Symbol:
Rest
Name:
RE1-silencing transcription factor
RGD ID:
621069
Description:
Enables several functions, including DNA-binding transcription repressor activity, RNA polymerase II-specific; RNA polymerase II-specific DNA-binding transcription factor binding activity; and promoter-specific chromatin binding activity. Involved in several processes, including negative regulation of biosynthetic process; negative regulation of dense core granule biogenesis; and response to ischemia. Located in chromatin and nucleus. Part of transcription repressor complex. Human ortholog(s) of this gene implicated in autosomal dominant nonsyndromic deafness 27; gingival fibromatosis 5; and nephroblastoma. Orthologous to human REST (RE1 silencing transcription factor); PARTICIPATES IN Huntington's disease pathway; INTERACTS WITH (+)-schisandrin B; 1,2-dimethylhydrazine; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
neural-restrictive silencer factor; Nrsf; zinc finger transcription factor REST protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 31,213,415 - 31,233,451 (-) NCBI GRCr8 mRatBN7.2 14 30,859,109 - 30,879,828 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 30,862,553 - 30,894,354 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 31,239,986 - 31,260,061 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 32,548,313 - 32,568,388 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 31,032,969 - 31,053,042 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 33,131,985 - 33,152,019 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 33,134,511 - 33,164,141 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 32,925,741 - 32,951,551 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 33,136,046 - 33,151,142 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 33,136,045 - 33,151,142 (-) NCBI Celera 14 30,181,687 - 30,196,879 (-) NCBI Celera Cytogenetic Map 14 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rest Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of REST mRNA] CTD PMID:31150632 Rest Rat 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of REST mRNA CTD PMID:27840820 Rest Rat 1,2-dimethylhydrazine decreases expression ISO Rest (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of REST mRNA CTD PMID:22206623 Rest Rat 17beta-estradiol affects expression ISO REST (Homo sapiens) 6480464 Estradiol affects the expression of REST mRNA CTD PMID:22574217 Rest Rat 17beta-estradiol increases expression ISO Rest (Mus musculus) 6480464 Estradiol results in increased expression of REST mRNA CTD PMID:39298647 Rest Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of REST mRNA CTD PMID:32145629 Rest Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Rest (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of REST mRNA CTD PMID:19770486 Rest Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of REST mRNA CTD PMID:33387578 Rest Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of REST mRNA CTD PMID:32109520 Rest Rat 2-hydroxypropanoic acid increases expression ISO REST (Homo sapiens) 6480464 Lactic Acid results in increased expression of REST mRNA CTD PMID:30851411 Rest Rat 5-fluorouracil affects expression ISO REST (Homo sapiens) 6480464 Fluorouracil affects the expression of REST mRNA CTD PMID:16584549 Rest Rat 5-fluorouracil decreases expression ISO Rest (Mus musculus) 6480464 Fluorouracil results in decreased expression of REST protein CTD PMID:21296659 Rest Rat 6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide multiple interactions ISO REST (Homo sapiens) 6480464 6-chloro-2 more ... CTD PMID:26307266 Rest Rat 6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide increases expression ISO REST (Homo sapiens) 6480464 6-chloro-2 more ... CTD PMID:26307266 Rest Rat 9-cis-retinoic acid increases expression EXP 6480464 Alitretinoin results in increased expression of REST mRNA CTD PMID:16648578 Rest Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of REST mRNA CTD PMID:28959563 Rest Rat aflatoxin B1 increases expression ISO Rest (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of REST mRNA CTD PMID:19770486 Rest Rat all-trans-retinoic acid multiple interactions ISO REST (Homo sapiens) 6480464 ZMYND8 protein affects the reaction [Tretinoin results in decreased expression of REST mRNA] CTD PMID:26655721 