Symbol:
Kpna2
Name:
karyopherin subunit alpha 2
RGD ID:
621419
Description:
Predicted to enable several functions, including histone deacetylase binding activity; nuclear import signal receptor activity; and nuclear localization sequence binding activity. Involved in postsynapse to nucleus signaling pathway and regulation of transcription by glucose. Predicted to be located in cytoplasmic stress granule; cytosol; and nucleoplasm. Predicted to be part of NLS-dependent protein nuclear import complex. Predicted to be active in several cellular components, including glutamatergic synapse; nuclear membrane; and postsynaptic density. Orthologous to human KPNA2 (karyopherin subunit alpha 2); PARTICIPATES IN influenza A pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
importin; importin subunit alpha-1; importin subunit alpha-2; karyopherin (importin) alpha 2; karyopherin alpha 2; MGC108637; nuclear import protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KPNA2 (karyopherin subunit alpha 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Kpna2 (karyopherin subunit alpha 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Kpna2 (karyopherin subunit alpha 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
KPNA2 (karyopherin subunit alpha 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KPNA2 (karyopherin subunit alpha 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Kpna2 (karyopherin subunit alpha 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KPNA2 (karyopherin subunit alpha 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KPNA2 (karyopherin subunit alpha 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Kpna2 (karyopherin subunit alpha 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Kpna2 (karyopherin subunit alpha 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
KPNA2 (karyopherin subunit alpha 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Kpna2rt (karyopherin subunit alpha 2, retrotransposed)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
kpna2 (karyopherin alpha 2 (RAG cohort 1, importin alpha 1))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
ima-2
Alliance
DIOPT (OrthoFinder|PANTHER)
Xenopus tropicalis (tropical clawed frog):
kpna2
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 92,433,678 - 92,445,841 (-) NCBI GRCr8 mRatBN7.2 10 91,933,951 - 91,946,115 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 91,933,951 - 91,946,150 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 96,991,813 - 97,004,201 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 96,454,982 - 96,467,370 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 91,856,366 - 91,868,402 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 95,200,029 - 95,212,111 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 95,200,030 - 95,212,111 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 94,940,856 - 94,952,938 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 96,342,214 - 96,352,613 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 96,356,583 - 96,366,983 (-) NCBI Celera 10 90,599,417 - 90,611,576 (-) NCBI Celera Cytogenetic Map 10 q32.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kpna2 Rat (+)-catechin multiple interactions ISO KPNA2 (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of KPNA2 mRNA CTD PMID:24763279 Kpna2 Rat (S)-amphetamine increases expression ISO Kpna2 (Mus musculus) 6480464 Dextroamphetamine results in increased expression of KPNA2 mRNA CTD PMID:12558987 Kpna2 Rat 1,2-dimethylhydrazine multiple interactions ISO Kpna2 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of KPNA2 mRNA] CTD PMID:22206623 Kpna2 Rat 1,2-dimethylhydrazine increases expression ISO Kpna2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of KPNA2 mRNA CTD PMID:22206623 Kpna2 Rat 1-chloro-2,4-dinitrobenzene affects binding ISO KPNA2 (Homo sapiens) 6480464 Dinitrochlorobenzene binds to KPNA2 protein CTD PMID:32991956 Kpna2 Rat 17beta-estradiol increases expression ISO Kpna2 (Mus musculus) 6480464 Estradiol results in increased expression of KPNA2 mRNA CTD PMID:25210133 Kpna2 Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of KPNA2 mRNA CTD PMID:32145629 Kpna2 Rat 17beta-estradiol decreases phosphorylation ISO KPNA2 (Homo sapiens) 6480464 Estradiol results in decreased phosphorylation of KPNA2 protein CTD PMID:27026707 Kpna2 Rat 17beta-estradiol increases expression ISO KPNA2 (Homo sapiens) 6480464 Estradiol results in increased expression of KPNA2 mRNA CTD PMID:16474171 and PMID:16514628 Kpna2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Kpna2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Kpna2 