Advanced Search (OLGA)

Gene: Kalrn (kalirin, RhoGEF kinase) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Kalrn

Name:

kalirin, RhoGEF kinase

RGD ID:

621865

Description:

Enables enzyme binding activity. Involved in several processes, including regulation of dendrite development; regulation of modification of postsynaptic actin cytoskeleton; and regulation of neurotransmitter receptor localization to postsynaptic specialization membrane. Located in neuronal cell body and perinuclear region of cytoplasm. Is active in glutamatergic synapse; postsynaptic density; and presynapse. Human ortholog(s) of this gene implicated in cerebral atherosclerosis; cerebral infarction; and coronary artery disease. Orthologous to human KALRN (kalirin RhoGEF kinase); PARTICIPATES IN ephrin - ephrin receptor bidirectional signaling axis; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cyclin B1; Duo; Hapip; huntingtin-associated protein interacting protein (duo); huntingtin-associated protein-interacting protein; kalirin; P-CIP10; PAM COOH-terminal interactor protein 10; serine/threonine kinase with Dbl- and pleckstrin homology domain; serine/threonine-protein kinase with Dbl- and pleckstrin homology domain

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	KALRN (kalirin RhoGEF kinase)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):	Kalrn (kalirin, RhoGEF kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Kalrn (kalirin RhoGEF kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	KALRN (kalirin RhoGEF kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	KALRN (kalirin RhoGEF kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Kalrn (kalirin RhoGEF kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	KALRN (kalirin RhoGEF kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	KALRN (kalirin RhoGEF kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Kalrn (kalirin RhoGEF kinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TRIO (trio Rho guanine nucleotide exchange factor)	HGNC	OrthoDB
Alliance orthologs ³
Mus musculus (house mouse):	Kalrn (kalirin, RhoGEF kinase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	KALRN (kalirin RhoGEF kinase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	kalrna (kalirin RhoGEF kinase a)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	kalrnb (kalirin RhoGEF kinase b)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	trio	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	unc-73	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CDC24	Alliance	DIOPT (Ensembl Compara\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	79,703,345 - 80,309,210 (+)	NCBI		GRCr8
mRatBN7.2	11	66,198,155 - 66,803,166 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	66,198,173 - 66,797,610 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	75,087,947 - 75,631,070 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	67,750,338 - 68,292,956 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	66,780,418 - 67,323,530 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	69,484,293 - 70,025,682 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	69,484,293 - 70,025,633 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	72,575,016 - 73,115,328 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	68,124,348 - 68,611,336 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	11	68,205,034 - 68,668,925 (+)	NCBI
Celera	11	65,708,953 - 66,248,259 (+)	NCBI		Celera
Cytogenetic Map	11	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kalrn	Rat	cerebral atherosclerosis	susceptibility	ISO	KALRN (Homo sapiens)	329956416	DNA:SNP:intron: (rs6438833) (human)	RGD
Kalrn	Rat	cerebral infarction	susceptibility	ISO	KALRN (Homo sapiens)	11085239	DNA:SNP:intron: (rs6438833) (human)	RGD
Kalrn	Rat	cerebral infarction	sexual_dimorphism	ISO	KALRN (Homo sapiens)	329956420	DNA:SNPs more ...	RGD
Kalrn	Rat	coronary artery disease	onset	ISO	KALRN (Homo sapiens)	329970276	associated with nicotine dependence and DNA:SNPs:multiple	RGD
Kalrn	Rat	coronary artery disease	susceptibility	ISO	KALRN (Homo sapiens)	329956419	associated with type 2 diabetes mellitus and DNA:SNP:intron: (rs9289231) T>G (human)	RGD
Kalrn	Rat	coronary artery disease	susceptibility	ISO	KALRN (Homo sapiens)	329955537	DNA:SNP:intron: (rs9289231) T>G (human)	RGD
Kalrn	Rat	coronary artery disease	severity	ISO	KALRN (Homo sapiens)	11076452	DNA:SNP:intron: (rs9289231) (human)	RGD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kalrn	Rat	alkaptonuria		ISO	KALRN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Alkaptonuria	ClinVar	PMID:12501223 more ...
Kalrn	Rat	Coronary Disease		ISO	KALRN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Coronary heart disease more ...	ClinVar	PMID:17357071 and PMID:25741868
Kalrn	Rat	familial hypocalciuric hypercalcemia		ISO	KALRN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial hypocalciuric hypercalcemia	ClinVar	PMID:28492532
Kalrn	Rat	Familial Thoracic Aortic Aneurysm 7		ISO	KALRN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Aortic aneurysm and familial thoracic 7	ClinVar	PMID:28492532
Kalrn	Rat	Primary Lymphedema with Myelodysplasia		ISO	KALRN (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:19449416 more ...