Rest Rat all-trans-retinoic acid decreases expression ISO REST (Homo sapiens) 6480464 Tretinoin results in decreased expression of REST mRNA CTD PMID:26655721 Rest Rat alpha-D-galactose decreases expression ISO Rest (Mus musculus) 6480464 Galactose results in decreased expression of REST protein CTD PMID:36878094 Rest Rat alpha-D-galactose multiple interactions ISO Rest (Mus musculus) 6480464 gentiopicroside analog inhibits the reaction [Galactose results in decreased expression of REST protein] CTD PMID:36878094 Rest Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of REST mRNA CTD PMID:16483693 Rest Rat aristolochic acid A decreases expression ISO REST (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of REST mRNA CTD PMID:33212167 Rest Rat Aroclor 1254 decreases expression ISO REST (Homo sapiens) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of REST mRNA CTD PMID:16934159 Rest Rat arsane multiple interactions ISO REST (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of REST mRNA CTD PMID:39836092 Rest Rat arsenic atom multiple interactions ISO REST (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of REST mRNA CTD PMID:39836092 Rest Rat arsenous acid increases expression ISO REST (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of REST mRNA CTD PMID:20458559 Rest Rat benzo[a]pyrene decreases expression ISO Rest (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of REST mRNA CTD PMID:22228805 Rest Rat benzo[a]pyrene affects methylation ISO REST (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of REST promoter CTD PMID:27901495 Rest Rat benzo[a]pyrene diol epoxide I decreases expression ISO REST (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Rest Rat bexarotene increases expression EXP 6480464 bexarotene results in increased expression of REST mRNA CTD PMID:16648578 Rest Rat bis(2-ethylhexyl) phthalate decreases expression ISO Rest (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of REST mRNA CTD PMID:33754040 Rest Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of REST mRNA CTD PMID:25181051 Rest Rat bisphenol A increases expression ISO Rest (Mus musculus) 6480464 bisphenol A results in increased expression of REST mRNA CTD PMID:35598803 Rest Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of REST mRNA CTD PMID:32145629 Rest Rat bisphenol A decreases expression ISO REST (Homo sapiens) 6480464 bisphenol A results in decreased expression of REST mRNA CTD PMID:30953815 Rest Rat bisphenol F increases expression ISO Rest (Mus musculus) 6480464 bisphenol F results in increased expression of REST mRNA CTD PMID:38685157 Rest Rat bromochloroacetic acid decreases expression ISO Rest (Mus musculus) 6480464 bromochloroacetic acid results in decreased expression of REST protein CTD PMID:21296659 Rest Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of REST mRNA CTD PMID:19167457 Rest Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of REST promoter CTD PMID:22457795 Rest Rat caffeine decreases phosphorylation ISO REST (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of REST protein CTD PMID:35688186 Rest Rat carbamazepine multiple interactions ISO REST (Homo sapiens) 6480464 Carbamazepine inhibits the reaction [REST protein results in increased expression of TAC3 mRNA] CTD PMID:19539370 Rest Rat CGP 52608 multiple interactions ISO REST (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to REST gene] CTD PMID:28238834 Rest Rat copper(II) sulfate increases expression ISO REST (Homo sapiens) 6480464 Copper Sulfate results in increased expression of REST mRNA CTD PMID:19549813 Rest Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of REST mRNA CTD PMID:26577399 Rest Rat decabromodiphenyl ether multiple interactions ISO Rest (Mus musculus) 6480464 BESEB CDRI-08 inhibits the reaction [decabromobiphenyl ether inhibits the reaction [REST protein binds to GRIN1 promoter]] and decabromobiphenyl ether inhibits the reaction [REST protein binds to GRIN1 promoter] CTD PMID:26413122 Rest Rat diarsenic trioxide increases expression ISO REST (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of REST mRNA CTD PMID:20458559 Rest Rat diuron increases expression EXP 6480464 Diuron results in increased expression of REST mRNA CTD PMID:21551480 Rest Rat dorsomorphin multiple interactions ISO REST (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of REST mRNA CTD PMID:27188386 Rest Rat doxorubicin affects expression ISO Rest (Mus musculus) 6480464 Doxorubicin affects the expression of REST mRNA CTD PMID:15033991 Rest Rat doxorubicin decreases expression ISO Rest (Mus musculus) 6480464 Doxorubicin results in decreased expression of REST mRNA CTD PMID:19277126 Rest Rat fenamidone increases expression ISO Rest (Mus musculus) 6480464 fenamidone results in increased expression of REST mRNA CTD PMID:27029645 Rest Rat folic acid decreases expression ISO REST (Homo sapiens) 6480464 Folic Acid results in decreased expression of REST mRNA CTD PMID:21867686 Rest Rat FR900359 increases phosphorylation ISO REST (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of REST protein CTD PMID:37730182 Rest Rat galactose multiple interactions ISO Rest (Mus musculus) 6480464 gentiopicroside analog inhibits the reaction [Galactose results in decreased expression of REST protein] CTD PMID:36878094 Rest Rat galactose decreases expression ISO Rest (Mus musculus) 6480464 Galactose results in decreased expression of REST protein CTD PMID:36878094 Rest Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of REST mRNA CTD PMID:33387578 Rest Rat Gentiopicrin multiple interactions ISO Rest (Mus musculus) 6480464 gentiopicroside analog inhibits the reaction [Galactose results in decreased expression of REST protein] CTD PMID:36878094 Rest Rat kainic acid multiple interactions EXP 6480464 Kainic Acid promotes the reaction [REST protein binds to HCN1 intron] more ... CTD PMID:21905079 Rest Rat kainic acid increases expression EXP 6480464 Kainic Acid results in increased expression of REST protein CTD PMID:21905079 Rest Rat lead diacetate multiple interactions EXP 6480464 [lead acetate results in increased abundance of Lead] which results in increased expression of REST protein more ... CTD PMID:30742882 Rest Rat lead diacetate increases expression ISO Rest (Mus musculus) 6480464 lead acetate results in increased expression of REST mRNA and lead acetate results in increased expression of REST protein CTD PMID:29505838 Rest Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of REST mRNA and lead acetate results in increased expression of REST protein CTD PMID:29505838 Rest Rat lead diacetate multiple interactions ISO Rest (Mus musculus) 6480464 REST protein promotes the reaction [lead acetate results in decreased expression of SV2C mRNA] and REST protein promotes the reaction [lead acetate results in decreased expression of SV2C protein] CTD PMID:29505838 Rest Rat lead(0) multiple interactions EXP 6480464 [lead acetate results in increased abundance of Lead] which results in increased expression of REST protein more ... CTD PMID:30742882 Rest Rat leflunomide increases expression ISO REST (Homo sapiens) 6480464 leflunomide results in increased expression of REST mRNA CTD PMID:28988120 Rest Rat methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of REST mRNA and methylmercuric chloride results in increased expression of REST protein CTD PMID:29522201 Rest Rat methylmercury chloride multiple interactions EXP 6480464 JUND affects the reaction [methylmercuric chloride results in increased expression of REST mRNA] more ... CTD PMID:29522201 Rest Rat monosodium L-glutamate multiple interactions ISO Rest (Mus musculus) 6480464 SB 203580 inhibits the reaction [Sodium Glutamate results in increased expression of REST mRNA] CTD PMID:16782274 Rest Rat monosodium L-glutamate increases expression ISO Rest (Mus musculus) 6480464 Sodium Glutamate results in increased expression of REST mRNA CTD PMID:16782274 Rest Rat N-methyl-4-phenylpyridinium affects localization ISO REST (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium affects the localization of REST protein CTD PMID:19631241 Rest Rat N-methyl-4-phenylpyridinium increases expression ISO REST (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of REST mRNA CTD PMID:19631241 Rest Rat N-methyl-4-phenylpyridinium affects response to substance ISO REST (Homo sapiens) 6480464 REST protein affects the susceptibility to 1-Methyl-4-phenylpyridinium CTD PMID:19631241 Rest Rat ozone multiple interactions ISO REST (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of REST mRNA CTD PMID:35430440 Rest Rat panobinostat multiple interactions