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO KPNA2 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Kpna2 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Kpna2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Kpna2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Kpna2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of KPNA2 mRNA CTD PMID:21570461 Kpna2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of KPNA2 mRNA CTD PMID:33387578 Kpna2 Rat 2,4,6-tribromophenol decreases expression ISO KPNA2 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Kpna2 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of KPNA2 mRNA CTD PMID:21346803 Kpna2 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of KPNA2 mRNA CTD PMID:21346803 Kpna2 Rat 2-methylcholine affects expression ISO KPNA2 (Homo sapiens) 6480464 beta-methylcholine affects the expression of KPNA2 mRNA CTD PMID:21179406 Kpna2 Rat 3-methylcholanthrene increases expression ISO Kpna2 (Mus musculus) 6480464 Methylcholanthrene results in increased expression of KPNA2 mRNA CTD PMID:20713471 Kpna2 Rat 4,4'-diaminodiphenylmethane increases expression ISO Kpna2 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of KPNA2 mRNA CTD PMID:18648102 Kpna2 Rat 4,4'-sulfonyldiphenol increases expression ISO Kpna2 (Mus musculus) 6480464 bisphenol S results in increased expression of KPNA2 mRNA CTD PMID:39298647 Kpna2 Rat 4,4'-sulfonyldiphenol decreases methylation ISO Kpna2 (Mus musculus) 6480464 bisphenol S results in decreased methylation of KPNA2 promoter CTD PMID:33297965 Kpna2 Rat 4-hydroxynon-2-enal decreases expression ISO Kpna2 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in decreased expression of KPNA2 mRNA CTD PMID:19191707 Kpna2 Rat 5-aza-2'-deoxycytidine affects expression ISO KPNA2 (Homo sapiens) 6480464 Decitabine affects the expression of KPNA2 mRNA CTD PMID:23300844 Kpna2 Rat 5-fluorouracil decreases expression ISO KPNA2 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of KPNA2 mRNA CTD PMID:17374387 Kpna2 Rat 5-fluorouracil multiple interactions ISO KPNA2 (Homo sapiens) 6480464 TP53 protein affects the reaction [Fluorouracil results in decreased expression of KPNA2 mRNA] CTD PMID:15016801 Kpna2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of KPNA2 mRNA CTD PMID:24780913 Kpna2 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of KPNA2 mRNA CTD PMID:31881176 Kpna2 Rat afimoxifene decreases expression ISO KPNA2 (Homo sapiens) 6480464 afimoxifene results in decreased expression of KPNA2 mRNA CTD PMID:16514628 Kpna2 Rat aflatoxin B1 affects expression ISO KPNA2 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of KPNA2 protein CTD PMID:20106945 Kpna2 Rat aflatoxin B1 increases expression ISO Kpna2 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of KPNA2 mRNA CTD PMID:19770486 Kpna2 Rat all-trans-retinoic acid decreases expression ISO KPNA2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of KPNA2 mRNA CTD PMID:18614847 and PMID:33167477 Kpna2 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of KPNA2 mRNA CTD PMID:38685447 Kpna2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of KPNA2 mRNA CTD PMID:16483693 Kpna2 Rat antirheumatic drug decreases expression ISO KPNA2 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of KPNA2 mRNA CTD PMID:24449571 Kpna2 Rat arsane affects expression ISO KPNA2 (Homo sapiens) 6480464 Arsenic affects the expression of KPNA2 mRNA CTD PMID:18414638 Kpna2 Rat arsenic atom affects expression ISO KPNA2 (Homo sapiens) 6480464 Arsenic affects the expression of KPNA2 mRNA CTD PMID:18414638 Kpna2 Rat arsenite(3-) decreases expression ISO Kpna2 (Mus musculus) 6480464 arsenite results in decreased expression of KPNA2 mRNA CTD PMID:18929588 Kpna2 Rat arsenous acid multiple interactions ISO KPNA2 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [GATA3 protein binds to KPNA2 protein] CTD PMID:19080345 Kpna2 Rat atorvastatin calcium affects localization ISO KPNA2 (Homo sapiens) 6480464 Atorvastatin affects the localization of KPNA2 protein CTD PMID:34696514 Kpna2 Rat atorvastatin calcium multiple interactions ISO KPNA2 (Homo sapiens) 6480464 [Ivermectin co-treated with Atorvastatin] affects the localization of KPNA2 protein CTD PMID:34696514 Kpna2 Rat benzo[a]pyrene increases expression ISO Kpna2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of KPNA2 mRNA CTD PMID:20504355 Kpna2 Rat benzo[a]pyrene increases methylation ISO KPNA2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of KPNA2 promoter CTD PMID:27901495 Kpna2 Rat benzo[a]pyrene diol epoxide I decreases expression ISO KPNA2 