces sterile inflammation-induced organ damage.
Hoque R, etal., J Immunol. 2013 Apr 15;190(8):4297-304. doi: 10.4049/jimmunol.1202184. Epub 2013 Mar 15.
39.
Reduced toll-like receptor 9 expression on peripheral CD14+ monocytes of chronic hepatitis B patients and its restoration by effective therapy.
Huang YW, etal., Antivir Ther. 2014;19(7):637-43. doi: 10.3851/IMP2762. Epub 2014 Mar 12.
40.
Toll-like receptor 9 mediates CpG oligonucleotide-induced cellular invasion.
Ilvesaro JM, etal., Mol Cancer Res. 2008 Oct;6(10):1534-43. doi: 10.1158/1541-7786.MCR-07-2005.
41.
Acetaminophen-induced hepatotoxicity in mice is dependent on Tlr9 and the Nalp3 inflammasome.
Imaeda AB, etal., J Clin Invest. 2009 Feb;119(2):305-14. doi: 10.1172/JCI35958. Epub 2009 Jan 26.
42.
TLR9 activation is a key event for the maintenance of a mycobacterial antigen-elicited pulmonary granulomatous response.
Ito T, etal., Eur J Immunol. 2007 Oct;37(10):2847-55.
43.
Polymorphisms in innate immunity genes associated with development of bronchiolitis obliterans after lung transplantation.
Kastelijn EA, etal., J Heart Lung Transplant. 2010 Jun;29(6):665-71. Epub 2010 Mar 15.
44.
Expression of TLR2, TLR4, and TLR9 in dermatomyositis and polymyositis.
Kim GT, etal., Clin Rheumatol. 2010 Mar;29(3):273-9. doi: 10.1007/s10067-009-1316-7. Epub 2009 Dec 2.
45.
CpG oligonucleotide activates Toll-like receptor 9 and causes lung inflammation in vivo.
Knuefermann P, etal., Respir Res. 2007 Oct 9;8:72.
46.
A comprehensive genotype-phenotype interaction of different Toll-like receptor variations in a renal transplant cohort.
Kruger B, etal., Clin Sci (Lond). 2010 Dec;119(12):535-44. doi: 10.1042/CS20100190.
47.
Pathogen recognition by the innate immune system.
Kumar H, etal., Int Rev Immunol. 2011 Feb;30(1):16-34.
48.
Toll-like receptors and CD14 genes polymorphisms and susceptibility to asthma in Tunisian children.
Lachheb J, etal., Tissue Antigens. 2008 May;71(5):417-25. Epub 2008 Feb 28.
49.
Comprehensive genetic assessment of a functional TLR9 promoter polymorphism: no replicable association with asthma or asthma-related phenotypes.
Lange NE, etal., BMC Med Genet. 2011 Feb 15;12:26.
50.
TLR4 and TLR9 Expression in Different Phenotypes of Rhinitis.
Lauriello M, etal., Int J Otolaryngol. 2012;2012:925164. doi: 10.1155/2012/925164. Epub 2012 Apr 10.
51.
Increased toll-like receptor 9 expression in cervical neoplasia.
Lee JW, etal., Mol Carcinog. 2007 Nov;46(11):941-7.
52.
Small interfering RNA targeting Toll-like receptor 9 protects mice against polymicrobial septic acute kidney injury.
Liu L, etal., Nephron Exp Nephrol. 2012;122(1-2):51-61. doi: 10.1159/000346953. Epub 2013 Mar 15.
53.
Changes in intestinal Toll-like receptors and cytokines precede histological injury in a rat model of necrotizing enterocolitis.
Liu Y, etal., Am J Physiol Gastrointest Liver Physiol. 2009 Sep;297(3):G442-50. Epub 2009 Jul 16.
54.
The T-1237C polymorphism of the Toll-like receptor-9 gene is associated with chronic kidney disease in a Han Chinese population.
Lu KC, etal., Tohoku J Exp Med. 2011;225(2):109-16.
55.
Neutrophil Toll-Like Receptor 9 Expression and the Systemic Inflammatory Response in Acetaminophen-Induced Acute Liver Failure.
Manakkat Vijay GK, etal., Crit Care Med. 2016 Jan;44(1):43-53. doi: 10.1097/CCM.0000000000001309.
56.
Immunohistochemical detection of toll-like receptor-2, -4 and -9 in exocrine glands associated with rat alimentary tract.
Mantani Y, etal., J Vet Med Sci. 2012 Nov;74(11):1429-38. Epub 2012 Jun 19.