ISO REST (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of REST mRNA CTD PMID:27188386 Rest Rat panobinostat increases expression ISO REST (Homo sapiens) 6480464 panobinostat results in increased expression of REST mRNA CTD PMID:26272509 Rest Rat paracetamol affects expression ISO Rest (Mus musculus) 6480464 Acetaminophen affects the expression of REST mRNA CTD PMID:17562736 Rest Rat phenobarbital decreases expression ISO Rest (Mus musculus) 6480464 Phenobarbital results in decreased expression of REST mRNA CTD PMID:23091169 Rest Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of REST mRNA CTD PMID:19162173 Rest Rat rac-lactic acid increases expression ISO REST (Homo sapiens) 6480464 Lactic Acid results in increased expression of REST mRNA CTD PMID:30851411 Rest Rat resveratrol multiple interactions ISO REST (Homo sapiens) 6480464 6-chloro-2 more ... CTD PMID:26307266 Rest Rat resveratrol multiple interactions EXP 6480464 JUN protein promotes the reaction [resveratrol inhibits the reaction [2 more ... CTD PMID:26307266 Rest Rat resveratrol decreases expression ISO REST (Homo sapiens) 6480464 resveratrol results in decreased expression of REST mRNA and resveratrol results in decreased expression of REST protein CTD PMID:26307266 Rest Rat SB 203580 multiple interactions ISO Rest (Mus musculus) 6480464 SB 203580 inhibits the reaction [Sodium Glutamate results in increased expression of REST mRNA] CTD PMID:16782274 Rest Rat SB 431542 multiple interactions ISO REST (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of REST mRNA CTD PMID:27188386 Rest Rat sirolimus multiple interactions ISO REST (Homo sapiens) 6480464 Sirolimus promotes the reaction [TP73 protein affects the activity of REST protein] CTD PMID:21245298 Rest Rat sodium arsenate increases expression ISO Rest (Mus musculus) 6480464 sodium arsenate results in increased expression of REST mRNA CTD PMID:27751817 Rest Rat sodium arsenite increases expression ISO REST (Homo sapiens) 6480464 sodium arsenite results in increased expression of REST mRNA CTD PMID:38568856 Rest Rat sodium arsenite multiple interactions ISO REST (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of REST mRNA CTD PMID:39836092 Rest Rat sparteine increases expression EXP 6480464 Sparteine results in increased expression of REST mRNA CTD PMID:16843632 Rest Rat succimer multiple interactions ISO Rest (Mus musculus) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in decreased expression of REST mRNA CTD PMID:26378955 Rest Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of REST mRNA CTD PMID:31150632 Rest Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of REST mRNA] CTD PMID:31150632 Rest Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of REST mRNA CTD PMID:34492290 Rest Rat titanium dioxide decreases methylation ISO Rest (Mus musculus) 6480464 titanium dioxide results in decreased methylation of REST gene CTD PMID:35295148 Rest Rat trichostatin A decreases activity ISO REST (Homo sapiens) 6480464 trichostatin A results in decreased activity of REST protein CTD PMID:16330548 Rest Rat triphenyl phosphate affects expression ISO REST (Homo sapiens) 6480464 triphenyl phosphate affects the expression of REST mRNA CTD PMID:37042841 Rest Rat troglitazone decreases expression ISO Rest (Mus musculus) 6480464 troglitazone results in decreased expression of REST mRNA CTD PMID:28973697 Rest Rat urethane increases expression ISO REST (Homo sapiens) 6480464 Urethane results in increased expression of REST mRNA CTD PMID:28818685 Rest Rat valproic acid increases methylation ISO REST (Homo sapiens) 6480464 Valproic Acid results in increased methylation of REST gene CTD PMID:29154799 Rest Rat valproic acid decreases expression ISO REST (Homo sapiens) 6480464 Valproic Acid results in decreased expression of REST mRNA CTD PMID:23179753 and PMID:27188386 Rest Rat vorinostat decreases expression ISO REST (Homo sapiens) 6480464 vorinostat results in decreased expression of REST mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) 1,2-dimethylhydrazine (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 5-fluorouracil (ISO) 6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide (ISO) 9-cis-retinoic acid (EXP) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-D-galactose (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bexarotene (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bromochloroacetic acid (ISO) C60 fullerene (EXP) cadmium dichloride (EXP) caffeine (ISO) carbamazepine (ISO) CGP 52608 (ISO) copper(II) sulfate (ISO) Cuprizon (EXP) decabromodiphenyl ether (ISO) diarsenic trioxide (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) fenamidone (ISO) folic acid (ISO) FR900359 (ISO) galactose (ISO) gentamycin (EXP) Gentiopicrin (ISO) kainic acid (EXP) lead diacetate (EXP,ISO) lead(0) (EXP) leflunomide (ISO) methylmercury chloride (EXP) monosodium L-glutamate (ISO) N-methyl-4-phenylpyridinium (ISO) ozone (ISO) panobinostat (ISO) paracetamol (ISO) phenobarbital (ISO) pirinixic acid (EXP) rac-lactic acid (ISO) resveratrol (EXP,ISO) SB 203580 (ISO) SB 431542 (ISO) sirolimus (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sparteine (EXP) succimer (ISO) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (ISO) trichostatin A (ISO) triphenyl phosphate (ISO) troglitazone (ISO) urethane (ISO) valproic acid (ISO) vorinostat (ISO)
Biological Process
auditory receptor cell stereocilium organization (ISO,ISS) cardiac muscle cell myoblast differentiation (ISO,ISS) cellular response to electrical stimulus (IEA,ISO,ISS) cellular response to glucocorticoid stimulus (IEA,ISO,ISS) cellular response to stress (ISO) chromatin remodeling (IMP) detection of mechanical stimulus involved in sensory perception of sound (ISO,ISS) hematopoietic progenitor cell differentiation (ISO) modification of synaptic structure (IMP) negative regulation by host of viral transcription (IEA,ISS) negative regulation of aldosterone biosynthetic process (IEA,IMP,ISO) negative regulation of amniotic stem cell differentiation (IEA,ISO,ISS) negative regulation of calcium ion-dependent exocytosis (IMP) negative regulation of cortisol biosynthetic process (IEA,IMP,ISO) negative regulation of dense core granule biogenesis (IMP) negative regulation of DNA-templated transcription (IBA,IDA,IEA,IMP,ISO) negative regulation of gene expression (IMP,ISO) negative regulation of insulin secretion (IEA,ISO,ISS) negative regulation of mesenchymal stem cell differentiation (IEA,ISO) negative regulation of miRNA transcription (IEA,ISO) negative regulation of neurogenesis (ISO,ISS) negative regulation of neuron differentiation (IBA,IEA,IMP,ISO,ISS) negative regulation of transcription by RNA polymerase II (IEA,IMP,ISO,NAS) nervous system process (IEA,ISO,ISS) neuromuscular process controlling balance (ISO,ISS) neuron differentiation (IEP) neuronal stem cell population maintenance (ISO,ISS) positive regulation of DNA-templated transcription (IEA,ISO) positive regulation of gene expression (ISO,ISS) positive regulation of neuron differentiation (ISO,ISS) positive regulation of programmed cell death (IMP) positive regulation of stem cell population maintenance (IEA,ISO,ISS) positive regulation of transcription by RNA polymerase II (IBA) regulation of alternative mRNA splicing, via spliceosome (ISO,ISS) regulation of DNA-templated transcription (ISO,ISS) regulation of gene expression (ISO) regulation of osteoblast differentiation (ISO,ISS) response to ethanol (IEP) response to hypoxia (IEA,ISO,ISS) response to ischemia (IDA,IEP) somatic stem cell population maintenance (ISO,ISS)
Cellular Component
chromatin (IDA) cytoplasm (IEA,ISO,ISS) cytosol (IEA,ISO) nucleoplasm (IEA,ISO) nucleus (IBA,IDA,IEA,ISO,ISS) protein-containing complex (IDA) transcription repressor complex (IBA,IDA,IEA,ISO)
Molecular Function
chromatin binding (ISO,ISS) DNA binding (IDA,ISO) DNA-binding transcription factor activity (IDA,IEA,ISO,TAS) DNA-binding transcription repressor activity, RNA polymerase II-specific (IBA,IDA,IEA,ISO) identical protein binding (ISO,ISS) metal ion binding (IEA) promoter-specific chromatin binding (IDA) protein binding (IPI,ISO) protein-containing complex binding (IDA) RNA polymerase II cis-regulatory region sequence-specific DNA binding (IEA,ISO,ISS) RNA polymerase II core promoter sequence-specific DNA binding (ISO) RNA polymerase II-specific DNA-binding transcription factor binding (IEA,IPI,ISO) sequence-specific DNA binding (IDA,ISO,ISS) transcription cis-regulatory region binding (IBA,IEA,ISO,ISS) zinc ion binding (IEA)
1.
Regulation of neuronal traits by a novel transcriptional complex.