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 and PMID:34454013 Kpna2 Rat benzo[b]fluoranthene increases expression ISO Kpna2 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of KPNA2 mRNA CTD PMID:26377693 Kpna2 Rat bis(2-chloroethyl) sulfide decreases expression ISO KPNA2 (Homo sapiens) 6480464 Mustard Gas results in decreased expression of KPNA2 mRNA CTD PMID:25102026 Kpna2 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of KPNA2 mRNA CTD PMID:33789034 Kpna2 Rat bis(2-ethylhexyl) phthalate increases expression ISO Kpna2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of KPNA2 mRNA CTD PMID:33754040 Kpna2 Rat bisphenol A increases expression ISO KPNA2 (Homo sapiens) 6480464 bisphenol A results in increased expression of KPNA2 mRNA CTD PMID:16474171 Kpna2 Rat bisphenol A multiple interactions ISO KPNA2 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of KPNA2 gene CTD PMID:31601247 Kpna2 Rat bisphenol A decreases expression ISO KPNA2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of KPNA2 mRNA and bisphenol A results in decreased expression of KPNA2 protein CTD PMID:29275510 more ... Kpna2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of KPNA2 mRNA CTD PMID:30816183 and PMID:34947998 Kpna2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of KPNA2 gene CTD PMID:28505145 Kpna2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of KPNA2 mRNA CTD PMID:25181051 and PMID:32145629 Kpna2 Rat bisphenol F increases expression ISO Kpna2 (Mus musculus) 6480464 bisphenol F results in increased expression of KPNA2 mRNA CTD PMID:38685157 Kpna2 Rat bortezomib increases expression ISO KPNA2 (Homo sapiens) 6480464 Bortezomib results in increased expression of KPNA2 mRNA CTD PMID:20977926 Kpna2 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of KPNA2 mRNA CTD PMID:24136188 Kpna2 Rat caffeine increases phosphorylation ISO KPNA2 (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of KPNA2 protein CTD PMID:35688186 Kpna2 Rat calcitriol decreases expression ISO KPNA2 (Homo sapiens) 6480464 Calcitriol results in decreased expression of KPNA2 mRNA CTD PMID:16847355 more ... Kpna2 Rat calcitriol multiple interactions ISO KPNA2 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of KPNA2 mRNA CTD PMID:21592394 Kpna2 Rat carbon nanotube increases expression ISO Kpna2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Kpna2 Rat chromium(6+) affects expression ISO Kpna2 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of KPNA2 mRNA CTD PMID:28472532 Kpna2 Rat chromium(6+) multiple interactions ISO KPNA2 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of KPNA2 mRNA CTD PMID:38479592 Kpna2 Rat cisplatin decreases expression ISO KPNA2 (Homo sapiens) 6480464 Cisplatin results in decreased expression of KPNA2 mRNA CTD PMID:27594783 Kpna2 Rat cisplatin affects expression ISO KPNA2 (Homo sapiens) 6480464 Cisplatin affects the expression of KPNA2 mRNA CTD PMID:23300844 Kpna2 Rat cisplatin multiple interactions ISO KPNA2 (Homo sapiens) 6480464 Cisplatin affects the reaction [Piroxicam results in decreased expression of KPNA2 mRNA] CTD PMID:21858171 Kpna2 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of KPNA2 mRNA CTD PMID:17602206 Kpna2 Rat clofibric acid affects expression EXP 6480464 Clofibric Acid affects the expression of KPNA2 mRNA CTD PMID:17602206 Kpna2 Rat cobalt dichloride decreases expression ISO KPNA2 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of KPNA2 mRNA CTD PMID:19376846 Kpna2 Rat copper(II) sulfate decreases expression ISO KPNA2 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of KPNA2 mRNA CTD PMID:19549813 Kpna2 Rat cyclosporin A increases expression ISO KPNA2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of KPNA2 mRNA CTD PMID:20106945 Kpna2 Rat cyproterone acetate increases expression EXP 6480464 Cyproterone Acetate results in increased expression of KPNA2 mRNA CTD PMID:16906019 Kpna2 Rat cyproterone acetate decreases expression EXP 6480464 Cyproterone Acetate results in decreased expression of KPNA2 mRNA CTD PMID:16906019 Kpna2 Rat cytarabine decreases expression ISO KPNA2 (Homo sapiens) 6480464 Cytarabine results in decreased expression of KPNA2 mRNA CTD PMID:17374387 Kpna2 Rat DDE increases expression ISO KPNA2 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of KPNA2 mRNA CTD PMID:38568856 Kpna2 Rat diallyl trisulfide decreases expression ISO KPNA2 (Homo sapiens) 6480464 diallyl trisulfide results in decreased expression of KPNA2 mRNA CTD PMID:34995734 Kpna2 Rat diarsenic trioxide multiple interactions ISO KPNA2 (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [GATA3 protein binds to