57.
[TLR9 expression is positively correlated with the levels of CD38, HLA-DR and CD95 on peripheral blood mononuclear cells in chronic HBV infected patients].
Mao X, etal., Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi. 2016 May;32(5):660-5.
58.
TLR9 is expressed in idiopathic interstitial pneumonia and its activation promotes in vitro myofibroblast differentiation.
Meneghin A, etal., Histochem Cell Biol. 2008 Nov;130(5):979-92. Epub 2008 Jul 17.
59.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
60.
TLR9 is up-regulated in human and murine NASH: pivotal role in inflammatory recruitment and cell survival.
Mridha AR, etal., Clin Sci (Lond). 2017 Jul 24;131(16):2145-2159. doi: 10.1042/CS20160838. Print 2017 Aug 15.
61.
Polymorphisms in the Fc gamma receptor IIIA and Toll-like receptor 9 are associated with protection against severe malarial anemia and changes in circulating gamma interferon levels.
Munde EO, etal., Infect Immun. 2012 Dec;80(12):4435-43. doi: 10.1128/IAI.00945-12. Epub 2012 Oct 8.
62.
Increase in NF-kappaB binding affinity of the variant C allele of the toll-like receptor 9 -1237T/C polymorphism is associated with Helicobacter pylori-induced gastric disease.
Ng MT, etal., Infect Immun. 2010 Mar;78(3):1345-52. Epub 2009 Dec 28.
63.
Exacerbated autoimmunity in the absence of TLR9 in MRL.Fas(lpr) mice depends on Ifnar1.
Nickerson KM, etal., J Immunol. 2013 Apr 15;190(8):3889-94. doi: 10.4049/jimmunol.1203525. Epub 2013 Mar 6.
64.
Glomerular expression of toll-like receptor-9 in lupus nephritis but not in normal kidneys: implications for the amplification of the inflammatory response.
Papadimitraki ED, etal., Lupus. 2009 Aug;18(9):831-5. doi: 10.1177/0961203309103054.
65.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
66.
Association between -1486 T>C and +1174 G>A single nucleotide polymorphisms in TLR9 gene and severity of lupus nephritis.
Ramachandran R, etal., Indian J Nephrol. 2012 Mar;22(2):125-9. doi: 10.4103/0971-4065.97133.
67.
Sinonasal epithelial cell expression of toll-like receptor 9 is decreased in chronic rhinosinusitis with polyps.
Ramanathan M Jr, etal., Am J Rhinol. 2007 Jan-Feb;21(1):110-6.
68.
Th2 cytokines associated with chronic rhinosinusitis with polyps down-regulate the antimicrobial immune function of human sinonasal epithelial cells.
Ramanathan M Jr, etal., Am J Rhinol. 2008 Mar-Apr;22(2):115-21.
69.
Intranasal CpG therapy attenuated experimental fungal asthma in a TLR9-dependent and -independent manner.
Ramaprakash H and Hogaboam CM, Int Arch Allergy Immunol. 2010;152(2):98-112. Epub 2009 Dec 16.
70.
Toll-like receptor 9 modulates immune responses to Aspergillus fumigatus conidia in immunodeficient and allergic mice.
Ramaprakash H, etal., Infect Immun. 2009 Jan;77(1):108-19. Epub 2008 Oct 20.
71.
GOA pipeline
RGD automated data pipeline
72.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
73.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
74.
Comprehensive gene review and curation
RGD comprehensive gene curation
75.
Expression of toll-like receptors 2, 4 and 9 is increased in gingival tissue from patients with type 2 diabetes and chronic periodontitis.
Rojo-Botello NR, etal., J Periodontal Res. 2012 Feb;47(1):62-73. doi: 10.1111/j.1600-0765.2011.01405.x. Epub 2011 Aug 17.
76.
Absent Toll-like receptor-9 expression predicts poor prognosis in renal cell carcinoma.
Ronkainen H, etal., J Exp Clin Cancer Res. 2011 Sep 19;30:84. doi: 10.1186/1756-9966-30-84.
77.
Innate recognition network driving herpes simplex virus-induced corneal immunopathology: role of the toll pathway in early inflammatory events in stromal keratitis.
Sarangi PP, etal., J Virol. 2007 Oct;81(20):11128-38. Epub 2007 Aug 8.
78.
Mechanistic investigation of immunosuppression in patients with condyloma acuminata.