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kalrn	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Kalrn (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of KALRN mRNA	CTD	PMID:22206623
Kalrn	Rat	17beta-estradiol	decreases expression	ISO	KALRN (Homo sapiens)	6480464	Estradiol results in decreased expression of KALRN mRNA	CTD	PMID:31614463
Kalrn	Rat	2,2',4,4',5,5'-hexachlorobiphenyl	multiple interactions	ISO	Kalrn (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
Kalrn	Rat	2,2',5,5'-tetrachlorobiphenyl	multiple interactions	ISO	Kalrn (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
Kalrn	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Kalrn (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of KALRN mRNA	CTD	PMID:18796159
Kalrn	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of KALRN mRNA	CTD	PMID:32109520
Kalrn	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Kalrn (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of KALRN mRNA	CTD	PMID:26377647
Kalrn	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of KALRN mRNA	CTD	PMID:22298810
Kalrn	Rat	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	EXP		6480464	2 more ...	CTD	PMID:32109520
Kalrn	Rat	2,4-dinitrobenzenesulfonic acid	increases expression	ISO	Kalrn (Mus musculus)	6480464	2 and 4-dinitrobenzenesulfonic acid results in increased expression of KALRN mRNA	CTD	PMID:30116771
Kalrn	Rat	2,4-dinitrobenzenesulfonic acid	multiple interactions	ISO	Kalrn (Mus musculus)	6480464	[2 and 4-dinitrobenzenesulfonic acid co-treated with GR 159897] results in increased expression of KALRN mRNA	CTD	PMID:30116771
Kalrn	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of KALRN mRNA	CTD	PMID:21346803
Kalrn	Rat	3,4-methylenedioxymethamphetamine	decreases expression	EXP		6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of KALRN mRNA	CTD	PMID:30071829
Kalrn	Rat	3H-1,2-dithiole-3-thione	affects expression	EXP		6480464	1 and 2-dithiol-3-thione affects the expression of KALRN mRNA	CTD	PMID:19162173
Kalrn	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	Kalrn (Mus musculus)	6480464	bisphenol S results in decreased expression of KALRN mRNA	CTD	PMID:39298647
Kalrn	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of KALRN mRNA	CTD	PMID:24780913
Kalrn	Rat	aflatoxin B1	decreases expression	ISO	KALRN (Homo sapiens)	6480464	Aflatoxin B1 results in decreased expression of KALRN mRNA	CTD	PMID:22100608
Kalrn	Rat	aflatoxin B1	increases methylation	ISO	KALRN (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of KALRN intron	CTD	PMID:30157460
Kalrn	Rat	Aflatoxin B2 alpha	increases methylation	ISO	KALRN (Homo sapiens)	6480464	aflatoxin B2 results in increased methylation of KALRN intron	CTD	PMID:30157460
Kalrn	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of KALRN mRNA	CTD	PMID:16483693
Kalrn	Rat	antirheumatic drug	increases expression	ISO	KALRN (Homo sapiens)	6480464	Antirheumatic Agents results in increased expression of KALRN mRNA	CTD	PMID:24449571
Kalrn	Rat	arsane	affects methylation	ISO	KALRN (Homo sapiens)	6480464	Arsenic affects the methylation of KALRN gene	CTD	PMID:25304211
Kalrn	Rat	arsenic atom	affects methylation	ISO	KALRN (Homo sapiens)	6480464	Arsenic affects the methylation of KALRN gene	CTD	PMID:25304211
Kalrn	Rat	arsenite(3-)	decreases expression	ISO	Kalrn (Mus musculus)	6480464	arsenite results in decreased expression of KALRN mRNA	CTD	PMID:18929588
Kalrn	Rat	arsenite(3-)	increases expression	ISO	Kalrn (Mus musculus)	6480464	arsenite results in increased expression of KALRN mRNA	CTD	PMID:33053406
Kalrn	Rat	arsenite(3-)	multiple interactions	ISO	Kalrn (Mus musculus)	6480464	TRP53 protein affects the reaction [arsenite results in decreased expression of KALRN mRNA]	CTD	PMID:18929588
Kalrn	Rat	arsenous acid	increases expression	ISO	KALRN (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of KALRN mRNA	CTD	PMID:20458559 and PMID:26705709
Kalrn	Rat	atrazine	affects methylation	EXP		6480464	Atrazine affects the methylation of KALRN gene	CTD	PMID:28931070 and PMID:35440735
Kalrn	Rat	atrazine	decreases expression	EXP		6480464	Atrazine results in decreased expression of KALRN mRNA	CTD	PMID:36841081
Kalrn	Rat	benzo[a]pyrene	increases mutagenesis	ISO	KALRN (Homo sapiens)	6480464	Benzo(a)pyrene results in increased mutagenesis of KALRN gene	CTD	PMID:25435355
Kalrn	Rat	benzo[a]pyrene	decreases expression	ISO	KALRN (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of KALRN mRNA	CTD	PMID:32234424
Kalrn	Rat	benzo[a]pyrene	affects methylation	ISO	KALRN (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of KALRN intron and Benzo(a)pyrene affects the methylation of KALRN promoter	CTD	PMID:27901495 and PMID:30157460
Kalrn	Rat	benzo[a]pyrene	decreases methylation	ISO	KALRN (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of KALRN exon	CTD	PMID:27901495
Kalrn	Rat	benzo[a]pyrene	increases expression	ISO	KALRN (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of KALRN mRNA	CTD	PMID:26238291
Kalrn	Rat	benzo[a]pyrene	decreases expression	ISO	Kalrn (Mus musculus)	6480464	Benzo(a)pyrene results in decreased expression of KALRN mRNA	CTD	PMID:21964900
Kalrn	Rat	benzo[a]pyrene	increases expression	ISO	Kalrn (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of KALRN mRNA	CTD	PMID:22228805
Kalrn	Rat	benzo[a]pyrene diol epoxide I	increases expression	ISO	KALRN (Homo sapiens)	6480464	7 more ...	CTD	PMID:26238291
Kalrn	Rat	benzo[e]pyrene	increases methylation	ISO	KALRN (Homo sapiens)	6480464	benzo(e)pyrene results in increased methylation of KALRN intron	CTD	PMID:30157460
Kalrn	Rat	beta-naphthoflavone	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of KALRN mRNA	CTD	PMID:18164116
Kalrn	Rat	bis(2-ethylhexyl) phthalate	decreases methylation	ISO	Kalrn (Mus musculus)	6480464	Diethylhexyl Phthalate results in decreased methylation of KALRN exon and Diethylhexyl Phthalate results in decreased methylation of KALRN intron	CTD	PMID:32864567
Kalrn	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of KALRN mRNA	CTD	PMID:25181051
Kalrn	Rat	bisphenol A	decreases expression	ISO	Kalrn (Mus musculus)	6480464	bisphenol A results in decreased expression of KALRN protein	CTD	PMID:35999755
Kalrn	Rat	bisphenol A	decreases methylation	ISO	KALRN (Homo sapiens)	6480464	bisphenol A results in decreased methylation of KALRN gene	CTD	PMID:31601247
Kalrn	Rat	bromuconazole	increases expression	EXP		6480464	bromuconazole results in increased expression of KALRN mRNA	CTD	PMID:33789219
Kalrn	Rat	butanal	increases expression	ISO	KALRN (Homo sapiens)	6480464	butyraldehyde results in increased expression of KALRN mRNA	CTD	PMID:26079696
Kalrn	Rat	C60 fullerene	decreases expression	EXP		6480464	fullerene C60 results in decreased expression of KALRN mRNA	CTD	PMID:19167457
Kalrn	Rat	cadmium acetate	decreases expression	ISO	KALRN (Homo sapiens)	6480464	cadmium acetate results in decreased expression of KALRN mRNA	CTD	PMID:18155341
Kalrn	Rat	caffeine	decreases phosphorylation	ISO	KALRN (Homo sapiens)	6480464	Caffeine results in decreased phosphorylation of KALRN protein	CTD	PMID:35688186
Kalrn	Rat	carbon nanotube	affects expression	ISO	Kalrn (Mus musculus)	6480464	Nanotubes and Carbon affects the expression of KALRN mRNA	CTD	PMID:25620056
Kalrn	Rat	carbon nanotube	increases expression	ISO	Kalrn (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681 and PMID:25620056
Kalrn	Rat	CGP 52608	multiple interactions	ISO	KALRN (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to KALRN gene]	CTD	PMID:28238834
Kalrn	Rat	chlordecone	increases expression	ISO	Kalrn (Mus musculus)	6480464	Chlordecone results in increased expression of KALRN mRNA	CTD	PMID:29980752
Kalrn	Rat	chlorpyrifos	decreases expression	ISO	Kalrn (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of KALRN mRNA	CTD	PMID:37019170
Kalrn	Rat	chromium(6+)	affects expression	ISO	Kalrn (Mus musculus)	6480464	chromium hexavalent ion affects the expression of KALRN mRNA	CTD	PMID:28472532
Kalrn	Rat	cisplatin	multiple interactions	ISO	KALRN (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in decreased expression of KALRN mRNA	CTD	PMID:27392435
Kalrn	Rat	cobalt dichloride	decreases expression	EXP		6480464	cobaltous chloride results in decreased expression of KALRN mRNA	CTD	PMID:24386269
Kalrn	Rat	cocaine	affects expression	EXP		6480464	Cocaine affects the expression of KALRN mRNA	CTD	PMID:20187946
Kalrn	Rat	copper(II) sulfate	decreases expression	ISO	KALRN (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of KALRN mRNA	CTD	PMID:19549813
Kalrn	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of KALRN mRNA	CTD	PMID:26577399
Kalrn	Rat	dextran sulfate	decreases expression	ISO	Kalrn (Mus musculus)	6480464	Dextran Sulfate results in decreased expression of KALRN protein	CTD	PMID:35999755
Kalrn	Rat	diarsenic trioxide	increases expression	ISO	KALRN (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of KALRN mRNA	CTD	PMID:20458559 and PMID:26705709
Kalrn	Rat	doxorubicin	decreases expression	ISO	KALRN (Homo sapiens)	6480464	Doxorubicin results in decreased expression of KALRN mRNA	CTD	PMID:29803840
Kalrn	Rat	endosulfan	decreases expression	EXP		6480464	Endosulfan results in decreased expression of KALRN mRNA	CTD	PMID:29391264
Kalrn	Rat	ethanol	affects splicing	ISO	Kalrn (Mus musculus)	6480464	Ethanol affects the splicing of KALRN mRNA	CTD	PMID:30319688
Kalrn	Rat	ethanol	multiple interactions	ISO	Kalrn (Mus musculus)	6480464	Ethanol affects the expression of and affects the splicing of KALRN mRNA	CTD	PMID:30319688
Kalrn	Rat	flavonoids	decreases expression	EXP		6480464	Flavonoids results in decreased expression of KALRN mRNA	CTD	PMID:18035473
Kalrn	Rat	folic acid	decreases expression	ISO	Kalrn (Mus musculus)	6480464	Folic Acid results in decreased expression of KALRN mRNA	CTD	PMID:25629700
Kalrn	Rat	folic acid	multiple interactions	ISO	Kalrn (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of KALRN mRNA	CTD	PMID:22206623
Kalrn	Rat	FR900359	decreases phosphorylation	ISO	KALRN (Homo sapiens)	6480464	FR900359 results in decreased phosphorylation of KALRN protein	CTD	PMID:37730182
Kalrn	Rat	genistein	affects expression	ISO	Kalrn (Mus musculus)	6480464	Genistein affects the expression of KALRN mRNA	CTD	PMID:32186404
Kalrn	Rat	glycidol	increases methylation	EXP		6480464	glycidol results in increased methylation of KALRN promoter	CTD	PMID:33150595
Kalrn	Rat	glycidol	decreases expression	EXP		6480464	glycidol results in decreased expression of KALRN mRNA	CTD	PMID:33150645
Kalrn	Rat	glyphosate	increases methylation	EXP		6480464	Glyphosate results in increased methylation of KALRN gene	CTD	PMID:31011160
Kalrn	Rat	glyphosate	affects methylation	EXP		6480464	Glyphosate affects the methylation of KALRN gene	CTD	PMID:35440735
Kalrn	Rat	graphite	affects expression	EXP		6480464	Graphite affects the expression of KALRN mRNA	CTD	PMID:29933104
Kalrn	Rat	hydrogen peroxide	affects expression	ISO	KALRN (Homo sapiens)	6480464	Hydrogen Peroxide affects the expression of KALRN mRNA	CTD	PMID:20044591
Kalrn	Rat	kainic acid	increases expression	EXP		6480464	Kainic Acid results in increased expression of KALRN mRNA	CTD	PMID:19700661
Kalrn	Rat	lead diacetate	increases expression	ISO	Kalrn (Mus musculus)	6480464	lead acetate results in increased expression of KALRN mRNA	CTD	PMID:20542052
Kalrn	Rat	lead diacetate	decreases expression	ISO	Kalrn (Mus musculus)	6480464	lead acetate results in decreased expression of KALRN mRNA	CTD	PMID:22609695
Kalrn	Rat	leflunomide	increases expression	ISO	KALRN (Homo sapiens)	6480464	leflunomide results in increased expression of KALRN mRNA	CTD	PMID:28988120
Kalrn	Rat	lipopolysaccharide	multiple interactions	ISO	KALRN (Homo sapiens)	6480464	[S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of KALRN mRNA	CTD	PMID:35811015
Kalrn	Rat	melphalan	decreases expression	ISO	KALRN (Homo sapiens)	6480464	Melphalan results in decreased expression of KALRN mRNA	CTD	PMID:22363485
Kalrn	Rat	methapyrilene	increases methylation	ISO	KALRN (Homo sapiens)	6480464	Methapyrilene results in increased methylation of KALRN intron	CTD	PMID:30157460
Kalrn	Rat	methotrexate	increases expression	ISO	KALRN (Homo sapiens)	6480464	Methotrexate results in increased expression of KALRN mRNA	CTD	PMID:24449571
Kalrn	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of KALRN gene	CTD	PMID:35440735
Kalrn	Rat	mono(2-ethylhexyl) phthalate	decreases expression	ISO	Kalrn (Mus musculus)	6480464	mono-(2-ethylhexyl)phthalate results in decreased expression of KALRN mRNA	CTD	PMID:22401849
Kalrn	Rat	N,N-diethyl-m-toluamide	multiple interactions	EXP		6480464	[Permethrin co-treated with DEET] results in decreased methylation of KALRN gene	CTD	PMID:33148267
Kalrn	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of KALRN mRNA and [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of KALRN mRNA	CTD	PMID:18164116 and PMID:20360939
Kalrn	Rat	nickel atom	decreases expression	ISO	KALRN (Homo sapiens)	6480464	Nickel results in decreased expression of KALRN mRNA	CTD	PMID:25583101
Kalrn	Rat	nitrofen	decreases expression	EXP		6480464	nitrofen results in decreased expression of KALRN mRNA	CTD	PMID:33484710
Kalrn	Rat	paracetamol	affects expression	ISO	Kalrn (Mus musculus)	6480464	Acetaminophen affects the expression of KALRN mRNA	CTD	PMID:17562736
Kalrn	Rat	PCB138	multiple interactions	ISO	Kalrn (Mus musculus)	6480464	[2 more ...	CTD	PMID:25510870
Kalrn	Rat	permethrin	multiple interactions	EXP		6480464	[Permethrin co-treated with DEET] results in decreased methylation of KALRN gene	CTD	PMID:33148267
Kalrn	Rat	phenethyl caffeate	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of KALRN mRNA	CTD	PMID:20360939
Kalrn	Rat	phenobarbital	affects expression	ISO	Kalrn (Mus musculus)	6480464	Phenobarbital affects the expression of KALRN mRNA	CTD	PMID:23091169
Kalrn	Rat	pirinixic acid	increases expression	EXP		6480464	pirinixic acid results in increased expression of KALRN mRNA	CTD	PMID:19162173
Kalrn	Rat	pirinixic acid	decreases expression	ISO	Kalrn (Mus musculus)	6480464	pirinixic acid results in decreased expression of KALRN mRNA	CTD	PMID:23811191
Kalrn	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	KALRN (Homo sapiens)	6480464	[S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of KALRN mRNA	CTD	PMID:35811015
Kalrn	Rat	sodium arsenite	affects methylation	ISO	KALRN (Homo sapiens)	6480464	sodium arsenite affects the methylation of KALRN gene	CTD	PMID:28589171
Kalrn	Rat	Soman	decreases expression	EXP		6480464	Soman results in decreased expression of KALRN mRNA	CTD	PMID:19281266
Kalrn	Rat	sulindac sulfide	decreases expression	ISO	KALRN (Homo sapiens)	6480464	sulindac sulfide results in decreased expression of KALRN mRNA	CTD	PMID:16184548
Kalrn	Rat	tetrachloromethane	affects expression	ISO	Kalrn (Mus musculus)	6480464	Carbon Tetrachloride affects the expression of KALRN mRNA	CTD	PMID:17484886
Kalrn	Rat	thalidomide	decreases expression	ISO	KALRN (Homo sapiens)	6480464	Thalidomide results in decreased expression of KALRN mRNA	CTD	PMID:32756504
Kalrn	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of KALRN mRNA	CTD	PMID:34492290
Kalrn	Rat	titanium dioxide	increases expression	ISO	Kalrn (Mus musculus)	6480464	titanium dioxide results in increased expression of KALRN mRNA	CTD	PMID:23557971
Kalrn	Rat	triadimefon	decreases expression	ISO	KALRN (Homo sapiens)	6480464	triadimefon results in decreased expression of KALRN mRNA	CTD	PMID:26705709
Kalrn	Rat	trichostatin A	increases expression	ISO	KALRN (Homo sapiens)	6480464	trichostatin A results in increased expression of KALRN mRNA	CTD	PMID:24935251
Kalrn	Rat	trichostatin A	decreases expression	ISO	KALRN (Homo sapiens)	6480464	trichostatin A results in decreased expression of KALRN mRNA	CTD	PMID:27188386
Kalrn	Rat	triphenyl phosphate	affects expression	ISO	KALRN (Homo sapiens)	6480464	triphenyl phosphate affects the expression of KALRN mRNA	CTD	PMID:37042841
Kalrn	Rat	triptonide	decreases expression	ISO	Kalrn (Mus musculus)	6480464	triptonide results in decreased expression of KALRN mRNA	CTD	PMID:33045310
Kalrn	Rat	valproic acid	decreases methylation	ISO	KALRN (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of KALRN gene	CTD	PMID:29154799
Kalrn	Rat	valproic acid	affects splicing	EXP		6480464	Valproic Acid affects the splicing of KALRN mRNA	CTD	PMID:29427782
Kalrn	Rat	valproic acid	affects expression	ISO	KALRN (Homo sapiens)	6480464	Valproic Acid affects the expression of KALRN mRNA	CTD	PMID:25979313
Kalrn	Rat	valproic acid	increases expression	ISO	KALRN (Homo sapiens)	6480464	Valproic Acid results in increased expression of KALRN mRNA	CTD	PMID:24935251
Kalrn	Rat	vinclozolin	affects expression	EXP		6480464	vinclozolin affects the expression of KALRN mRNA	CTD	PMID:19015723
Kalrn	Rat	vinclozolin	affects methylation	EXP		6480464	vinclozolin affects the methylation of KALRN gene	CTD	PMID:31682807
Kalrn	Rat	vorinostat	decreases expression	ISO	KALRN (Homo sapiens)	6480464	vorinostat results in decreased expression of KALRN mRNA	CTD	PMID:27188386