KPNA2 protein] CTD PMID:19080345 Kpna2 Rat dibenzo[a,l]pyrene decreases expression ISO Kpna2 (Mus musculus) 6480464 dibenzo(a and l)pyrene results in decreased expression of KPNA2 mRNA CTD PMID:25908611 Kpna2 Rat dibutyl phthalate decreases expression ISO Kpna2 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of KPNA2 mRNA CTD PMID:17361019 and PMID:21266533 Kpna2 Rat dioxygen decreases expression ISO KPNA2 (Homo sapiens) 6480464 Oxygen results in decreased expression of KPNA2 mRNA CTD PMID:27103661 Kpna2 Rat dioxygen multiple interactions ISO KPNA2 (Homo sapiens) 6480464 Oxygen affects the reaction [AHR protein results in increased expression of KPNA2 mRNA] CTD PMID:27103661 Kpna2 Rat dopamine increases expression EXP 6480464 Dopamine results in increased expression of KPNA2 mRNA CTD PMID:21983523 Kpna2 Rat enzyme inhibitor multiple interactions ISO KPNA2 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of KPNA2 protein CTD PMID:23301498 Kpna2 Rat epoxiconazole decreases expression ISO Kpna2 (Mus musculus) 6480464 epoxiconazole results in decreased expression of KPNA2 mRNA CTD PMID:35436446 Kpna2 Rat ethanol affects splicing ISO Kpna2 (Mus musculus) 6480464 Ethanol affects the splicing of KPNA2 mRNA CTD PMID:30319688 Kpna2 Rat fenoldopam increases expression EXP 6480464 Fenoldopam results in increased expression of KPNA2 mRNA CTD PMID:21983523 Kpna2 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of KPNA2 mRNA CTD PMID:24136188 Kpna2 Rat fluoranthene multiple interactions ISO Kpna2 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in decreased expression of KPNA2 mRNA CTD PMID:28329830 Kpna2 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of KPNA2 mRNA CTD PMID:24136188 Kpna2 Rat folic acid multiple interactions ISO Kpna2 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of KPNA2 mRNA] CTD PMID:22206623 Kpna2 Rat FR900359 increases phosphorylation ISO KPNA2 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of KPNA2 protein CTD PMID:37730182 Kpna2 Rat fulvestrant decreases expression ISO KPNA2 (Homo sapiens) 6480464 fulvestrant results in decreased expression of KPNA2 mRNA CTD PMID:16514628 Kpna2 Rat fulvestrant multiple interactions ISO KPNA2 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of KPNA2 gene CTD PMID:31601247 Kpna2 Rat genistein increases expression ISO KPNA2 (Homo sapiens) 6480464 Genistein results in increased expression of KPNA2 mRNA CTD PMID:16474171 Kpna2 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of KPNA2 mRNA CTD PMID:33387578 Kpna2 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of KPNA2 mRNA CTD PMID:24136188 Kpna2 Rat hydrogen peroxide affects expression ISO KPNA2 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of KPNA2 mRNA CTD PMID:21179406 Kpna2 Rat hydrogen peroxide affects localization ISO KPNA2 (Homo sapiens) 6480464 Hydrogen Peroxide affects the localization of KPNA2 protein CTD PMID:34696514 Kpna2 Rat hydroxyurea decreases expression ISO KPNA2 (Homo sapiens) 6480464 Hydroxyurea results in decreased expression of KPNA2 mRNA CTD PMID:17374387 Kpna2 Rat iron dichloride increases expression ISO KPNA2 (Homo sapiens) 6480464 ferrous chloride results in increased expression of KPNA2 mRNA CTD PMID:35984750 Kpna2 Rat ivermectin decreases expression ISO KPNA2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of KPNA2 protein CTD PMID:32959892 Kpna2 Rat ivermectin multiple interactions ISO KPNA2 (Homo sapiens) 6480464 [Ivermectin co-treated with Atorvastatin] affects the localization of KPNA2 protein CTD PMID:34696514 Kpna2 Rat ivermectin affects localization ISO KPNA2 (Homo sapiens) 6480464 Ivermectin affects the localization of KPNA2 protein CTD PMID:34696514 Kpna2 Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of KPNA2 mRNA CTD PMID:20080153 Kpna2 Rat lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of KPNA2 mRNA CTD PMID:11578147 Kpna2 Rat lead(0) affects expression ISO KPNA2 (Homo sapiens) 6480464 Lead affects the expression of KPNA2 mRNA CTD PMID:28903495 Kpna2 Rat leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of KPNA2 mRNA CTD PMID:24136188 Kpna2 Rat leflunomide decreases expression ISO KPNA2 (Homo sapiens) 6480464 leflunomide results in decreased expression of KPNA2 mRNA CTD PMID:28988120 Kpna2 Rat levofloxacin decreases expression EXP 6480464 Levofloxacin results in decreased expression of KPNA2 mRNA CTD PMID:24136188 Kpna2 Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of KPNA2 mRNA CTD PMID:35283115 Kpna2 Rat lipopolysaccharide multiple interactions ISO KPNA2 (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of KPNA2 mRNA CTD PMID:35877022 Kpna2 