Ballas N, etal., Neuron. 2001 Aug 16;31(3):353-65.
2.
Ischemic insults derepress the gene silencer REST in neurons destined to die.
Calderone A, etal., J Neurosci 2003 Mar 15;23(6):2112-21.
3.
REST: a mammalian silencer protein that restricts sodium channel gene expression to neurons.
Chong JA, etal., Cell. 1995 Mar 24;80(6):949-57.
4.
HMGB1 neuroimmune signaling and REST-G9a gene repression contribute to ethanol-induced reversible suppression of the cholinergic neuron phenotype.
Crews FT, etal., Mol Psychiatry. 2023 Dec;28(12):5159-5172. doi: 10.1038/s41380-023-02160-6. Epub 2023 Jul 4.
5.
miR-29a modulates neuronal differentiation through targeting REST in mesenchymal stem cells.
Duan P, etal., PLoS One. 2014 May 19;9(5):e97684. doi: 10.1371/journal.pone.0097684. eCollection 2014.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
8.
Zinc-finger protein 90 negatively regulates neuron-restrictive silencer factor-mediated transcriptional repression of fetal cardiac genes.
Hata L, etal., J Mol Cell Cardiol. 2011 Jun;50(6):972-81. doi: 10.1016/j.yjmcc.2011.01.017. Epub 2011 Jan 31.
9.
Transcriptional repression by REST: recruitment of Sin3A and histone deacetylase to neuronal genes.
Huang Y, etal., Nat Neurosci. 1999 Oct;2(10):867-72.
10.
The gene silencing transcription factor REST represses miR-132 expression in hippocampal neurons destined to die.
Hwang JY, etal., J Mol Biol. 2014 Oct 9;426(20):3454-66. doi: 10.1016/j.jmb.2014.07.032. Epub 2014 Aug 6.
11.
Evidence of the neuron-restrictive silencer factor (NRSF) interaction with Sp3 and its synergic repression to the mu opioid receptor (MOR) gene.
Kim CS, etal., Nucleic Acids Res. 2006;34(22):6392-403. Epub 2006 Nov 27.
12.
Corepressor-dependent silencing of chromosomal regions encoding neuronal genes.
Lunyak VV, etal., Science 2002 Nov 29;298(5599):1747-52.
13.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
14.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
15.
Repressor element-1 silencing transcription factor (REST)-dependent epigenetic remodeling is critical to ischemia-induced neuronal death.
Noh KM, etal., Proc Natl Acad Sci U S A. 2012 Apr 17;109(16):E962-71. doi: 10.1073/pnas.1121568109. Epub 2012 Feb 27.
16.
Neuronal expression of zinc finger transcription factor REST/NRSF/XBR gene.
Palm K, etal., J Neurosci 1998 Feb 15;18(4):1280-96.
17.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
18.
REST/NRSF governs the expression of dense-core vesicle gliosecretion in astrocytes.
Prada I, etal., J Cell Biol. 2011 May 2;193(3):537-49. doi: 10.1083/jcb.201010126.
19.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
20.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
21.
REST-dependent epigenetic remodeling promotes the developmental switch in synaptic NMDA receptors.
Rodenas-Ruano A, etal., Nat Neurosci. 2012 Oct;15(10):1382-90. doi: 10.1038/nn.3214. Epub 2012 Sep 9.
22.
Protein kinase A regulates cholinergic gene expression in PC12 cells: REST4 silences the silencing activity of neuron-restrictive silencer factor/REST.
Shimojo M, etal., Mol Cell Biol. 1999 Oct;19(10):6788-95.
23.
Regulation of aldosterone and cortisol production by the transcriptional repressor neuron restrictive silencer factor.
Somekawa S, etal., Endocrinology. 2009 Jul;150(7):3110-7. Epub 2009 Apr 2.