Shi YJ, etal., Mol Med Rep. 2013 Aug;8(2):480-6. doi: 10.3892/mmr.2013.1511. Epub 2013 Jun 6.
79.
TLR4 and TLR9 are induced in oral lichen planus.
Siponen M, etal., J Oral Pathol Med. 2012 Nov;41(10):741-7. doi: 10.1111/j.1600-0714.2012.01169.x. Epub 2012 Jun 5.
80.
Dominance of E. coli phagocytosis over LPS in the inflammatory response of microglia.
Sivagnanam V, etal., J Neuroimmunol. 2010 Oct 8;227(1-2):111-9. Epub 2010 Jul 22.
81.
Toll-like receptor signaling and SIGIRR in renal fibrosis upon unilateral ureteral obstruction.
Skuginna V, etal., PLoS One. 2011 Apr 22;6(4):e19204. doi: 10.1371/journal.pone.0019204.
82.
Association studies of Toll-like receptor gene polymorphisms with allograft survival in renal transplant recipients of North India.
Srivastava P, etal., Clin Transplant. 2012 Jul-Aug;26(4):581-8. doi: 10.1111/j.1399-0012.2011.01577.x. Epub 2012 Jan 17.
83.
Effect of probiotic treatment on deranged neutrophil function and cytokine responses in patients with compensated alcoholic cirrhosis.
Stadlbauer V, etal., J Hepatol. 2008 Jun;48(6):945-51. Epub 2008 Mar 25.
84.
Genes that determine immunology and inflammation modify the basic defect of impaired ion conductance in cystic fibrosis epithelia.
Stanke F, etal., J Med Genet. 2011 Jan;48(1):24-31. Epub 2010 Sep 12.
85.
Toll-like receptor 9 enhances nephritogenic immunity and glomerular leukocyte recruitment, exacerbating experimental crescentic glomerulonephritis.
Summers SA, etal., Am J Pathol. 2010 Nov;177(5):2234-44. doi: 10.2353/ajpath.2010.100153. Epub 2010 Sep 16.
86.
Toll-like receptor 9 affects severity of IgA nephropathy.
Suzuki H, etal., J Am Soc Nephrol. 2008 Dec;19(12):2384-95. doi: 10.1681/ASN.2007121311. Epub 2008 Sep 5.
87.
Toll-like receptors in the interface membrane around loosening total hip replacement implants.
Takagi M, etal., J Biomed Mater Res A. 2007 Jun 15;81(4):1017-26.
88.
The expression of TLR2, TLR4 and TLR9 in the epidermis of patients with cutaneous leishmaniasis.
Tuon FF, etal., J Dermatol Sci. 2010 Jul;59(1):55-7. doi: 10.1016/j.jdermsci.2010.04.009. Epub 2010 May 20.
89.
Endosomal toll-like receptor gene polymorphisms and susceptibility to HIV and HCV co-infection - Differential influence in individuals with distinct ethnic background.
Valverde-Villegas JM, etal., Hum Immunol. 2017 Feb;78(2):221-226. doi: 10.1016/j.humimm.2017.01.001. Epub 2017 Jan 4.
90.
Polymorphisms in Toll-like receptors 2, 4, and 9 are highly associated with hearing loss in survivors of bacterial meningitis.
van Well GT, etal., PLoS One. 2012;7(5):e35837. doi: 10.1371/journal.pone.0035837. Epub 2012 May 25.
91.
Variants in toll-like receptors 2 and 9 influence susceptibility to pulmonary tuberculosis in Caucasians, African-Americans, and West Africans.
Velez DR, etal., Hum Genet. 2010 Jan;127(1):65-73. Epub 2009 Sep 22.
92.
Increased Toll-like Receptor-MyD88-NFκB-Proinflammatory neuroimmune signaling in the orbitofrontal cortex of humans with alcohol use disorder.
Vetreno RP, etal., Alcohol Clin Exp Res. 2021 Sep;45(9):1747-1761. doi: 10.1111/acer.14669. Epub 2021 Aug 20.
93.
Association study of a single nucleotide polymorphism in the exon 2 region of toll-like receptor 9 (TLR9) gene with susceptibility to systemic lupus erythematosus among Chinese.
Xu CJ, etal., Mol Biol Rep. 2009 Nov;36(8):2245-8. Epub 2009 Jan 7.
94.
Toll-like receptor 7 and 9 expression in peripheral blood mononuclear cells from patients with chronic hepatitis B and related hepatocellular carcinoma.
Xu N, etal., Acta Pharmacol Sin. 2008 Feb;29(2):239-44. doi: 10.1111/j.1745-7254.2008.00711.x.