Rat lycopene increases expression ISO KPNA2 (Homo sapiens) 6480464 lycopene results in increased expression of KPNA2 mRNA CTD PMID:16886892 Kpna2 Rat methotrexate affects expression ISO Kpna2 (Mus musculus) 6480464 Methotrexate affects the expression of KPNA2 mRNA CTD PMID:18502557 Kpna2 Rat methyl methanesulfonate decreases expression ISO KPNA2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of KPNA2 mRNA CTD PMID:23649840 Kpna2 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of KPNA2 mRNA CTD PMID:17602206 Kpna2 Rat nickel atom increases expression ISO KPNA2 (Homo sapiens) 6480464 Nickel results in increased expression of KPNA2 mRNA CTD PMID:25583101 Kpna2 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of KPNA2 mRNA CTD PMID:25729387 Kpna2 Rat ozone increases expression ISO Kpna2 (Mus musculus) 6480464 Ozone results in increased expression of KPNA2 mRNA CTD PMID:12763052 Kpna2 Rat ozone multiple interactions ISO Kpna2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of KPNA2 mRNA more ... CTD PMID:19555225 and PMID:34911549 Kpna2 Rat palbociclib decreases expression ISO KPNA2 (Homo sapiens) 6480464 palbociclib results in decreased expression of KPNA2 mRNA CTD PMID:22869556 Kpna2 Rat paracetamol affects expression ISO Kpna2 (Mus musculus) 6480464 Acetaminophen affects the expression of KPNA2 mRNA CTD PMID:17562736 Kpna2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of KPNA2 mRNA CTD PMID:33387578 Kpna2 Rat PCB138 multiple interactions ISO Kpna2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Kpna2 Rat perfluorononanoic acid decreases expression ISO KPNA2 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of KPNA2 mRNA CTD PMID:32588087 Kpna2 Rat perfluorooctanoic acid decreases expression ISO KPNA2 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of KPNA2 mRNA CTD PMID:36326898 Kpna2 Rat phenobarbital affects expression ISO Kpna2 (Mus musculus) 6480464 Phenobarbital affects the expression of KPNA2 mRNA CTD PMID:23091169 Kpna2 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of KPNA2 mRNA CTD PMID:16906019 Kpna2 Rat pirinixic acid increases expression ISO Kpna2 (Mus musculus) 6480464 pirinixic acid results in increased expression of KPNA2 mRNA CTD PMID:23811191 Kpna2 Rat piroxicam decreases expression ISO KPNA2 (Homo sapiens) 6480464 Piroxicam results in decreased expression of KPNA2 mRNA CTD PMID:21858171 Kpna2 Rat piroxicam multiple interactions ISO KPNA2 (Homo sapiens) 6480464 Cisplatin affects the reaction [Piroxicam results in decreased expression of KPNA2 mRNA] CTD PMID:21858171 Kpna2 Rat propiconazole increases expression ISO Kpna2 (Mus musculus) 6480464 propiconazole results in increased expression of KPNA2 mRNA CTD PMID:19363144 and PMID:21278054 Kpna2 Rat raloxifene decreases expression ISO KPNA2 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in decreased expression of KPNA2 mRNA CTD PMID:16514628 Kpna2 Rat resveratrol decreases expression ISO KPNA2 (Homo sapiens) 6480464 resveratrol results in decreased expression of KPNA2 mRNA and resveratrol results in decreased expression of KPNA2 protein CTD PMID:15767336 and PMID:18089832 Kpna2 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of KPNA2 mRNA CTD PMID:28374803 Kpna2 Rat SB 431542 multiple interactions ISO KPNA2 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of KPNA2 protein CTD PMID:37664457 Kpna2 Rat silicon dioxide increases expression ISO KPNA2 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of KPNA2 mRNA CTD PMID:25351596 Kpna2 Rat sodium arsenite decreases expression ISO KPNA2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of KPNA2 mRNA CTD PMID:38568856 Kpna2 Rat sodium arsenite increases expression ISO KPNA2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of KPNA2 mRNA CTD PMID:34032870 Kpna2 Rat Soman increases expression EXP 6480464 Soman results in increased expression of KPNA2 mRNA CTD PMID:19281266 Kpna2 Rat sunitinib decreases expression ISO KPNA2 (Homo sapiens) 6480464 Sunitinib results in decreased expression of KPNA2 mRNA CTD PMID:31533062 Kpna2 Rat testosterone decreases expression ISO KPNA2 (Homo sapiens) 6480464 Testosterone results in decreased expression of KPNA2 mRNA CTD PMID:21592394 Kpna2 Rat testosterone multiple interactions ISO KPNA2 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of KPNA2 mRNA CTD PMID:21592394 Kpna2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of KPNA2 mRNA CTD PMID:34492290 Kpna2 Rat thiram decreases expression ISO KPNA2 (Homo sapiens) 6480464 Thiram results in decreased expression of KPNA2 mRNA CTD PMID:38568856 Kpna2 Rat titanium dioxide decreases methylation ISO