Rest Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 31,213,415 - 31,233,451 (-) NCBI GRCr8 mRatBN7.2 14 30,859,109 - 30,879,828 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 30,862,553 - 30,894,354 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 31,239,986 - 31,260,061 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 32,548,313 - 32,568,388 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 31,032,969 - 31,053,042 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 33,131,985 - 33,152,019 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 33,134,511 - 33,164,141 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 32,925,741 - 32,951,551 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 33,136,046 - 33,151,142 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 33,136,045 - 33,151,142 (-) NCBI Celera 14 30,181,687 - 30,196,879 (-) NCBI Celera Cytogenetic Map 14 p11 NCBI
REST Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 56,907,900 - 56,935,844 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 56,907,876 - 56,966,808 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 57,774,066 - 57,802,010 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 57,468,799 - 57,493,097 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 57,614,969 - 57,639,268 NCBI Celera 4 55,279,985 - 55,307,950 (+) NCBI Celera Cytogenetic Map 4 q12 NCBI HuRef 4 53,727,986 - 53,755,535 (+) NCBI HuRef CHM1_1 4 57,809,465 - 57,837,418 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 60,399,324 - 60,427,254 (+) NCBI T2T-CHM13v2.0
Rest Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 77,413,273 - 77,434,279 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 77,413,338 - 77,434,279 (+) Ensembl GRCm39 Ensembl GRCm38 5 77,265,494 - 77,286,432 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 77,265,491 - 77,286,432 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 77,694,519 - 77,712,722 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 78,342,716 - 78,357,759 (+) NCBI MGSCv36 mm8 Celera 5 74,535,211 - 74,550,959 (+) NCBI Celera Cytogenetic Map 5 C3.3 NCBI cM Map 5 41.61 NCBI
REST Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 72,840,537 - 72,868,421 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 73,046,074 - 73,073,965 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 66,984,466 - 67,012,301 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 73,556,780 - 73,582,419 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 73,526,085 - 73,582,242 (-) Ensembl panpan1.1 panPan2
REST Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 49,041,082 - 49,062,596 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 49,041,047 - 49,059,388 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 48,930,954 - 48,953,349 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 49,654,746 - 49,677,219 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 49,656,727 - 49,673,995 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 49,327,159 - 49,349,567 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 48,856,606 - 48,878,993 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 49,801,275 - 49,823,781 (+) NCBI UU_Cfam_GSD_1.0
Rest
REST Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 56,035,150 - 56,215,013 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 56,035,182 - 56,061,140 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 57,440,573 - 57,466,453 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
REST Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 11,749,312 - 11,776,103 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 11,749,168 - 11,773,340 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666066 12,388,814 - 12,415,743 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rest
.
Predicted Target Of