95.
Toll-like receptor 9 is expressed in rat pancreas and is involved in cerulein-induced pancreatitis.
Zeng YJ, etal., Pancreas. 2008 Mar;36(2):212-4.
96.
Phosphorothioate-modified CpG oligodeoxynucleotide (CpG ODN) induces apoptosis of human hepatocellular carcinoma cells independent of TLR9.
Zhang Y, etal., Cancer Immunol Immunother. 2014 Apr;63(4):357-67. doi: 10.1007/s00262-014-1518-y. Epub 2014 Jan 23.
97.
Increased expression of Toll-like receptors 4 and 9 in human lung cancer.
Zhang YB, etal., Mol Biol Rep. 2009 Jul;36(6):1475-81. Epub 2008 Sep 2.
98.
Expression of toll-like receptor 9 in peripheral blood mononuclear cells from patients with different hepatitis B and C viral loads.
Zhou J, etal., J Huazhong Univ Sci Technolog Med Sci. 2009 Jun;29(3):313-7. doi: 10.1007/s11596-009-0310-2. Epub 2009 Jun 10.
99.
Association of TLR9 gene polymorphisms with lupus nephritis in a Chinese Han population.
Zhou XJ, etal., Clin Exp Rheumatol. 2010 May-Jun;28(3):397-400. Epub 2010 Jun 23.
100.
Protective effect of CpG-DNA against mastitis induced by Staphylococcus aureus infection in a rat model.
Zhu YM, etal., Int Immunopharmacol. 2007 Apr;7(4):435-43. Epub 2006 Nov 27.
101.
TLR9-signaling pathways are involved in Kilham rat virus-induced autoimmune diabetes in the biobreeding diabetes-resistant rat.
Zipris D, etal., J Immunol. 2007 Jan 15;178(2):693-701.
Tlr9 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 115,743,407 - 115,747,523 (+) NCBI GRCr8 mRatBN7.2 8 106,864,680 - 106,868,796 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 106,864,680 - 106,868,796 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 112,489,116 - 112,493,226 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 110,688,285 - 110,692,395 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 108,531,077 - 108,535,188 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 114,916,122 - 114,920,171 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 114,916,122 - 114,920,171 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 114,279,020 - 114,283,069 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 8 106,185,754 - 106,189,869 (+) NCBI Celera Cytogenetic Map 8 q32 NCBI
TLR9 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 52,221,080 - 52,225,645 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 52,221,080 - 52,225,645 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 52,255,096 - 52,259,661 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 52,230,138 - 52,235,219 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 52,230,137 - 52,233,247 NCBI Celera 3 52,234,410 - 52,239,491 (-) NCBI Celera Cytogenetic Map 3 p21.2 NCBI HuRef 3 52,317,258 - 52,322,341 (-) NCBI HuRef CHM1_1 3 52,207,624 - 52,212,707 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 52,253,966 - 52,258,531 (-) NCBI T2T-CHM13v2.0
Tlr9 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 106,099,797 - 106,104,075 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 106,099,797 - 106,104,082 (+) Ensembl GRCm39 Ensembl GRCm38 9 106,222,598 - 106,226,876 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 106,222,598 - 106,226,883 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 106,124,929 - 106,129,207 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 106,080,699 - 106,084,977 (+) NCBI MGSCv36 mm8 Celera 9 105,848,890 - 105,853,167 (+) NCBI Celera Cytogenetic Map 9 F1 NCBI cM Map 9 57.46 NCBI
Tlr9 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955532 3,828,775 - 3,832,582 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955532 3,828,645 - 3,832,699 (-) NCBI ChiLan1.0 ChiLan1.0
TLR9 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 37,529,322 - 37,547,117 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 37,529,401 - 37,539,957 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 37,542,340 - 37,547,114 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 37,510,887 - 37,521,504 (+) NCBI Dog10K_Boxer_Tasha Dog10K_Boxer_Tasha 20 37,523,889 - 37,528,666 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 37,879,856 - 37,897,682 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 37,892,901 - 37,897,671 (+) Ensembl ROS_Cfam_1.0 Ensembl ROS_Cfam_1.0 Ensembl 20 37,879,518 - 37,890,512 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 37,243,558 - 37,254,192 (+) NCBI UMICH_Zoey_3.1 UMICH_Zoey_3.1 20 37,256,577 - 37,261,354 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 37,665,125 - 37,669,902 (+) NCBI UNSW_CanFamBas_1.0 UNSW_CanFamBas_1.0 20 37,652,111 - 37,662,740 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 37,950,172 - 37,954,949 (+) NCBI UU_Cfam_GSD_1.0 UU_Cfam_GSD_1.0 20 37,936,949 - 37,947,576 (+) NCBI UU_Cfam_GSD_1.0
TLR9 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 34,349,609 - 34,357,673 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 34,353,444 - 34,370,990 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 37,634,343 - 37,652,036 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
.