Kpna2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of KPNA2 promoter CTD PMID:35295148 Kpna2 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of KPNA2 mRNA CTD PMID:25729387 Kpna2 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of KPNA2 mRNA CTD PMID:25729387 Kpna2 Rat triadimefon increases expression ISO Kpna2 (Mus musculus) 6480464 triadimefon results in increased expression of KPNA2 mRNA CTD PMID:19363144 Kpna2 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of KPNA2 mRNA CTD PMID:33387578 Kpna2 Rat trimellitic anhydride increases expression ISO Kpna2 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of KPNA2 mRNA CTD PMID:19042947 Kpna2 Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of KPNA2 mRNA CTD PMID:24136188 Kpna2 Rat tungsten increases expression ISO Kpna2 (Mus musculus) 6480464 Tungsten results in increased expression of KPNA2 mRNA CTD PMID:30912803 Kpna2 Rat tunicamycin decreases expression ISO KPNA2 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of KPNA2 mRNA CTD PMID:22378314 and PMID:29453283 Kpna2 Rat valproic acid affects expression ISO Kpna2 (Mus musculus) 6480464 Valproic Acid affects the expression of KPNA2 mRNA CTD PMID:17292431 Kpna2 Rat vancomycin decreases expression ISO Kpna2 (Mus musculus) 6480464 Vancomycin results in decreased expression of KPNA2 mRNA CTD PMID:18930951 Kpna2 Rat vincaleukoblastine affects response to substance ISO KPNA2 (Homo sapiens) 6480464 KPNA2 protein affects the susceptibility to Vinblastine CTD PMID:16217747 Kpna2 Rat vincristine decreases expression ISO KPNA2 (Homo sapiens) 6480464 Vincristine results in decreased expression of KPNA2 mRNA CTD PMID:23649840 Kpna2 Rat zinc atom increases expression EXP 6480464 Zinc deficiency results in increased expression of KPNA2 mRNA CTD PMID:16140947 Kpna2 Rat zinc atom multiple interactions EXP 6480464 Zinc inhibits the reaction [Zinc deficiency results in increased expression of KPNA2 mRNA] CTD PMID:16140947 Kpna2 Rat zinc(0) increases expression EXP 6480464 Zinc deficiency results in increased expression of KPNA2 mRNA CTD PMID:16140947 Kpna2 Rat zinc(0) multiple interactions EXP 6480464 Zinc inhibits the reaction [Zinc deficiency results in increased expression of KPNA2 mRNA] CTD PMID:16140947
Imported Annotations - KEGG (archival)
(+)-catechin (ISO) (S)-amphetamine (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-methylcholine (ISO) 3-methylcholanthrene (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) afimoxifene (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atorvastatin calcium (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bortezomib (ISO) buspirone (EXP) caffeine (ISO) calcitriol (ISO) carbon nanotube (ISO) chromium(6+) (ISO) cisplatin (ISO) clofibric acid (EXP) cobalt dichloride (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) cyproterone acetate (EXP) cytarabine (ISO) DDE (ISO) diallyl trisulfide (ISO) diarsenic trioxide (ISO) dibenzo[a,l]pyrene (ISO) dibutyl phthalate (ISO) dioxygen (ISO) dopamine (EXP) enzyme inhibitor (ISO) epoxiconazole (ISO) ethanol (ISO) fenoldopam (EXP) finasteride (EXP) fluoranthene (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) genistein (ISO) gentamycin (EXP) glafenine (EXP) hydrogen peroxide (ISO) hydroxyurea (ISO) iron dichloride (ISO) ivermectin (ISO) ketamine (EXP) lead diacetate (EXP) lead(0) (ISO) leflunomide (EXP,ISO) levofloxacin (EXP) lidocaine (EXP) lipopolysaccharide (ISO) lycopene (ISO) methotrexate (ISO) methyl methanesulfonate (ISO) N-nitrosodiethylamine (EXP) nickel atom (ISO) oxaliplatin (EXP) ozone (ISO) palbociclib (ISO) paracetamol (EXP,ISO) PCB138 (ISO) perfluorononanoic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) pirinixic acid (EXP,ISO) piroxicam (ISO) propiconazole (ISO) raloxifene (ISO) resveratrol (ISO) rotenone (EXP) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) Soman (EXP) sunitinib (ISO) testosterone (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) triadimefon (ISO) trichloroethene (EXP) trimellitic anhydride (ISO) trovafloxacin (EXP) tungsten (ISO) tunicamycin (ISO) valproic acid (ISO) vancomycin (ISO) vincaleukoblastine (ISO) vincristine (ISO) zinc atom (EXP) zinc(0) (EXP)
1.
Caldendrin-Jacob: a protein liaison that couples NMDA receptor signalling to the nucleus.
Dieterich DC, etal., PLoS Biol. 2008 Feb;6(2):e34. doi: 10.1371/journal.pbio.0060034.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Karyopherin alpha2: a control step of glucose-sensitive gene expression in hepatic cells.
Guillemain G, etal., Biochem J 2002 May 15;364(Pt 1):201-9.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
8.