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kalrn	Rat	adult locomotory behavior	acts_upstream_of_or_within	ISO	Kalrn (Mus musculus)	1624291	MGI:5551305 PMID:23116210	RGD	PMID:23116210
Kalrn	Rat	axon guidance	involved_in	IBA	FB:FBgn0024277 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kalrn	Rat	axonogenesis		IDA		628431		RGD
Kalrn	Rat	habituation	acts_upstream_of_or_within	ISO	Kalrn (Mus musculus)	1624291	MGI:5551305 PMID:23116210	RGD	PMID:23116210
Kalrn	Rat	intracellular signal transduction	involved_in	IDA		628431	PMID:12177196	HGNC-UCL
Kalrn	Rat	intracellular signal transduction		IDA		628431		RGD
Kalrn	Rat	intracellular signal transduction	involved_in	IBA	PANTHER:PTN002737294 and Kalrn (Rattus norvegicus)	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kalrn	Rat	lactation	acts_upstream_of_or_within	ISO	Kalrn (Mus musculus)	1624291	MGI:5551305 PMID:23116210	RGD	PMID:23116210
Kalrn	Rat	maternal behavior	acts_upstream_of_or_within	ISO	Kalrn (Mus musculus)	1624291	MGI:5551305 PMID:23116210	RGD	PMID:23116210
Kalrn	Rat	maternal process involved in parturition	acts_upstream_of_or_within	ISO	Kalrn (Mus musculus)	1624291	MGI:5551305 PMID:23116210	RGD	PMID:23116210
Kalrn	Rat	memory	acts_upstream_of_or_within	ISO	Kalrn (Mus musculus)	1624291	MGI:4358076 PMID:19625617	RGD	PMID:19625617
Kalrn	Rat	negative regulation of growth hormone secretion	acts_upstream_of_or_within	ISO	Kalrn (Mus musculus)	1624291	MGI:5551305 PMID:23116210	RGD	PMID:23116210
Kalrn	Rat	nervous system development	involved_in	IDA		628431	PMID:12177196	HGNC-UCL
Kalrn	Rat	nervous system development		IDA		628431		RGD
Kalrn	Rat	neuromuscular junction development	acts_upstream_of_or_within	ISO	Kalrn (Mus musculus)	1624291	MGI:5551305 PMID:23116210	RGD	PMID:23116210
Kalrn	Rat	positive regulation of dendritic spine morphogenesis	acts_upstream_of_or_within	ISO	Kalrn (Mus musculus)	1624291	MGI:4358076 PMID:19625617	RGD	PMID:19625617
Kalrn	Rat	positive regulation of GTPase activity	acts_upstream_of_or_within	ISO	Kalrn (Mus musculus)	1624291	MGI:4358076 PMID:19625617	RGD	PMID:19625617
Kalrn	Rat	regulation of dendrite development		IDA		1358370		RGD
Kalrn	Rat	regulation of modification of postsynaptic actin cytoskeleton	involved_in	IMP		12050112	PMID:18031682	SynGO
Kalrn	Rat	regulation of modification of postsynaptic actin cytoskeleton	involved_in	IDA		12050112	PMID:18031682	SynGO
Kalrn	Rat	regulation of neurotransmitter receptor localization to postsynaptic specialization membrane	involved_in	IDA		12050112	PMID:18031682	SynGO
Kalrn	Rat	regulation of neurotransmitter receptor localization to postsynaptic specialization membrane	involved_in	IMP		12050112	PMID:18031682	SynGO
Kalrn	Rat	social behavior	acts_upstream_of_or_within	ISO	Kalrn (Mus musculus)	1624291	MGI:4358076 PMID:19625617	RGD	PMID:19625617

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kalrn	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kalrn	Rat	cytoplasm	is_active_in	IBA	MGI:1277173 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kalrn	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Kalrn	Rat	cytoskeleton	located_in	IEA	UniProtKB-SubCell:SL-0090	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Kalrn	Rat	cytoskeleton	located_in	IEA	UniProtKB-KW:KW-0206	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kalrn	Rat	cytosol	located_in	ISO	KALRN (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Kalrn	Rat	extrinsic component of membrane	is_active_in	IBA	FB:FBgn0024277 and PANTHER:PTN001481781	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kalrn	Rat	glutamatergic synapse	is_active_in	IDA		12050112	PMID:18031682	SynGO
Kalrn	Rat	glutamatergic synapse	is_active_in	IMP		12050112	PMID:18031682	SynGO
Kalrn	Rat	neuronal cell body		IDA		727293		RGD
Kalrn	Rat	nucleoplasm	located_in	ISO	KALRN (Homo sapiens) more ...	1624291		RGD	GO_REF:0000052
Kalrn	Rat	perinuclear region of cytoplasm		IDA		727293		RGD
Kalrn	Rat	postsynaptic density	is_active_in	IDA		12050112	PMID:18031682	SynGO
Kalrn	Rat	postsynaptic density	is_active_in	IBA	PANTHER:PTN002737294 and Kalrn (Rattus norvegicus)	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kalrn	Rat	postsynaptic density	is_active_in	IMP		12050112	PMID:18031682	SynGO
Kalrn	Rat	presynapse	is_active_in	EXP		13702180	PMID:23622064	SynGO
Kalrn	Rat	presynapse	is_active_in	IDA		13702180	PMID:23622064	SynGO

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kalrn	Rat	ATP binding	enables	IEA	UniRule:UR001503341	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Kalrn	Rat	ATP binding	enables	IEA	InterPro:IPR000719 and InterPro:IPR017441	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kalrn	Rat	ATP binding	enables	IEA	UniProtKB-KW:KW-0067	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kalrn	Rat	enzyme binding		IPI	Pam (Rattus norvegicus)	728662		RGD
Kalrn	Rat	guanyl-nucleotide exchange factor activity	enables	TAS		628431	PMID:12177196	HGNC-UCL
Kalrn	Rat	guanyl-nucleotide exchange factor activity		TAS		628431		RGD
Kalrn	Rat	guanyl-nucleotide exchange factor activity	enables	IBA	FB:FBgn0024277 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kalrn	Rat	guanyl-nucleotide exchange factor activity	enables	IEA	InterPro:IPR000219	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kalrn	Rat	guanyl-nucleotide exchange factor activity	enables	IEA	UniProtKB-KW:KW-0344	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kalrn	Rat	guanyl-nucleotide exchange factor activity	enables	ISO	KALRN (Homo sapiens)	1624291	PMID:12546821	RGD	PMID:12546821
Kalrn	Rat	kinase activity	enables	IEA	UniProtKB-KW:KW-0418	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kalrn	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kalrn	Rat	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kalrn	Rat	nucleotide binding	enables	IEA	UniRule:UR001503341	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Kalrn	Rat	protein binding		IPI	Hap1 (Rattus norvegicus)	728800		RGD
Kalrn	Rat	protein binding	enables	IPI	UniProtKB:Q62765	150521626	PMID:31801062	IntAct
Kalrn	Rat	protein binding	enables	IPI	UniProtKB:Q99K10	150521626	PMID:31801062	IntAct
Kalrn	Rat	protein binding	enables	ISO	KALRN (Homo sapiens)	1624291	UniProtKB:P0DTD1-PRO_0000449631 more ...	RGD	PMID:36217029
Kalrn	Rat	protein binding	enables	ISO	KALRN (Homo sapiens) and UniProtKB:O60229-2	1624291	UniProtKB:Q9Y6H5-1 and PMID:23284848	RGD	PMID:23284848
Kalrn	Rat	protein binding	enables	IPI	UniProtKB:P54256	728800	PMID:9285789	IntAct
Kalrn	Rat	protein binding	enables	IPI	UniProtKB:Q99K10	13210534	PMID:26078884	ARUK-UCL
Kalrn	Rat	protein binding		IPI	Ppp1r9b (Rattus norvegicus)	9999382		RGD
Kalrn	Rat	protein binding		IPI	Disc1 (Rattus norvegicus)	5509795		RGD
Kalrn	Rat	protein kinase activity	enables	IEA	InterPro:IPR000719 and InterPro:IPR008271	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kalrn	Rat	protein serine kinase activity	enables	IEA	RHEA:17989	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Kalrn	Rat	protein serine/threonine kinase activity	enables	IEA	UniProtKB-KW:KW-0723	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kalrn	Rat	protein serine/threonine kinase activity	enables	IEA	EC:2.7.11.1	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Kalrn	Rat	transferase activity	enables	IEA	UniProtKB-KW:KW-0808	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kalrn	Rat	ephrin - ephrin receptor bidirectional signaling axis		ISO	KALRN (Homo sapiens)	6484113		PID	PID:200052

#	Reference Title	Reference Citation
1.	Novel proteins that interact with the COOH-terminal cytosolic routing determinants of an integral membrane peptide-processing enzyme.	Alam MR, etal., J Biol Chem 1996 Nov 8;271(45):28636-40.
2.	Kalirin, a cytosolic protein with spectrin-like and GDP/GTP exchange factor-like domains that interacts with peptidylglycine alpha-amidating monooxygenase, an integral membrane peptide-processing enzyme.	Alam MR, etal., J Biol Chem 1997 May 9;272(19):12667-75.
3.	The Kalirin Gene rs9289231 Polymorphism as a Novel Predisposing Marker for Coronary Artery Disease.	Boroumand M, etal., Lab Med. 2014 Fall;45(4):302-8. doi: 10.1309/LMLS813ZDPHRFLUU.
4.	Molecular profiling of synaptic vesicle docking sites reveals novel proteins but few differences between glutamatergic and GABAergic synapses.	Boyken J, etal., Neuron. 2013 Apr 24;78(2):285-97. doi: 10.1016/j.neuron.2013.02.027.
5.	Huntingtin-associated protein 1 (HAP1) binds to a Trio-like polypeptide, with a rac1 guanine nucleotide exchange factor domain.	Colomer V, etal., Hum Mol Genet 1997 Sep;6(9):1519-25.
6.	Genetic Variation of the Kalirin Gene is Associated with ICAS in the Chinese Population.	Dang M, etal., J Mol Neurosci. 2018 Oct;66(2):157-162. doi: 10.1007/s12031-018-1130-2. Epub 2018 Sep 19.
7.	KALRN Rare and Common Variants and Susceptibility to Ischemic Stroke in Chinese Han Population.	Dang M, etal., Neuromolecular Med. 2015 Sep;17(3):241-50. doi: 10.1007/s12017-015-8352-z. Epub 2015 Apr 28.
8.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
9.	Disrupted-in-Schizophrenia 1 (DISC1) regulates spines of the glutamate synapse via Rac1.	Hayashi-Takagi A, etal., Nat Neurosci. 2010 Mar;13(3):327-32. Epub 2010 Feb 7.
10.	Validation study of genetic associations with coronary artery disease on chromosome 3q13-21 and potential effect modification by smoking.	Horne BD, etal., Ann Hum Genet. 2009 Nov;73(Pt 6):551-8. doi: 10.1111/j.1469-1809.2009.00540.x. Epub 2009 Aug 25.
11.	Isoforms of kalirin, a neuronal Dbl family member, generated through use of different 5'- and 3'-ends along with an internal translational initiation site.	Johnson RC, etal., J Biol Chem 2000 Jun 23;275(25):19324-33.
12.	Genetic Variant of Kalirin Gene Is Associated with Ischemic Stroke in a Chinese Han Population.	Li H, etal., Biomed Res Int. 2017;2017:6594271. doi: 10.1155/2017/6594271. Epub 2017 Jun 19.
13.	Kalirin, a multifunctional Rho guanine nucleotide exchange factor, is necessary for maintenance of hippocampal pyramidal neuron dendrites and dendritic spines.	Ma XM, etal., J Neurosci 2003 Nov 19;23(33):10593-603.
14.	Kalirin Dbl-homology guanine nucleotide exchange factor 1 domain initiates new axon outgrowths via RhoG-mediated mechanisms.	May V, etal., J Neurosci 2002 Aug 15;22(16):6980-90.
15.	Association of KALRN, ADIPOQ, and FTO gene polymorphism in type 2 diabetic patients with coronary artery disease: possible predisposing markers.	Mofarrah M, etal., Coron Artery Dis. 2016 Sep;27(6):490-6. doi: 10.1097/MCA.0000000000000386.
16.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
17.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
18.	Neurexin-Neuroligin Synaptic Complex Regulates Schizophrenia-Related DISC1/Kal-7/Rac1 "Signalosome".	Owczarek S, etal., Neural Plast. 2015;2015:167308. doi: 10.1155/2015/167308. Epub 2015 May 20.
19.	Synaptic Kalirin-7 and Trio Interactomes Reveal a GEF Protein-Dependent Neuroligin-1 Mechanism of Action.	Paskus JD, etal., Cell Rep. 2019 Dec 3;29(10):2944-2952.e5. doi: 10.1016/j.celrep.2019.10.115.
20.	The neuronal Rho-GEF Kalirin-7 interacts with PDZ domain-containing proteins and regulates dendritic morphogenesis.	Penzes P, etal., Neuron. 2001 Jan;29(1):229-42.
21.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
22.	GOA pipeline	RGD automated data pipeline
23.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
24.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
25.	Association between Serum Kalirin Levels and the KALRN gene rs9289231 Polymorphism in Early-Onset Coronary Artery Disease.	Shafiei A, etal., J Tehran Heart Cent. 2018 Apr;13(2):58-64.
26.	Kalirin-7 controls activity-dependent structural and functional plasticity of dendritic spines.	Xie Z, etal., Neuron. 2007 Nov 21;56(4):640-56.