Count of predictions: 291 Count of miRNA genes: 194 Interacting mature miRNAs: 218 Transcripts: ENSRNOT00000002837, ENSRNOT00000002844, ENSRNOT00000064627 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1581500 Renag1 Renal agenesis QTL 1 kidney development trait (VT:0000527) percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940) 14 8170668 68298175 Rat 731183 Pia20 Pristane induced arthritis QTL 20 3.55 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 9088978 39057237 Rat 10755459 Coatc15 Coat color QTL 15 0.01681 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 14 19836944 64836944 Rat 619619 Rf4 Renal disease susceptibility QTL 4 4.1 0.002 urine total protein amount (VT:0000032) urine protein excretion rate to body weight ratio (CMO:0001099) 14 1 32754612 Rat 70187 Pancm5 Pancreatic morphology QTL 5 16.7 pancreas mass (VT:0010144) pancreas weight to body weight ratio (CMO:0000630) 14 30320092 80829842 Rat 2324617 Coatc2 Coat color QTL 2 0.001 coat/hair pigmentation trait (VT:0010463) pigmented coat/hair area to total coat/hair area ratio (CMO:0001810) 14 30767025 39153750 Rat 1358296 Ael3 Aortic elastin QTL 3 3.7 0.00051 aorta elastin amount (VT:0003905) aortic elastin 14 8267090 53267090 Rat 71117 Niddm17 Non-insulin dependent diabetes mellitus QTL 17 2.35 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 14 17593761 42336881 Rat 61420 Pia6 Pristane induced arthritis QTL 6 4.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 14 18631345 42337007 Rat 7387267 Uae42 Urinary albumin excretion QTL 42 0.61 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 14 22167967 67167967 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 2313397 Coatc1 Coat color QTL1 coat/hair pigmentation trait (VT:0010463) coat/hair color measurement (CMO:0001808) 14 18541332 63541332 Rat 631262 Tcas4 Tongue tumor susceptibility QTL 4 7.29 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 14 17622561 42337007 Rat 634352 Apr6 Acute phase response QTL 6 3.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 14 1 41131407 Rat 2302045 Pia39 Pristane induced arthritis QTL 39 4.9 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G2a level (CMO:0002116) 14 8267090 53267090 Rat 1300140 Srn3 Serum renin concentration QTL 3 3.19 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 14 14875168 30883947 Rat
PMC84675P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 30,864,090 - 30,864,736 (+) MAPPER mRatBN7.2 Rnor_6.0 14 33,136,967 - 33,137,612 NCBI Rnor6.0 Rnor_5.0 14 32,930,723 - 32,931,368 UniSTS Rnor5.0 RGSC_v3.4 14 33,137,600 - 33,138,245 UniSTS RGSC3.4 Celera 14 30,183,241 - 30,183,886 UniSTS Cytogenetic Map 14 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000002837 ⟹ ENSRNOP00000002837
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 30,862,553 - 30,878,297 (-) Ensembl Rnor_6.0 Ensembl 14 33,135,413 - 33,150,509 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000002844 ⟹ ENSRNOP00000002844
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 30,862,553 - 30,894,354 (-) Ensembl Rnor_6.0 Ensembl 14 33,134,511 - 33,164,141 (-) Ensembl
RefSeq Acc Id:
NM_031788 ⟹ NP_113976
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 31,213,415 - 31,233,451 (-) NCBI mRatBN7.2 14 30,859,109 - 30,879,148 (-) NCBI Rnor_6.0 14 33,135,413 - 33,150,509 (-) NCBI Rnor_5.0 14 32,925,741 - 32,951,551 (-) NCBI RGSC_v3.4 14 33,136,046 - 33,151,142 (-) RGD Celera 14 30,181,687 - 30,196,879 (-) RGD
Sequence:
ATGGCCACCCAGGTGATGGGGCAGTCTTCTGGAGGAGGAAGTCTCTTTAACAACAGTGGCAACATGGGCATGGCCTTACCCAACGACATGTATGACTTGCACGACCTCTCGAAAGCTGAACTGGCGGC
hide sequence
RefSeq Acc Id:
XM_006250849 ⟹ XP_006250911
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 31,213,415 - 31,233,284 (-) NCBI mRatBN7.2 14 30,859,109 - 30,878,983 (-) NCBI Rnor_6.0 14 33,131,985 - 33,151,920 (-) NCBI Rnor_5.0 14 32,925,741 - 32,951,551 (-) NCBI
Sequence:
CTAGTGCGGACGGCGGGGGAGGGGGCTTCGGGGCCGCGGCCGGCCGAAAGGCGCCTCTAGGGTG
hide sequence
RefSeq Acc Id:
NP_113976 ⟸ NM_031788
- UniProtKB:
F1M9A3 (UniProtKB/TrEMBL)
- Sequence:
MATQVMGQSSGGGSLFNNSGNMGMALPNDMYDLHDLSKAELAAPQLIMLANVALTGEVNGSCCDYLVGEERQMAELMPVGDNHFSDSEGEGLEESAELKGDPSGLDNMELRSLELSVVEPQPVFEASA
hide sequence
RefSeq Acc Id:
XP_006250911 ⟸ XM_006250849
- Peptide Label:
isoform X1
- UniProtKB:
F1M9A3 (UniProtKB/TrEMBL)
- Sequence:
MATQVMGQSSGGGSLFNNSGNMGMALPNDMYDLHDLSKAELAAPQLIMLANVALTGEVNGSCCD
hide sequence
Ensembl Acc Id:
ENSRNOP00000002844 ⟸ ENSRNOT00000002844
Ensembl Acc Id:
ENSRNOP00000002837 ⟸ ENSRNOT00000002837
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Rest
RE1-silencing transcription factor
zinc finger transcription factor REST protein
Name updated
1299863 APPROVED
2002-08-07
Rest
zinc finger transcription factor REST protein
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_disease
mRNA and protein expression are induced by global ischemia
1299303
gene_expression
expression decreases during neuronal development
633753
gene_transcript
has several splicing forms with mRNAs encoding proteins with nine, five, or four zinc finger motifs
633753