GOA pipeline
RGD automated data pipeline
9.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
10.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Kpna2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 92,433,678 - 92,445,841 (-) NCBI GRCr8 mRatBN7.2 10 91,933,951 - 91,946,115 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 91,933,951 - 91,946,150 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 96,991,813 - 97,004,201 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 96,454,982 - 96,467,370 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 91,856,366 - 91,868,402 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 95,200,029 - 95,212,111 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 95,200,030 - 95,212,111 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 94,940,856 - 94,952,938 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 96,342,214 - 96,352,613 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 96,356,583 - 96,366,983 (-) NCBI Celera 10 90,599,417 - 90,611,576 (-) NCBI Celera Cytogenetic Map 10 q32.1 NCBI
KPNA2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 68,035,735 - 68,046,854 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 68,035,636 - 68,047,364 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 66,031,851 - 66,042,970 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 63,462,310 - 63,473,432 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 17 62,601,848 - 62,612,972 (+) NCBI Celera Cytogenetic Map 17 q24.2 NCBI HuRef 17 61,416,714 - 61,427,908 (+) NCBI HuRef CHM1_1 17 66,096,665 - 66,107,785 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 68,911,511 - 68,922,628 (+) NCBI T2T-CHM13v2.0
Kpna2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 106,879,455 - 106,890,351 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 106,879,455 - 106,890,367 (-) Ensembl GRCm39 Ensembl GRCm38 11 106,988,629 - 106,999,525 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 106,988,629 - 106,999,541 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 106,849,943 - 106,860,839 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 106,804,719 - 106,815,615 (-) NCBI MGSCv36 mm8 Celera 11 118,719,792 - 118,733,297 (-) NCBI Celera Cytogenetic Map 11 E1 NCBI cM Map 11 70.08 NCBI
Kpna2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955478 7,121,432 - 7,134,327 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955478 7,121,432 - 7,134,327 (+) NCBI ChiLan1.0 ChiLan1.0
KPNA2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 84,035,576 - 84,071,181 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 88,856,717 - 88,892,339 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 61,968,807 - 61,979,954 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 67,161,908 - 67,173,410 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 67,161,908 - 67,173,410 (+) Ensembl panpan1.1 panPan2
KPNA2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 12,546,912 - 12,556,163 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 13,442,712 - 13,451,963 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 14,205,539 - 14,214,799 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 14,205,541 - 14,214,742 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 13,154,710 - 13,163,965 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 14,370,477 - 14,379,722 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 14,369,408 - 14,378,660 (+) NCBI UU_Cfam_GSD_1.0
Kpna2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 13,965,860 - 13,977,209 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936541 5,217,362 - 5,228,846 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936541 5,217,389 - 5,228,816 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KPNA2
KPNA2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 53,422,792 - 53,434,693 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 53,423,040 - 53,433,290 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 24,363,548 - 24,375,627 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kpna2
.
Predicted Target Of
Count of predictions: 36 Count of miRNA genes: 36 Interacting mature miRNAs: 36 Transcripts: ENSRNOT00000020795 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 1579915 Bp280 Blood pressure QTL 280 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90404397 107211142 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 4889948 Bss91 Bone structure and strength QTL 91 4 tibia area (VT:1000281) tibia midshaft total cross-sectional area (CMO:0001715) 10 82564856 92369470 Rat 2298548 Neuinf7 Neuroinflammation QTL 7 3.4 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 10 72224939 107211142 Rat 1579919 Bp281 Blood pressure QTL 281 0.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 74372084 94965338 Rat 1302404 Cia27 Collagen induced arthritis QTL 27 2.6 0.0045 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 10 76452683 107211142 Rat 1300107 Rf18 Renal function QTL 18 3.41 urine output (VT:0003620) timed urine volume (CMO:0000260) 10 78775516 98279596 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 2317754 Glom25 Glomerulus QTL 25 3.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 82685200 107211142 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 10450495 Bp383 Blood pressure QTL 383 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 94965338 Rat 2313856 Bp342 Blood pressure QTL 342 4.4 0.0001 life span trait (VT:0005372) age at time of death (CMO:0001193) 10 87307617 96121100 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2292617 Ept18 Estrogen-induced pituitary tumorigenesis QTL 18 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 70193 Mcs7 Mammary carcinoma susceptibility QTL 7 2.