PMID:9915831	PMID:10692441	PMID:10974569	PMID:12546821	PMID:14742910	PMID:15923627	PMID:16644733	PMID:18585704	PMID:18625710	PMID:18628310	PMID:19020030	PMID:19056867
PMID:19625617	PMID:19889983	PMID:20333733	PMID:21880917	PMID:22458534	PMID:22738176	PMID:23116210	PMID:23288169	PMID:23516288	PMID:23742124	PMID:23825406	PMID:25146373
PMID:25378388	PMID:25865668	PMID:26921771	PMID:27989699	PMID:28418645	PMID:30053369	PMID:30565792	PMID:30875016	PMID:32203420	PMID:32375403	PMID:38143048

Kalrn
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	79,703,345 - 80,309,210 (+)	NCBI		GRCr8
mRatBN7.2	11	66,198,155 - 66,803,166 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	66,198,173 - 66,797,610 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	75,087,947 - 75,631,070 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	67,750,338 - 68,292,956 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	66,780,418 - 67,323,530 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	69,484,293 - 70,025,682 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	69,484,293 - 70,025,633 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	72,575,016 - 73,115,328 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	68,124,348 - 68,611,336 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	11	68,205,034 - 68,668,925 (+)	NCBI
Celera	11	65,708,953 - 66,248,259 (+)	NCBI		Celera
Cytogenetic Map	11	q22	NCBI

KALRN
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	124,033,369 - 124,726,325 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	124,033,369 - 124,726,325 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	123,752,216 - 124,445,172 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	125,296,275 - 125,922,726 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	3	122,221,230 - 122,847,210 (+)	NCBI		Celera
Cytogenetic Map	3	q21.1-q21.2	NCBI
HuRef	3	121,187,838 - 121,814,322 (+)	NCBI		HuRef
CHM1_1	3	123,776,558 - 124,403,021 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	126,759,499 - 127,452,146 (+)	NCBI		T2T-CHM13v2.0

Kalrn
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	33,789,443 - 34,393,647 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	33,789,443 - 34,393,902 (-)	Ensembl		GRCm39 Ensembl
GRCm38	16	33,969,073 - 34,573,277 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	33,969,073 - 34,573,532 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	33,969,159 - 34,514,113 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	33,892,682 - 34,433,795 (-)	NCBI		MGSCv36	mm8
Celera	16	34,453,093 - 34,990,407 (-)	NCBI		Celera
Cytogenetic Map	16	B3	NCBI
cM Map	16	24.27	NCBI

Kalrn
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955427	23,184,739 - 23,816,811 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955427	23,184,751 - 23,823,128 (+)	NCBI	ChiLan1.0	ChiLan1.0

KALRN
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	121,994,732 - 122,687,369 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	121,999,508 - 122,692,146 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	121,138,136 - 121,828,723 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	128,098,363 - 128,722,156 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	128,225,413 - 128,720,441 (+)	Ensembl	panpan1.1		panPan2

KALRN
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	33	27,161,403 - 27,752,891 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	33	27,161,504 - 27,746,497 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	33	27,117,706 - 27,776,818 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	33	27,329,328 - 27,797,773 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	33	27,328,803 - 27,985,259 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	33	27,125,464 - 27,784,937 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	33	27,169,910 - 27,829,241 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	33	27,786,940 - 28,447,934 (+)	NCBI		UU_Cfam_GSD_1.0

Kalrn
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	126,658,106 - 127,230,908 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936725	572,868 - 1,139,142 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936725	749,382 - 1,020,702 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

KALRN
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	13	135,653,795 - 136,277,072 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	145,158,050 - 145,609,817 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

KALRN
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	56,106,677 - 56,820,004 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	56,151,819 - 56,754,538 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	109,573,807 - 110,217,834 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Kalrn
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624731	121,122 - 752,942 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624731	54,934 - 756,707 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Kalrn
5285 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	202
Count of miRNA genes:	136
Interacting mature miRNAs:	149
Transcripts:	ENSRNOT00000002324, ENSRNOT00000016340, ENSRNOT00000049292
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	18976208	86241447	Rat
70208	Niddm22	Non-insulin dependent diabetes mellitus QTL 22	3.61		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	11	59802794	82566553	Rat
4889859	Pur28	Proteinuria QTL 28	19.5	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	11	45459323	75190161	Rat
10755497	Bp388	Blood pressure QTL 388	2.76		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	19456205	76331918	Rat
1549848	Bvd6	Brain ventricular dilatation QTL 6	3.1	0.0001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	11	66113321	82169223	Rat
10058952	Gmadr6	Adrenal mass QTL 6	2.29	0.0072	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	22959403	67959403	Rat
10058954	Gmadr7	Adrenal mass QTL 7	2.49	0.0049	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	60346590	86241447	Rat
2298551	Neuinf10	Neuroinflammation QTL 10	3.7		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	11	31239134	78851519	Rat
2312566	Glom20	Glomerulus QTL 20	3.6	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	44285759	82566702	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	27672410	82846715	Rat
724561	Plsm4	Polydactyly-luxate syndrome (PLS) morphotypes QTL 4		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	11	54457534	86241447	Rat
631506	Bp104	Blood pressure QTL 104	2.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	59802794	82566545	Rat
8694424	Bw162	Body weight QTL 162	3.8	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	23280456	68280456	Rat
1581572	Uae35	Urinary albumin excretion QTL 35		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	44803318	82846466	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	29528418	82566702	Rat
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	1	69446234	Rat
70180	BpQTLcluster10	Blood pressure QTL cluster 10	3.19		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	11	34918041	79918041	Rat
1581565	Pur10	Proteinuria QTL 10		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	44803318	82846466	Rat
634339	Niddm50	Non-insulin dependent diabetes mellitus QTL 50	3.32		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	11	66422148	86241447	Rat
8694376	Bw156	Body weight QTL 156	2.25	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	23280456	68280456	Rat
1300135	Rf19	Renal function QTL 19	3.38		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	11	40946188	82566702	Rat
1354593	Stl12	Serum triglyceride level QTL 12	3.36		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	11	66422148	86241447	Rat
9589032	Epfw10	Epididymal fat weight QTL 10	9.29	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	11	23280456	68280456	Rat
9590313	Scort20	Serum corticosterone level QTL 20	6.51	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	11	23280456	68280456	Rat
4889521	Gluco62	Glucose level QTL 62	2.82	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	55136729	82993457	Rat
7411658	Foco27	Food consumption QTL 27	16.2	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	11	56351424	86241447	Rat

D11Mgh3

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	66,422,148 - 66,422,316 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	69,649,708 - 69,649,875	NCBI	Rnor6.0
Rnor_5.0	11	72,739,687 - 72,739,854	UniSTS	Rnor5.0
RGSC_v3.4	11	68,234,781 - 68,234,949	RGD	RGSC3.4
RGSC_v3.4	11	68,234,782 - 68,234,949	UniSTS	RGSC3.4
RGSC_v3.1	11	68,292,371 - 68,292,538	RGD
Celera	11	65,874,140 - 65,874,287	UniSTS
RH 3.4 Map	11	411.0	UniSTS
RH 3.4 Map	11	411.0	RGD
Cytogenetic Map	11	q22	UniSTS

D11Arb4

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	66,422,141 - 66,422,377 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	69,649,701 - 69,649,936	NCBI	Rnor6.0
Rnor_5.0	11	72,739,680 - 72,739,915	UniSTS	Rnor5.0
RGSC_v3.4	11	68,234,774 - 68,235,010	RGD	RGSC3.4
RGSC_v3.4	11	68,234,775 - 68,235,010	UniSTS	RGSC3.4
RGSC_v3.1	11	68,292,364 - 68,292,599	RGD
Celera	11	65,874,133 - 65,874,348	UniSTS
RH 3.4 Map	11	416.8	UniSTS
RH 3.4 Map	11	416.8	RGD
RH 2.0 Map	11	147.1	RGD
SHRSP x BN Map	11	29.8399	RGD
Cytogenetic Map	11	q22	UniSTS

D11Got53

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	11	79,919,577 - 79,919,686 (+)	Marker Load Pipeline
mRatBN7.2	11	66,414,395 - 66,414,504 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	69,641,939 - 69,642,047	NCBI	Rnor6.0
Rnor_5.0	11	72,731,918 - 72,732,026	UniSTS	Rnor5.0
RGSC_v3.4	11	68,227,012 - 68,227,121	RGD	RGSC3.4
RGSC_v3.4	11	68,227,013 - 68,227,121	UniSTS	RGSC3.4
RGSC_v3.1	11	68,284,602 - 68,284,710	RGD
Celera	11	65,866,395 - 65,866,495	UniSTS
RH 3.4 Map	11	416.9	RGD
RH 3.4 Map	11	416.9	UniSTS
RH 2.0 Map	11	147.0	RGD
Cytogenetic Map	11	q22	UniSTS

BE102756

Rat Assembly	Chr	Position (strand)	Source	JBrowse
RH 3.4 Map	11	423.8	UniSTS
Cytogenetic Map	11	q22	UniSTS

RH137364

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	66,762,510 - 66,762,678 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	69,990,587 - 69,990,754	NCBI	Rnor6.0
Rnor_5.0	11	73,080,299 - 73,080,466	UniSTS	Rnor5.0
RGSC_v3.4	11	68,575,790 - 68,575,957	UniSTS	RGSC3.4
Celera	11	66,213,376 - 66,213,543	UniSTS
RH 3.4 Map	11	410.0	UniSTS
Cytogenetic Map	11	q22	UniSTS

BE110052

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	66,550,775 - 66,550,986 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	69,778,868 - 69,779,078	NCBI	Rnor6.0
Rnor_5.0	11	72,868,257 - 72,868,467	UniSTS	Rnor5.0
RGSC_v3.4	11	68,363,209 - 68,363,419	UniSTS	RGSC3.4
Celera	11	66,001,487 - 66,001,697	UniSTS
RH 3.4 Map	11	413.6	UniSTS
Cytogenetic Map	11	q22	UniSTS

BF396995

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	66,584,216 - 66,584,428 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	69,812,304 - 69,812,515	NCBI	Rnor6.0
Rnor_5.0	11	72,901,599 - 72,901,810	UniSTS	Rnor5.0
RGSC_v3.4	11	68,396,645 - 68,396,856	UniSTS	RGSC3.4
Celera	11	66,034,975 - 66,035,186	UniSTS
RH 3.4 Map	11	415.4	UniSTS
Cytogenetic Map	11	q22	UniSTS

AU046621

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	11	72,583,938 - 72,584,303	NCBI	Rnor5.0
RGSC_v3.4	11	68,082,751 - 68,083,111	UniSTS	RGSC3.4
Celera	11	65,717,382 - 65,717,746	UniSTS
Cytogenetic Map	11	q22	UniSTS

RH137626

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	66,797,618 - 66,797,774 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	70,025,691 - 70,025,846	NCBI	Rnor6.0
Rnor_5.0	11	73,115,337 - 73,115,492	UniSTS	Rnor5.0
RGSC_v3.4	11	68,611,345 - 68,611,500	UniSTS	RGSC3.4
Celera	11	66,248,268 - 66,248,423	UniSTS
Cytogenetic Map	11	q22	UniSTS

RH138291

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	66,698,064 - 66,698,218 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	69,926,149 - 69,926,302	NCBI	Rnor6.0
Rnor_5.0	11	73,015,452 - 73,015,605	UniSTS	Rnor5.0
RGSC_v3.4	11	68,511,288 - 68,511,441	UniSTS	RGSC3.4
Celera	11	66,148,872 - 66,149,025	UniSTS
RH 3.4 Map	11	420.8	UniSTS
Cytogenetic Map	11	q22	UniSTS