Predicted Target Of
Count of predictions: 63 Count of miRNA genes: 58 Interacting mature miRNAs: 61 Transcripts: ENSRNOT00000074194 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 738011 Anxrr9 Anxiety related response QTL 9 6.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 8 93535351 123900184 Rat 8693654 Alc32 Alcohol consumption QTL 32 2 0.755 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 8 88612425 107550209 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 738014 Anxrr15 Anxiety related response QTL 15 3.6 0.005 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 95718998 123900184 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 2313400 Anxrr25 Anxiety related response QTL 25 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 8 89265192 114019816 Rat 2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358903 Bp252 Blood pressure QTL 252 7 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 724539 Cm19 Cardiac mass QTL 19 2.6 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 8 100149864 120994388 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2300182 Bmd56 Bone mineral density QTL 56 5.4 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 95718998 123900184 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 631217 Activ1 Activity QTL 1 15.9 voluntary movement trait (VT:0003491) number of photobeam interruptions in an experimental apparatus (CMO:0001517) 8 102370617 108923645 Rat 1358893 Bp263 Blood pressure QTL 263 5.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat 61437 Cia6 Collagen induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 82460758 122812818 Rat
PMC133006P3
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 106,868,325 - 106,868,644 (+) MAPPER mRatBN7.2 Rnor_6.0 8 114,919,768 - 114,920,086 NCBI Rnor6.0 Rnor_5.0 8 114,282,666 - 114,282,984 UniSTS Rnor5.0 Celera 8 106,189,400 - 106,189,718 UniSTS
PMC55404P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 106,868,367 - 106,868,627 (+) MAPPER mRatBN7.2 Rnor_6.0 8 114,919,810 - 114,920,069 NCBI Rnor6.0 Rnor_5.0 8 114,282,708 - 114,282,967 UniSTS Rnor5.0 Celera 8 106,189,442 - 106,189,701 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
39
111
84
83
52
25
52
6
200
87
91
45
57
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000074194 ⟹ ENSRNOP00000066453
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 106,864,680 - 106,868,796 (+) Ensembl Rnor_6.0 Ensembl 8 114,916,122 - 114,920,171 (+) Ensembl
RefSeq Acc Id:
NM_198131 ⟹ NP_937764
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 115,743,407 - 115,747,523 (+) NCBI mRatBN7.2 8 106,864,680 - 106,868,796 (+) NCBI Rnor_6.0 8 114,916,122 - 114,920,171 (+) NCBI Rnor_5.0 8 114,279,020 - 114,283,069 (+) NCBI Celera 8 106,185,754 - 106,189,869 (+) RGD
Sequence:
GTTGCTTCCTCAATTCTCTGAGGGACCCTGGTGCGGATCATTCTCTGCTGCCCAGTTTGTCAGAGGGAGCCTCTGGAGAATCTTCCATTTTCCATCATGGTTCTCTGTAGCAGGACCCTGCACCCCTT
hide sequence
RefSeq Acc Id:
NP_937764 ⟸ NM_198131
- Peptide Label:
precursor
- UniProtKB:
Q6Y1S0 (UniProtKB/TrEMBL), A6I2Q1 (UniProtKB/TrEMBL), M0RAA8 (UniProtKB/TrEMBL)
- Sequence:
MVLCSRTLHPLSLLVQAAVLAEALALGTLPAFLPCELKPHGLVDCNWLFLKSVPHFSAAEPRSNITSLSLIANRIHHLHNLDFVHLPNVRQLNLKWNCPPPGLSPLHFSCRMTIEPKTFLAMRMLEEL
hide sequence
Ensembl Acc Id:
ENSRNOP00000066453 ⟸ ENSRNOT00000074194
RGD ID: 13696246 Promoter ID: EPDNEW_R6770 Type: initiation region Name: Tlr9_1 Description: toll-like receptor 9 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 114,916,122 - 114,916,182 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-02-11
Tlr9
toll-like receptor 9
Symbol and Name status set to approved
625702 APPROVED