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 72224939 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 61363 Oia3 Oil induced arthritis QTL 3 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87307617 107211142 Rat 1357344 Bp249 Blood pressure QTL 249 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 66743655 98003205 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 724530 Bp149 Blood pressure QTL 149 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90627439 107211142 Rat 1300137 Bp186 Blood pressure QTL 186 3.57 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 10 90627439 107057807 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 6893357 Bw102 Body weight QTL 102 0.5 0.36 body mass (VT:0001259) body weight (CMO:0000012) 10 80515287 101325465 Rat 12880384 Cm107 Cardiac mass QTL 107 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 90404397 107211142 Rat 12880385 Cm108 Cardiac mass QTL 108 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 90404397 107211142 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 2303589 Bw87 Body weight QTL 87 2 body mass (VT:0001259) body weight (CMO:0000012) 10 81285008 107211142 Rat 12880396 Am13 Aortic mass QTL 13 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 90404397 107211142 Rat 2306793 Ean5 Experimental allergic neuritis QTL 5 4.7 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 72552416 93995749 Rat 12880398 Kidm67 Kidney mass QTL 67 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 10 90404397 107211142 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2306792 Ean4 Experimental allergic neuritis QTL 4 4 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 84022321 93995963 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 12880395 Cm109 Cardiac mass QTL 109 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 10 90404397 107211142 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 634320 Niddm49 Non-insulin dependent diabetes mellitus QTL 49 4.41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 10 88539139 107211142 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 4889492 Pancm2 Pancreatic morphology QTL 2 3.2 pancreatic beta cell morphology trait (VT:0005217) ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814) 10 76748906 107211142 Rat 6893366 Bw106 Body weight QTL 106 0.3 0.47 body mass (VT:0001259) body weight (CMO:0000012) 10 70199100 107211142 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 12880055 Am11 Aortic mass QTL 11 0.004 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 84007272 95933025 Rat 2292438 Bp311 Blood pressure QTL 311 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 107211142 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 2301398 Kidm38 Kidney mass QTL 38 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 10 84007272 95933025 Rat 1600367 Mcs15 Mammary carcinoma susceptibility QTL 15 4.5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 85565469 103884409 Rat 1358188 Ept9 Estrogen-induced pituitary tumorigenesis QTL 9 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 631538 Oia5 Oil induced arthritis QTL 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87055121 107211142 Rat 61436 Cia5 Collagen induced arthritis QTL 5 4.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 91228102 104060283 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
PMC109067P1
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 10 q32.1 UniSTS
RH133348
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 10 q32.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000020795 ⟹ ENSRNOP00000020795
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 91,933,951 - 91,946,150 (-) Ensembl Rnor_6.0 Ensembl 10 95,200,030 - 95,212,111 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100211 ⟹ ENSRNOP00000076768
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 91,934,045 - 91,946,118 (-) Ensembl
RefSeq Acc Id:
NM_001270802 ⟹ NP_001257731
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 92,433,678 - 92,445,841 (-) NCBI mRatBN7.2 10 91,933,951 - 91,946,115 (-) NCBI Rnor_6.0 10 95,200,029 - 95,212,111 (-) NCBI Rnor_5.0 10 94,940,856 - 94,952,938 (-) NCBI Celera 10 90,599,417 - 90,611,576 (-) NCBI
Sequence:
ACAAAGTCTGAGGGCTGAGGGCTAGTGGACGTTTCGACAGCCGCCGACCCGCAGCTTGAGAGCCCTGCACCGACTTTCGTGGAAGTCTGAACCGGCTGTGCAGCTTTCCTTCCTCCTTGTTCCTGCAG
hide sequence
RefSeq Acc Id:
NM_053483 ⟹ NP_445935
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 92,433,678 - 92,445,841 (-) NCBI mRatBN7.2 10 91,933,951 - 91,946,115 (-) NCBI Rnor_6.0 10 95,200,029 - 95,212,111 (-) NCBI Rnor_5.0 10 94,940,856 - 94,952,938 (-) NCBI RGSC_v3.4 10 96,342,214 - 96,352,613 (-) RGD Celera 10 90,599,417 - 90,611,576 (-) NCBI
Sequence:
ACAAAGTCTGAGGGCTGAGGGCTAGTGGACGTTTCGACAGCCGCCGACCCGCAGCTTGAGAGCCCTGCACCGACTTTCGTGGAAGTCTGAACCGGCTGTGCAGCAACCATGTCCACCAATGAGAATGC
hide sequence
RefSeq Acc Id:
XM_063270000 ⟹ XP_063126070
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 92,433,678 - 92,445,631 (-) NCBI
RefSeq Acc Id:
NP_445935 ⟸ NM_053483
- UniProtKB:
Q6P6T9 (UniProtKB/TrEMBL), A6HK66 (UniProtKB/TrEMBL), Q9Z0N9 (UniProtKB/TrEMBL), F7F4Z2 (UniProtKB/TrEMBL)
- Sequence:
MSTNENANSTAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPLQENRNNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFL
hide sequence
RefSeq Acc Id:
NP_001257731 ⟸ NM_001270802
- UniProtKB:
Q6P6T9 (UniProtKB/TrEMBL), A6HK66 (UniProtKB/TrEMBL), Q9Z0N9 (UniProtKB/TrEMBL), F7F4Z2 (UniProtKB/TrEMBL)
- Sequence:
MSTNENANSTAARLNRFKNKGKDSTEMRRRRIEVNVELRKAKKDDQMLKRRNVSSFPDDATSPL
hide sequence
Ensembl Acc Id:
ENSRNOP00000020795 ⟸ ENSRNOT00000020795
Ensembl Acc Id:
ENSRNOP00000076768 ⟸ ENSRNOT00000100211
RefSeq Acc Id:
XP_063126070 ⟸ XM_063270000
- Peptide Label:
isoform X1
- UniProtKB:
Q9Z0N9 (UniProtKB/TrEMBL), A6HK66 (UniProtKB/TrEMBL), F7F4Z2 (UniProtKB/TrEMBL), Q6P6T9 (UniProtKB/TrEMBL)
RGD ID: 13697848 Promoter ID: EPDNEW_R8373 Type: single initiation site Name: Kpna2_1 Description: karyopherin subunit alpha 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 95,212,113 - 95,212,173 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-11
Kpna2
karyopherin subunit alpha 2
Kpna2
karyopherin alpha 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2009-12-15
Kpna2
karyopherin alpha 2
Kpna2
karyopherin (importin) alpha 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Kpna2
karyopherin (importin) alpha 2
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Kpna2
karyopherin (importin) alpha 2
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_function
regulates glucose-sensitive gene expression by transmitting a signal to the nucleus
633087