AU049016

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	66,739,774 - 66,740,015 (+)	MAPPER	mRatBN7.2
mRatBN7.2	11	66,739,924 - 66,740,015 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	69,968,003 - 69,968,093	NCBI	Rnor6.0
Rnor_6.0	11	69,967,853 - 69,968,093	NCBI	Rnor6.0
Rnor_5.0	11	73,057,717 - 73,057,807	UniSTS	Rnor5.0
Rnor_5.0	11	73,057,567 - 73,057,807	UniSTS	Rnor5.0
RGSC_v3.4	11	68,552,992 - 68,553,232	UniSTS	RGSC3.4
RGSC_v3.4	11	68,553,142 - 68,553,232	UniSTS	RGSC3.4
Celera	11	66,190,796 - 66,190,886	UniSTS
Celera	11	66,190,646 - 66,190,886	UniSTS
Cytogenetic Map	11	q22	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_032062	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088638	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088639	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088640	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088641	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088642	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088643	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088644	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088645	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088646	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088647	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088648	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088649	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088650	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088651	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088652	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088653	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088654	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088655	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088656	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088657	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088658	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088660	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088661	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088662	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088663	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088664	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088665	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088666	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039088667	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270778	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270779	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270780	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270781	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270782	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270783	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270784	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270785	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270786	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270787	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270788	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270789	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063270790	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC133403	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF046121	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF229255	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF230644	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF232668	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF232669	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY621095	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LS482391	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U88156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U88157	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U94189	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016340 ⟹ ENSRNOP00000016340

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	66,198,173 - 66,628,157 (+)	Ensembl
Rnor_6.0 Ensembl	11	69,739,384 - 69,856,241 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000049292 ⟹ ENSRNOP00000039072

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	66,254,969 - 66,797,610 (+)	Ensembl
Rnor_6.0 Ensembl	11	69,484,293 - 70,025,633 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098731 ⟹ ENSRNOP00000078050

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	66,254,969 - 66,797,610 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101686 ⟹ ENSRNOP00000097769

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	66,688,941 - 66,797,589 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112350 ⟹ ENSRNOP00000084630

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	66,616,200 - 66,760,639 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000114138 ⟹ ENSRNOP00000089775

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	66,198,173 - 66,797,610 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117056 ⟹ ENSRNOP00000094025

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	66,254,810 - 66,797,610 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118953 ⟹ ENSRNOP00000084297

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	66,254,682 - 66,797,610 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000119829 ⟹ ENSRNOP00000083298

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	66,688,941 - 66,765,434 (+)	Ensembl

RefSeq Acc Id:

NM_032062 ⟹ NP_114451

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,760,161 - 80,302,770 (+)	NCBI
mRatBN7.2	11	66,254,969 - 66,797,610 (+)	NCBI
Rnor_6.0	11	69,484,293 - 70,025,682 (+)	NCBI
Rnor_5.0	11	72,575,016 - 73,115,328 (+)	NCBI
RGSC_v3.4	11	68,124,348 - 68,611,336 (+)	RGD
Celera	11	65,708,953 - 66,248,259 (+)	NCBI

Sequence:

show sequence

ATGACGGACCGCTTCTGGGACCAGTGGTATCTTTGGTATCTCCGCTTGCTTCGGCTTCTGGATCGAGGATCTTTTCGGAATGATGGTTTGAAAGCTTCTGATGTCCTTCCTATCCTAAAGGAGAAAGT
GGCCTTTGTGTCTGGGGGTCGTGATAAGCGAGGTGGACCCATCCTGACCTTCCCTGCCCGAACCAATCATGACAGAATAAGACAGGAAGACCTACGGAAACTCGTGACGAATTTGGCCAGCGTGCCAA
GCGAGGACGTTTGCAAACGTGGCTTCACCGTCATCATCGACATGCGGGGCTCCAAGTGGGACCTCATCAAGCCCCTCCTCAAGACGCTGCAGGAAGCCTTTCCCGCCGAGATCCATGTGGCCCTCATC
ATCAAGCCTGACAACTTCTGGCAGAAGCAGAAGACCAACTTTGGCAGCTCCAAATTCATCTTTGAGACGAGCATGGTGTCTGTGGAGGGCCTCACGAAGCTGGTGGACCCCTCCCAGCTGACAGAAGA
GTTTGACGGTTCCCTGGATTACAACCACGAGGAGTGGATTGAGTTGCGCCTCTCCCTGGAGGAGTTCTTCAACAGTGCGGTCCACCTGCTCTCACGCCTCGAGGACCTGCAGGAGATGCTGGCCCGGA
AGGAGTTCCCTGTGGATGTGGAGGGCTCTCGGAGGCTTATCGACGAGCACACACAACTTAAGAAAAAGGTGCTGAAGGCCCCCGTGGAAGAGCTGGACCGGGAGGGGCAGCGGCTACTGCAGTGTATC
CGCTGCAGTGATGGCTTCTCAGGGCGCAACTGCATCCCAGGAAGTGCCGACTTCCAGAGCCTTGTACCCAAGATCACCAGCCTCCTGGACAAGCTGCATTCCACCCGACAACACCTGCACCAGATGTG
GCACGTCCGAAAGCTCAAGCTGGATCAGTGCTTCCAGCTGCGGCTCTTCGAGCAGGATGCCGAGAAGATGTTCGACTGGATAAGCCACAACAAGGAGTTATTTCTTCAGAGCCACACAGAGATCGGAG
TCAGCTACCAGCATGCACTAGACCTCCAGACACAGCACAATCACTTTGCCATGAACTCCATGAATGCCTATGTCAACATCAACCGCATCATGTCTGTCGCATCCCGCCTCTCAGAGGCTGGCCATTAT
GCCTCCCAGCAAATCAAGCAGATCTCCACGCAGCTAGACCAGGAGTGGAAGAGCTTTGCTGCTGCCCTGGATGAACGCAGTACAATCCTGGCCATGTCTGCTGTGTTCCACCAGAAGGCAGAGCAGTT
CCTGTCAGGAGTGGATGCCTGGTGTAAGATGTGCAGTGAAGGCGGCCTTCCTTCTGAGATGCAGGACCTGGAGCTGGCAATCCACCATCACCAGTCCTTGTATGAGCAGGTGACCCAGGCCTACACAG
AGGTCAGCCAGGATGGGAAAGCACTCCTGGATGTCCTGCAGCGTCCCCTGAGCCCTGGGAACTCCGAGTCCCTCACAGCCACAGCCAACTACTCCAAGGCGGTACACCAGGTGCTGGATGTGGTACAT
GAGGTGCTGCACCACCAGCGGCGGCTCGAGAGCATCTGGCAGCACCGTAAAGTGCGGCTTCACCAGCGGCTGCAGCTGTGCGTCTTCCAGCAGGATGTGCAGCAGGTGCTGGACTGGATTGAAAACCA
CGGTGAGGCCTTTCTCAGCAAACACACTGGGGTCGGCAAGTCCCTGCATCGGGCACGGGCATTGCAGAAGAGGCATGATGACTTTGAAGAGGTGGCTCAGAATACATACACCAATGCGGACAAGCTCC
TAGAGGCAGCAGAGCAGCTGGCTCAGACTGGGGAATGTGACCCGGAAGAGATCTACAAGGCTGCCCGACACCTGGAGGTGCGCATCCAAGACTTCGTGCGCAGAGTGGAGCAGCGGAAGCTTCTTCTG
GACATGTCCGTCTCTTTCCACACGCACACCAAAGAGCTGTGGACATGGATGGAAGACCTTCAGAAGGAGGTGCTGGAGGATGTCTGTGCAGACTCTGTGGATGCGGTCCAGGAACTGATCAAGCAGTT
CCAGCAGCAGCAGACCGCTACCCTGGACGCCACTCTCAACGTCATCAAGGAAGGCGAAGACCTTATCCAGCAGCTCAGGTCAGCGCCTCCCTCCCTGGGGGAGCCCACCGAGGCCAGGGACTCAGCTG
TATCCAACAACAAGACGCCCCACAGTAGTTCCATCAGCCATATCGAGTCTGTCCTCCAGCAGCTGGACGATGCTCAGGTACAGATGGAGGAGCTGTTTCACGAGCGGAAGATCAAGCTGGACATCTTC
CTGCAGCTGCGCATCTTCGAACAGTACACCATTGAGGTCACCGCAGAGCTGGATGCCTGGAATGAGGACTTGCTCCGGCAGATGAATGACTTCAACACAGAGGACCTGACCCTGGCAGAGCAGCGGCT
ACAGCGCCACACAGAACGGAAGCTTGCCATGAACAACATGACATTCGAGGTCATCCAGCAGGGCCAGGACCTGCACCAATATATCATGGAAGTCCAAGCCTCAGGAATCGAGTTAATCTGTGAGAAGG
ACGTTGACCTGGCAGCTCAGGTGCAAGAGCTACTGGAATTTCTCCATGAGAAGCAGCACGAACTGGAGCTCAATGCGGAGCAGACGCACAAGCGGCTAGAGCAGTGTCTCCAGCTGCGGCACCTCCAG
GCTGAGGTCAAACAGGTTCTGGGATGGATCCGCAATGGAGAGTCCATGCTCAACGCCAGCCTGGTCAATGCCAGCTCTTTGTCTGAGGCAGAGCAGCTACAGCGGGAGCACGAACAGTTCCAGCTAGC
CATCGAGAAGACGCACCAGAGCGCCCTGCAGGTACAGCAGAAGGCAGAGGCACTGCTCCAGGCCGGCCACTATGACGCCGATGCTATCCGGGAATGTGCGGAGAAGGTGGCCCTCCACTGGCAACAGC
TCATGCTAAAGATGGAGGACCGGCTGAAACTCGTCAATGCCTCTGTGGCCTTTTACAAGACCTCTGAGCAGGTGTGCAGCGTTCTGGAGAGCTTAGAGCAGGAGTACCGGAGAGACGAAGACTGGTGC
GGCGGGAGAGACAAGCTGGGGCCGGCGGCAGAGATGGACCACGTCATTCCACTCCTCAGCAAGCATCTGGAGCAGAAGGAGGCCTTCCTGAAGGCCTGCACTCTGGCACGGCGGAATGCCGAGGTGTT
CCTCAAGTACATCCACAGGAACAATGTGAGCATGCCCAGTGTTGCCAGCCACACCAGGGGACCCGAACAGCAAGTAAAAGCCATCTTGAGTGAGCTCTTGCAGAGAGAGAATCGCGTCCTGCACTTCT
GGACCTTGAAGAAGCGGCGGTTAGACCAGTGTCAGCAATATGTGGTGTTTGAACGCAGTGCTAAACAGGCACTAGACTGGATCCAAGAAACAGGAGAATATTACCTCTCAACCCATACCTCCACTGGA
GAGACCACAGAGGAGACTCAGGAGCTGCTGAAAGAGTATGGAGAATTCAGGGTGCCTGCCAAGCAAACAAAAGAGAAGGTGAAGCTTCTGATCCAGCTAGCAGACAGCTTTGTGGAAAAGGGCCACAT
CCATGCCACAGAGATACGGAAATGGGTGACCACGGTGGACAAGCACTACCGGGATTTCTCCCTGAGGATGGGGAAGTACCGGTACACCCTGGAGAAAGCCCTGGGAGTCAACACGGAGGATAACAAGG
ACCTAGAGCTGGACATTATCCCAGCAAGCCTTTCAGACCGGGAGGTCAAGCTCCGGGATGCTAACCACGAGGTCAATGAAGAGAAACGGAAGTCAGCTCGAAAGAAAGAATTCATTATGGCTGAACTG
CTCCAGACCGAGAAGGCTTATGTAAGAGACCTACACGAGTGCTTGGAGACCTACCTGTGGGAAATGACCAGTGGTGTGGAAGAGATACCACCTGGGATCCTCAATAAGGAGCACATCATCTTCGGCAA
CATCCAGGAGATCTATGACTTCCACAACAACATCTTCCTCAAAGAGCTGGAGAAGTACGAGCAGCTGCCTGAGGATGTGGGACACTGCTTTGTTACCTGGGCAGACAAATTTCAGATGTATGTCACCT
ACTGTAAAAACAAGCCTGATTCCAACCAGCTGATCCTGGAGCACGCAGGCACCTTCTTTGATGAGATCCAGCAGCGGCACGGGCTGGCCAACTCCATCTCTTCCTACTTAATTAAGCCTGTCCAGAGA
GTTACGAAGTACCAGCTGCTCCTGAAGGAACTTTTAACTTGCTGTGAAGAAGGGAAAGGGGAGCTCAAGGATGGCCTGGAGGTGATGCTCAGTGTCCCCAAGAAAGCCAATGATGCCATGCATGTCAG
CATGCTTGAAGGGTTCGATGAGAACTTGGATGTACAGGGGGAGTTGATTCTCCAGGATGCCTTTCAAGTGTGGGACCCAAAGTCGCTGATCCGGAAGGGGCGGGAACGGCATCTGTTCCTCTTTGAGA
TCTCCTTGGTGTTTAGCAAAGAGATCAAAGACTCTTCAGGACACACGAAATATGTTTACAAGAACAAGCTACTGACCTCAGAGCTGGGTGTGACCGAGCACGTAGAAGGTGACCCCTGCAAATTCGCC
TTGTGGTCTGGGCGCACCCCATCCTCAGACAATAAAACAGTGCTCAAAGCTTCCAACATCGAAACCAAGCAGGAATGGATCAAGAACATTCGGGAAGTGATTCAGGAAAGGATCATTCATCTTAAAGG
AGCTTTAAAGGAGCCAATCCAGCTCCCCAAAACACCAGCCAAACTGAGGAACAATAGTAAGAGGGATGGGGTAGAGGATGGTGACAGCCAGGGGGACGGGAGCAGCCAGCCCGATACCATATCCATTG
CCTCCAGGACCTCTCAGAACACAGTGGAGAGTGACAAGCTCTCAGGTGGATGTGAGCTGACCGTGGTCCTCCAGGACTTCAGCGCGGCCCACAGCAGTGAGCTGAGCATCCAGGTGGGGCAGACTGTG
GAGCTGTTGGAACGACCCAGTGAGAGACCCGGCTGGTGTCTGGTCCGCACCACAGAGCGGAGCCCCCCACAGGAAGGCCTGGTCCCCAGCAGCACCTTGTGCATCTCACACTCGAGAAGCAGCGTGGA
AATGGACTGCTTCTTCCCCCTGGTGAAAGATTCATACTCTCATTCCTCCGGTGAGAATGGAGGCAAGTCTGAGTCCGTGGCCAACCTGCAGTCTCAGCCCTCCCTGAACTCCATCCACAGTTCCCCTG
GTCCCAAGCGCTCCACCAACACCCTTAAGAAGTGGCTGACGAGCCCTGTGCGTCGGCTCAACAGCGGGAAAGCAGACGGAAACATCAAAAAGCAGAAGAAAGTACGGGATGGGCGGAAGAGCTTCGAC
CTGGGCTCACCCAAGCCAGGGGACGAGACAACCCCTCAGGGAGACAGCGCTGATGAGAAGAGCAAGAAAGGTTGGGGAGAAGATGAGCCAGATGAAGAGTCACACACACCTCTCCCCCCGCCCATGAA
GATCTTTGACAACGACCCCACCCAGGATGAGATGTCCTCTTTGCTAGCAGCCCGGCAGGCTCCCACTGACGTGCCTACTGCTGCAGACCTTGTCAGTGCAATAGAAAAGTTGGTCAAAAGTAAGCTGA
CTCTGGAAGGAGGCTCTTACCGGGGGAGCTTGAAGGACCCTACAGTCTGCCTGAATGAGGGGATGGCCCCTCCCACACCTCCTAGAAACCTGGAAGAAGAACAGAAAGCCAAGGCTCTAAGAGGCAGG
ATGTTTGTCCTGAATGAGTTGGTGCAGACAGAGAAGGACTACGTCAAGGACCTGGGGATTGTGGTGGAGGGCTTCATGAAAAGAATAGAAGAGAAGGGGGTCCCCGAGGACATGCGAGGGAAGGAAAA
GATCGTGTTTGGAAACATCCACCAGATTTACGACTGGCATAAAGATTTTTTCCTGGCTGAACTGGAAAAATGCATCCAAGAGCAAGACAGATTGGCCCAGCTCTTCATTAAACATGAGCGGAAGCTGC
ACATCTATGTGTGGTACTGCCAGAACAAACCACGTTCCGAATACATCGTGGCTGAATATGATGCCTACTTTGAGGAGGTTAAACAAGAGATCAATCAAAGGCTGACCCTTAGTGACTTCCTCATCAAG
CCCATTCAGAGAATAACAAAGTACCAGCTGCTACTCAAGGACTTCCTGCGGTACAGCGAGAAGGCTGGTTTGGAGTGTTCTGATATTGAGAAAGCAGTGGAGTTAATGTGCCTTGTCCCCAAGCGCTG
TAATGACATGATGAATCTGGGACGCCTGCAGGGCTTTGAGGGCACCCTGACCGCCCAGGGCAAGCTTCTACAGCAGGACACGTTCTATGTGATTGAGCTGGATGCTGGCATGCAGTCCCGGACCAAGG
AGAGGCGTGTGTTTCTCTTTGAGCAGATTGTCATCTTTAGTGAACTGCTCCGAAAGGGATCCCTCACCCCAGGCTACATGTTCAAGAGGAGCATCAAGATGAATTACTTGGTTCTGGAAGAAGATGTG
GATGATGACCCCTGCAAATTTGCACTTATGAACAGGGAGACTTCAGAAAGGGTCATTCTGCAGGCCGCCAACTCAGACATCCAGCAGGCCTGGGTGCAGGACATCAACCAAGTCCTAGAAACACAGAG
GGACTTCTTAAATGCTCTGCAGTCACCCATCGAGTATCAGCGGAAGGAGAGGAGCACAGCTGTGATCCGGTCCCAGCCCCCTAGGGTTCCTCAAGCCAGCCCCAGGCCCTATTCGTCTGTCCCAGTGG
GCTCAGAGAAACCCCCCAAGGGCTCCAGCTACAACCCGCCCCTGCCACCCCTGAAAATATCTACCTCGAATGGCAGTCCAGGGTTCGACTACCACCAGCCTGGGGACAAGTTTGACGCTAGCAAGCAG
AACGACCTGGGAGGCTGCAATGGGACCTCAACCATGGCCGTAATTAAAGATTACTATGCACTGAAGGAGAACGAAATCTGTGTGAGCCAAGGTGAGGTGGTCCAGGTCCTCGCCGTCAACCAGCAGAA
CATGTGTCTGGTGTACCAGCCTGCCAGCGACCATTCCCCAGCAGCGGAGGGCTGGGTCCCAGGCAGCATCCTGGCACCCCTCACCAAAGCCACAGCGCCGGCCGAGAGTAGTGATGAGAGCATCAAGA
AGTCATGCTCATGGCACACTCTACGCATGAGAAAGCGGGCAGACGTGGAGAACACGGGTAAAAATGAAGCCACAGGGCCTCGTAAACCCAAGGATATTCTGGGCAACAAAGCCTCTGTTAAAGAGACG
AACAGTTCCGAGGAGTCAGAGTGTGATGATCTTGACCCTAATACTAGTATGGAGATCTTGAATCCGAATTTCATCCAGGAAGTGGCTCCGGAATTCCTTGTGCCCTTGGTAGATGTGACCTGCTTGCT
CGGAGACACAGTACTGCTACAGTGCAAAGCCTGTGGGCGGCCAAAGCCTACCATCACCTGGAAGGGTCCAGATCAGAACATCCTAGACACCGACAACAGTTCAGCCACATACACCATCTCCTCCTGTG
ATTCTGGGGAAAGCACCCTCAAGATCTGCAACCTGATGCCCCAAGACAGCGGGATTTATACCTGCATAGCAACAAATGACCACGGAACCGCATCCACGTCTGCTACAGTTAAGGTGCAAGGTGTACCC
GCAGCCCCCAATCGCCCAATCGCACAGGAGAGGAGCTGCACCTCCGTCATCCTCCGCTGGCTGCCCCCAGCCAGCACCGGAAACTGCACTATTTCGGGGTACACAGTGGAGTACCGCGAGGAAGGTTC
GCAGGTCTGGCAGCAGTCGGTAGCTTCAACCTTGGACACTTACCTAGTCATTGAAGATCTTAGTCCAGGGTGCCCTTATCAGTTCAGGGTCAGCGCCAGCAACCCCTGGGGAATCAGCCTTCCCAGTG
AGCCCTCGGAGTTTGTGCACCTTCCAGAGTACGATGCAGCTGCTGATGGTGCCACCATTTCTTGGAAGGAAAATTTTGATTCTGCTTACACCGAACTGAACGAGATTGGCAGAGGCCGTTTCTCTATT
GTAAAGAAATGCATTCACAAAGCTACCCGCAAAGACGTTGCTGTGAAATTTGTGAGCAAGAAAATGAAAAAGAAGGAACAGGCTGCGCACGAGGCCGCCCTGCTCCAGCACCTGCAGCACCCCCAGTA
CGTCACCCTCCACGACACCTACGAGTCCCCCACATCCTACATCCTGATTTTGGAACTGATGGATGACGGCCGACTCTTGGACTACCTAATGAATCACGATGAGCTGATGGAAGAAAAGGTAGCTTTCT
ACATTCGAGACATCATGGAAGCTCTGCAGTACCTTCACAACTGCAGGGTGGCACATTTGGACATAAAGCCTGAAAACCTCCTCATTGACCTCCGGATCCCAGTGCCTCGAGTGAAACTCATCGACTTG
GAAGATGCTGTCCAGATCTCAGGCCACTTCCACATCCACCATCTGCTGGGGAACCCTGAGTTTGCTGCCCCGGAAGTGATCCAAGGCATCCCTGTCTCCCTGGGCACAGACATCTGGAGCATCGGGGT
TCTGACCTACGTCATGCTTAGCGGGGTCTCCCCCTTCTTAGATGAGAGCAAAGAGGAGACCTGCATCAACGTGTGCAGGGTGGACTTCAGCTTCCCCCACGAATACTTCTGCGGTGTAAGCAATGCTG
CCAGGGACTTCATCAACGTCATCTTACAGGAAGACTTCCGGAGGCGGCCCACAGCAGCCACGTGCCTGCAGCATCCGTGGCTGCAGCCCCACAACGGCAGCTACTCCAAGATCCCCTTGGATACCTCC
CGCCTGGCCTGCTTCATAGAGCGCCGCAAGCACCAGAATGACGTGCGGCCCATTCCCAATGTCAAAAGTTACATCGTCAACAGGGTGAACCAGGGGACCTAGCTATCCCACCGTCCCTCCACCCCGAG
GTTTCACATAGACGTGCAGT

hide sequence

RefSeq Acc Id:

XM_039088638 ⟹ XP_038944566

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,749 - 80,309,210 (+)	NCBI
mRatBN7.2	11	66,251,541 - 66,803,166 (+)	NCBI

RefSeq Acc Id:

XM_039088639 ⟹ XP_038944567

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,749 - 80,309,210 (+)	NCBI
mRatBN7.2	11	66,251,541 - 66,803,166 (+)	NCBI

RefSeq Acc Id:

XM_039088640 ⟹ XP_038944568

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,748 - 80,309,210 (+)	NCBI
mRatBN7.2	11	66,251,541 - 66,803,166 (+)	NCBI

RefSeq Acc Id:

XM_039088641 ⟹ XP_038944569

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,749 - 80,309,210 (+)	NCBI
mRatBN7.2	11	66,254,969 - 66,797,564 (+)	NCBI

RefSeq Acc Id:

XM_039088642 ⟹ XP_038944570

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,703,345 - 80,309,210 (+)	NCBI
mRatBN7.2	11	66,198,520 - 66,797,564 (+)	NCBI

RefSeq Acc Id:

XM_039088643 ⟹ XP_038944571

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,749 - 80,309,210 (+)	NCBI
mRatBN7.2	11	66,254,969 - 66,797,564 (+)	NCBI

RefSeq Acc Id:

XM_039088644 ⟹ XP_038944572

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,749 - 80,309,210 (+)	NCBI
mRatBN7.2	11	66,251,541 - 66,797,564 (+)	NCBI

RefSeq Acc Id:

XM_039088645 ⟹ XP_038944573

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,748 - 80,309,210 (+)	NCBI
mRatBN7.2	11	66,251,541 - 66,803,166 (+)	NCBI

RefSeq Acc Id:

XM_039088646 ⟹ XP_038944574

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,749 - 80,309,210 (+)	NCBI
mRatBN7.2	11	66,251,541 - 66,803,166 (+)	NCBI

RefSeq Acc Id:

XM_039088647 ⟹ XP_038944575

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,748 - 80,309,210 (+)	NCBI
mRatBN7.2	11	66,251,541 - 66,803,166 (+)	NCBI

RefSeq Acc Id:

XM_039088648 ⟹ XP_038944576

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,814,904 - 80,309,210 (+)	NCBI
mRatBN7.2	11	66,311,425 - 66,797,602 (+)	NCBI

RefSeq Acc Id:

XM_039088649 ⟹ XP_038944577

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,750 - 80,309,210 (+)	NCBI
mRatBN7.2	11	66,251,542 - 66,803,166 (+)	NCBI

RefSeq Acc Id:

XM_039088650 ⟹ XP_038944578

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,749 - 80,309,210 (+)	NCBI
mRatBN7.2	11	66,251,541 - 66,803,166 (+)	NCBI

RefSeq Acc Id:

XM_039088651 ⟹ XP_038944579

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,755 - 80,274,361 (+)	NCBI
mRatBN7.2	11	66,251,544 - 66,770,216 (+)	NCBI

RefSeq Acc Id:

XM_039088652 ⟹ XP_038944580

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,757 - 80,266,650 (+)	NCBI
mRatBN7.2	11	66,251,545 - 66,761,497 (+)	NCBI

RefSeq Acc Id:

XM_039088653 ⟹ XP_038944581

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,757 - 80,266,650 (+)	NCBI
mRatBN7.2	11	66,251,545 - 66,761,497 (+)	NCBI

RefSeq Acc Id:

XM_039088654 ⟹ XP_038944582

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,756 - 80,265,803 (+)	NCBI
mRatBN7.2	11	66,251,545 - 66,760,639 (+)	NCBI

RefSeq Acc Id:

XM_039088655 ⟹ XP_038944583

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,757 - 80,266,650 (+)	NCBI
mRatBN7.2	11	66,251,545 - 66,760,966 (+)	NCBI

RefSeq Acc Id:

XM_039088656 ⟹ XP_038944584

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,816,614 - 80,266,650 (+)	NCBI
mRatBN7.2	11	66,311,425 - 66,761,474 (+)	NCBI

RefSeq Acc Id:

XM_039088657 ⟹ XP_038944585

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	80,016,509 - 80,309,210 (+)	NCBI
mRatBN7.2	11	66,511,317 - 66,803,166 (+)	NCBI

RefSeq Acc Id:

XM_039088658 ⟹ XP_038944586

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,703,346 - 80,239,355 (+)	NCBI
mRatBN7.2	11	66,198,155 - 66,736,072 (+)	NCBI

RefSeq Acc Id:

XM_039088660 ⟹ XP_038944588

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,752 - 80,134,722 (+)	NCBI
mRatBN7.2	11	66,251,543 - 66,629,551 (+)	NCBI

RefSeq Acc Id:

XM_039088661 ⟹ XP_038944589

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,703,347 - 80,134,722 (+)	NCBI
mRatBN7.2	11	66,198,156 - 66,629,551 (+)	NCBI

RefSeq Acc Id:

XM_039088662 ⟹ XP_038944590

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,752 - 80,134,722 (+)	NCBI
mRatBN7.2	11	66,251,543 - 66,629,551 (+)	NCBI

RefSeq Acc Id:

XM_039088663 ⟹ XP_038944591

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,752 - 80,134,722 (+)	NCBI
mRatBN7.2	11	66,251,543 - 66,629,551 (+)	NCBI

RefSeq Acc Id:

XM_039088664 ⟹ XP_038944592

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,703,347 - 80,134,722 (+)	NCBI
mRatBN7.2	11	66,198,156 - 66,629,551 (+)	NCBI

RefSeq Acc Id:

XM_039088665 ⟹ XP_038944593

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,752 - 80,134,722 (+)	NCBI
mRatBN7.2	11	66,251,543 - 66,629,551 (+)	NCBI

RefSeq Acc Id:

XM_039088666 ⟹ XP_038944594

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,751 - 80,134,722 (+)	NCBI
mRatBN7.2	11	66,251,543 - 66,629,551 (+)	NCBI

RefSeq Acc Id:

XM_039088667 ⟹ XP_038944595

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,751 - 80,134,722 (+)	NCBI
mRatBN7.2	11	66,251,543 - 66,629,551 (+)	NCBI

RefSeq Acc Id:

XM_063270778 ⟹ XP_063126848

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,751 - 80,309,210 (+)	NCBI

RefSeq Acc Id:

XM_063270779 ⟹ XP_063126849

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,757 - 80,266,650 (+)	NCBI

RefSeq Acc Id:

XM_063270780 ⟹ XP_063126850

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,758 - 80,266,650 (+)	NCBI

RefSeq Acc Id:

XM_063270781 ⟹ XP_063126851

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,757 - 80,265,803 (+)	NCBI

RefSeq Acc Id:

XM_063270782 ⟹ XP_063126852

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,759 - 80,266,650 (+)	NCBI

RefSeq Acc Id:

XM_063270783 ⟹ XP_063126853

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	79,756,760 - 80,266,650 (+)	NCBI

RefSeq Acc Id:

XM_063270784 ⟹ XP_063126854

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	80,193,785 - 80,309,210 (+)	NCBI

RefSeq Acc Id:

XM_063270785 ⟹ XP_063126855

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	80,193,790 - 80,309,210 (+)	NCBI

RefSeq Acc Id:

XM_063270786 ⟹ XP_063126856

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	80,194,073 - 80,265,803 (+)	NCBI

RefSeq Acc Id:

XM_063270787 ⟹ XP_063126857

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	80,194,077 - 80,265,803 (+)	NCBI

RefSeq Acc Id:

XM_063270788 ⟹ XP_063126858

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	80,194,078 - 80,265,803 (+)	NCBI

RefSeq Acc Id:

XM_063270789 ⟹ XP_063126859

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	80,194,075 - 80,265,803 (+)	NCBI

RefSeq Acc Id:

XM_063270790 ⟹ XP_063126860

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	80,194,076 - 80,265,803 (+)	NCBI


Protein RefSeqs	NP_114451	(Get FASTA)	NCBI Sequence Viewer
	XP_038944566	(Get FASTA)	NCBI Sequence Viewer
	XP_038944567	(Get FASTA)	NCBI Sequence Viewer
	XP_038944568	(Get FASTA)	NCBI Sequence Viewer
	XP_038944569	(Get FASTA)	NCBI Sequence Viewer
	XP_038944570	(Get FASTA)	NCBI Sequence Viewer
	XP_038944571	(Get FASTA)	NCBI Sequence Viewer
	XP_038944572	(Get FASTA)	NCBI Sequence Viewer
	XP_038944573	(Get FASTA)	NCBI Sequence Viewer
	XP_038944574	(Get FASTA)	NCBI Sequence Viewer
	XP_038944575	(Get FASTA)	NCBI Sequence Viewer
	XP_038944576	(Get FASTA)	NCBI Sequence Viewer
	XP_038944577	(Get FASTA)	NCBI Sequence Viewer
	XP_038944578	(Get FASTA)	NCBI Sequence Viewer
	XP_038944579	(Get FASTA)	NCBI Sequence Viewer
	XP_038944580	(Get FASTA)	NCBI Sequence Viewer
	XP_038944581	(Get FASTA)	NCBI Sequence Viewer
	XP_038944582	(Get FASTA)	NCBI Sequence Viewer
	XP_038944583	(Get FASTA)	NCBI Sequence Viewer
	XP_038944584	(Get FASTA)	NCBI Sequence Viewer
	XP_038944585	(Get FASTA)	NCBI Sequence Viewer
	XP_038944586	(Get FASTA)	NCBI Sequence Viewer
	XP_038944588	(Get FASTA)	NCBI Sequence Viewer
	XP_038944589	(Get FASTA)	NCBI Sequence Viewer
	XP_038944590	(Get FASTA)	NCBI Sequence Viewer
	XP_038944591	(Get FASTA)	NCBI Sequence Viewer
	XP_038944592	(Get FASTA)	NCBI Sequence Viewer
	XP_038944593	(Get FASTA)	NCBI Sequence Viewer
	XP_038944594	(Get FASTA)	NCBI Sequence Viewer
	XP_038944595	(Get FASTA)	NCBI Sequence Viewer
	XP_063126848	(Get FASTA)	NCBI Sequence Viewer
	XP_063126849	(Get FASTA)	NCBI Sequence Viewer
	XP_063126850	(Get FASTA)	NCBI Sequence Viewer
	XP_063126851	(Get FASTA)	NCBI Sequence Viewer
	XP_063126852	(Get FASTA)	NCBI Sequence Viewer
	XP_063126853	(Get FASTA)	NCBI Sequence Viewer
	XP_063126854	(Get FASTA)	NCBI Sequence Viewer
	XP_063126855	(Get FASTA)	NCBI Sequence Viewer
	XP_063126856	(Get FASTA)	NCBI Sequence Viewer
	XP_063126857	(Get FASTA)	NCBI Sequence Viewer
	XP_063126858	(Get FASTA)	NCBI Sequence Viewer
	XP_063126859	(Get FASTA)	NCBI Sequence Viewer
	XP_063126860	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB66366	(Get FASTA)	NCBI Sequence Viewer
	AAB66367	(Get FASTA)	NCBI Sequence Viewer
	AAC03057	(Get FASTA)	NCBI Sequence Viewer
	AAC15790	(Get FASTA)	NCBI Sequence Viewer
	AAF66014	(Get FASTA)	NCBI Sequence Viewer
	AAF66018	(Get FASTA)	NCBI Sequence Viewer
	AAF66019	(Get FASTA)	NCBI Sequence Viewer
	AAF69144	(Get FASTA)	NCBI Sequence Viewer
	AAT39517	(Get FASTA)	NCBI Sequence Viewer
	EDM11342	(Get FASTA)	NCBI Sequence Viewer
	EDM11343	(Get FASTA)	NCBI Sequence Viewer
	EDM11344	(Get FASTA)	NCBI Sequence Viewer
	EDM11345	(Get FASTA)	NCBI Sequence Viewer
	EDM11346	(Get FASTA)	NCBI Sequence Viewer
	EDM11347	(Get FASTA)	NCBI Sequence Viewer
	EDM11348	(Get FASTA)	NCBI Sequence Viewer
	EDM11349	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016340
	ENSRNOP00000097769
GenBank Protein	P97924	(Get FASTA)	NCBI Sequence Viewer
	SPT35768	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_114451 ⟸ NM_032062

- UniProtKB:

A0A8I6GKY9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTDRFWDQWYLWYLRLLRLLDRGSFRNDGLKASDVLPILKEKVAFVSGGRDKRGGPILTFPARTNHDRIRQEDLRKLVTNLASVPSEDVCKRGFTVIIDMRGSKWDLIKPLLKTLQEAFPAEIHVALI
IKPDNFWQKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNHEEWIELRLSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKAPVEELDREGQRLLQCI
RCSDGFSGRNCIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQHALDLQTQHNHFAMNSMNAYVNINRIMSVASRLSEAGHY
ASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVFHQKAEQFLSGVDAWCKMCSEGGLPSEMQDLELAIHHHQSLYEQVTQAYTEVSQDGKALLDVLQRPLSPGNSESLTATANYSKAVHQVLDVVH
EVLHHQRRLESIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLL
DMSVSFHTHTKELWTWMEDLQKEVLEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAPPSLGEPTEARDSAVSNNKTPHSSSISHIESVLQQLDDAQVQMEELFHERKIKLDIF
LQLRIFEQYTIEVTAELDAWNEDLLRQMNDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIMEVQASGIELICEKDVDLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQ
AEVKQVLGWIRNGESMLNASLVNASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEALLQAGHYDADAIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWC
GGRDKLGPAAEMDHVIPLLSKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSMPSVASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQETGEYYLSTHTSTG
ETTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVEKGHIHATEIRKWVTTVDKHYRDFSLRMGKYRYTLEKALGVNTEDNKDLELDIIPASLSDREVKLRDANHEVNEEKRKSARKKEFIMAEL
LQTEKAYVRDLHECLETYLWEMTSGVEEIPPGILNKEHIIFGNIQEIYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSNQLILEHAGTFFDEIQQRHGLANSISSYLIKPVQR
VTKYQLLLKELLTCCEEGKGELKDGLEVMLSVPKKANDAMHVSMLEGFDENLDVQGELILQDAFQVWDPKSLIRKGRERHLFLFEISLVFSKEIKDSSGHTKYVYKNKLLTSELGVTEHVEGDPCKFA
LWSGRTPSSDNKTVLKASNIETKQEWIKNIREVIQERIIHLKGALKEPIQLPKTPAKLRNNSKRDGVEDGDSQGDGSSQPDTISIASRTSQNTVESDKLSGGCELTVVLQDFSAAHSSELSIQVGQTV
ELLERPSERPGWCLVRTTERSPPQEGLVPSSTLCISHSRSSVEMDCFFPLVKDSYSHSSGENGGKSESVANLQSQPSLNSIHSSPGPKRSTNTLKKWLTSPVRRLNSGKADGNIKKQKKVRDGRKSFD
LGSPKPGDETTPQGDSADEKSKKGWGEDEPDEESHTPLPPPMKIFDNDPTQDEMSSLLAARQAPTDVPTAADLVSAIEKLVKSKLTLEGGSYRGSLKDPTVCLNEGMAPPTPPRNLEEEQKAKALRGR
MFVLNELVQTEKDYVKDLGIVVEGFMKRIEEKGVPEDMRGKEKIVFGNIHQIYDWHKDFFLAELEKCIQEQDRLAQLFIKHERKLHIYVWYCQNKPRSEYIVAEYDAYFEEVKQEINQRLTLSDFLIK
PIQRITKYQLLLKDFLRYSEKAGLECSDIEKAVELMCLVPKRCNDMMNLGRLQGFEGTLTAQGKLLQQDTFYVIELDAGMQSRTKERRVFLFEQIVIFSELLRKGSLTPGYMFKRSIKMNYLVLEEDV
DDDPCKFALMNRETSERVILQAANSDIQQAWVQDINQVLETQRDFLNALQSPIEYQRKERSTAVIRSQPPRVPQASPRPYSSVPVGSEKPPKGSSYNPPLPPLKISTSNGSPGFDYHQPGDKFDASKQ
NDLGGCNGTSTMAVIKDYYALKENEICVSQGEVVQVLAVNQQNMCLVYQPASDHSPAAEGWVPGSILAPLTKATAPAESSDESIKKSCSWHTLRMRKRADVENTGKNEATGPRKPKDILGNKASVKET
NSSEESECDDLDPNTSMEILNPNFIQEVAPEFLVPLVDVTCLLGDTVLLQCKACGRPKPTITWKGPDQNILDTDNSSATYTISSCDSGESTLKICNLMPQDSGIYTCIATNDHGTASTSATVKVQGVP
AAPNRPIAQERSCTSVILRWLPPASTGNCTISGYTVEYREEGSQVWQQSVASTLDTYLVIEDLSPGCPYQFRVSASNPWGISLPSEPSEFVHLPEYDAAADGATISWKENFDSAYTELNEIGRGRFSI
VKKCIHKATRKDVAVKFVSKKMKKKEQAAHEAALLQHLQHPQYVTLHDTYESPTSYILILELMDDGRLLDYLMNHDELMEEKVAFYIRDIMEALQYLHNCRVAHLDIKPENLLIDLRIPVPRVKLIDL
EDAVQISGHFHIHHLLGNPEFAAPEVIQGIPVSLGTDIWSIGVLTYVMLSGVSPFLDESKEETCINVCRVDFSFPHEYFCGVSNAARDFINVILQEDFRRRPTAATCLQHPWLQPHNGSYSKIPLDTS
RLACFIERRKHQNDVRPIPNVKSYIVNRVNQGT

hide sequence

Ensembl Acc Id:

ENSRNOP00000016340 ⟸ ENSRNOT00000016340

Ensembl Acc Id:

ENSRNOP00000039072 ⟸ ENSRNOT00000049292

RefSeq Acc Id:	XP_038944586 ⟸ XM_039088658
- Peptide Label:	isoform X27
- UniProtKB:	A6IRJ3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038944589 ⟸ XM_039088661
- Peptide Label:	isoform X29
- UniProtKB:	A0A8L2Q7U3 (UniProtKB/TrEMBL), A6IRJ4 (UniProtKB/TrEMBL)

Protein Domains

CRAL-TRIO DH Fibronectin type-III Ig-like Ig-like C2-type PH Protein kinase SH3

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-21148	BioCyc
Ensembl Genes	ENSRNOG00000001706	Ensembl, ENTREZGENE
	ENSRNOG00000072161	ENTREZGENE
Ensembl Transcript	ENSRNOT00000016340	ENTREZGENE
	ENSRNOT00000101686	ENTREZGENE
Gene3D-CATH	1.20.58.60	UniProtKB/Swiss-Prot
	1.20.900.10	UniProtKB/Swiss-Prot
	2.30.29.30	UniProtKB/Swiss-Prot
	2.60.40.10	UniProtKB/Swiss-Prot
	3.40.525.10	UniProtKB/Swiss-Prot
	Phosphorylase Kinase, domain 1	UniProtKB/Swiss-Prot
	SH3 Domains	UniProtKB/Swiss-Prot
	Transferase(Phosphotransferase) domain 1	UniProtKB/Swiss-Prot
InterPro	CRAL-TRIO_dom	UniProtKB/Swiss-Prot
	CRAL-TRIO_dom_sf	UniProtKB/Swiss-Prot
	DBL_dom_sf	UniProtKB/Swiss-Prot
	DH-domain	UniProtKB/Swiss-Prot
	FN3_dom	UniProtKB/Swiss-Prot
	FN3_sf	UniProtKB/Swiss-Prot
	Ig-like_dom	UniProtKB/Swiss-Prot
	Ig-like_dom_sf	UniProtKB/Swiss-Prot
	Ig-like_fold	UniProtKB/Swiss-Prot
	Ig_I-set	UniProtKB/Swiss-Prot
	Ig_sub	UniProtKB/Swiss-Prot
	Ig_sub2	UniProtKB/Swiss-Prot
	Kalirin/TRIO	UniProtKB/Swiss-Prot
	Kalirin_TRIO_PH_1	UniProtKB/Swiss-Prot
	Kalirin_TRIO_SH3_2	UniProtKB/Swiss-Prot
	Kinase-like_dom_sf	UniProtKB/Swiss-Prot
	PH-like_dom_sf	UniProtKB/Swiss-Prot
	PH_domain	UniProtKB/Swiss-Prot
	Prot_kinase_dom	UniProtKB/Swiss-Prot
	Protein_kinase_ATP_BS	UniProtKB/Swiss-Prot
	RhoGEF_Guanine_NuclExch_SF	UniProtKB/Swiss-Prot
	Ser/Thr_kinase_AS	UniProtKB/Swiss-Prot
	SH3-like_dom_sf	UniProtKB/Swiss-Prot
	SH3_domain	UniProtKB/Swiss-Prot
	SOS1_NGEF_PH	UniProtKB/Swiss-Prot
	Spectrin/alpha-actinin	UniProtKB/Swiss-Prot
	Spectrin_repeat	UniProtKB/Swiss-Prot
KEGG Report	rno:84009	UniProtKB/Swiss-Prot
NCBI Gene	84009	ENTREZGENE
PANTHER	KALIRIN	UniProtKB/Swiss-Prot
	RHO GUANINE EXCHANGE FACTOR-RELATED	UniProtKB/Swiss-Prot
Pfam	CRAL_TRIO_2	UniProtKB/Swiss-Prot
	fn3	UniProtKB/Swiss-Prot
	I-set	UniProtKB/Swiss-Prot
	Pkinase	UniProtKB/Swiss-Prot
	RhoGEF	UniProtKB/Swiss-Prot
	SH3-RhoG_link	UniProtKB/Swiss-Prot
	SH3_1	UniProtKB/Swiss-Prot
	SOS1_NGEF_PH	UniProtKB/Swiss-Prot
	Spectrin	UniProtKB/Swiss-Prot
PhenoGen	Kalrn	PhenoGen
PROSITE	CRAL_TRIO	UniProtKB/Swiss-Prot
	DH_2	UniProtKB/Swiss-Prot
	FN3	UniProtKB/Swiss-Prot
	IG_LIKE	UniProtKB/Swiss-Prot
	PH_DOMAIN	UniProtKB/Swiss-Prot
	PROTEIN_KINASE_ATP	UniProtKB/Swiss-Prot
	PROTEIN_KINASE_DOM	UniProtKB/Swiss-Prot
	PROTEIN_KINASE_ST	UniProtKB/Swiss-Prot
	SH3	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000001706	RatGTEx
	ENSRNOG00000072161	RatGTEx
SMART	FN3	UniProtKB/Swiss-Prot
	IGc2	UniProtKB/Swiss-Prot
	RhoGEF	UniProtKB/Swiss-Prot
	S_TKc	UniProtKB/Swiss-Prot
	SEC14	UniProtKB/Swiss-Prot
	SH3	UniProtKB/Swiss-Prot
	SM00233	UniProtKB/Swiss-Prot
	SM00409	UniProtKB/Swiss-Prot
	SPEC	UniProtKB/Swiss-Prot
Superfamily-SCOP	PH domain-like	UniProtKB/Swiss-Prot
	Spectrin repeat	UniProtKB/Swiss-Prot
	SSF48065	UniProtKB/Swiss-Prot
	SSF48726	UniProtKB/Swiss-Prot
	SSF49265	UniProtKB/Swiss-Prot
	SSF50044	UniProtKB/Swiss-Prot
	SSF52087	UniProtKB/Swiss-Prot
	SSF56112	UniProtKB/Swiss-Prot
UniProt	A0A2X0SFF1	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5Y1V9_RAT	UniProtKB/TrEMBL
	A0A8I5ZVT3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A0J4_RAT	UniProtKB/TrEMBL
	A0A8I6A0Z4	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6ACF7	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AUW1	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6GKY9	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2Q7U3	ENTREZGENE, UniProtKB/TrEMBL
	A6IRI9	ENTREZGENE, UniProtKB/TrEMBL
	A6IRJ0	ENTREZGENE, UniProtKB/TrEMBL
	A6IRJ2_RAT	UniProtKB/TrEMBL
	A6IRJ3	ENTREZGENE, UniProtKB/TrEMBL
	A6IRJ4	ENTREZGENE, UniProtKB/TrEMBL
	A6IRJ6_RAT	UniProtKB/TrEMBL
	F1LZV1_RAT	UniProtKB/TrEMBL
	KALRN_RAT	UniProtKB/Swiss-Prot
	O70135	ENTREZGENE
	P97924	ENTREZGENE
	Q6IV51	ENTREZGENE
	Q9JIF1	ENTREZGENE
	Q9JIF2	ENTREZGENE
	Q9JIG0	ENTREZGENE
	Q9JIH3	ENTREZGENE
UniProt Secondary	O70135	UniProtKB/Swiss-Prot
	Q6IV51	UniProtKB/Swiss-Prot
	Q9JIF1	UniProtKB/Swiss-Prot
	Q9JIF2	UniProtKB/Swiss-Prot
	Q9JIG0	UniProtKB/Swiss-Prot
	Q9JIH3	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-03-14	Kalrn	kalirin, RhoGEF kinase	Hapip	huntingtin-associated protein interacting protein (duo)	Symbol and Name updated to reflect Human and Mouse nomenclature	1299863	APPROVED
2002-08-07	Hapip	huntingtin-associated protein interacting protein (duo)			Symbol and Name status set to provisional	70820	PROVISIONAL

Note Type	Note	Reference
gene_domains	contains dual Rho GTPase guanine nucleotide exchange factor (GEF) domains that interact with Rac1 and RhoA	628431
gene_expression	expressed mainly in the nervous system	628431
gene_physical_interaction	binds to the cytoplasmic domain of peptidylglycine alpha-amidating monooxygenase (PAM), a membrane protein mediating neuropeptide biosynthesis	628431
gene_process	participates in regulation of neuronal fiber extension and pathfinding during development	628431
gene_process	initiates new axons and axonal outgrowth via RhoG-mediated mechanisms	628431

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - PID (archival)