Symbol:
Rps3 (Ensembl: Rps3l1)
Name:
ribosomal protein S3 (Ensembl:ribosomal protein S3 like 1)
RGD ID:
619888
Description:
Enables kinase binding activity. Involved in DNA damage response; cellular response to nerve growth factor stimulus; and regulation of apoptotic process. Located in dendrite and nucleus. Part of cytosolic small ribosomal subunit. Orthologous to human RPS3 (ribosomal protein S3); PARTICIPATES IN ribosome biogenesis pathway; translation pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
40S ribosomal protein S3; small ribosomal subunit protein uS3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RPS3 (ribosomal protein S3) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Rps3 (ribosomal protein S3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Rps3 (ribosomal protein S3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RPS3 (ribosomal protein S3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RPS3 (ribosomal protein S3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rps3 (ribosomal protein S3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RPS3 (ribosomal protein S3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RPS3 (ribosomal protein S3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Rps3 (ribosomal protein S3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
PRSS22 (serine protease 22) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
RPS3 (ribosomal protein S3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|SonicParanoid)
Mus musculus (house mouse):
Rps3 (ribosomal protein S3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
rps3 (ribosomal protein S3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
rps-3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RPS3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
RpS3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
rps3
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 163,190,476 - 163,195,885 (-) NCBI GRCr8 mRatBN7.2 1 153,778,363 - 153,783,663 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 153,777,472 - 153,783,680 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 161,774,286 - 161,779,586 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 168,954,438 - 168,959,738 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 161,827,972 - 161,833,272 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 164,435,868 - 164,441,167 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 164,435,878 - 164,441,167 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 170,637,728 - 170,643,027 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 156,811,470 - 156,816,770 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 156,889,883 - 156,895,183 (-) NCBI Celera 1 151,861,094 - 151,866,394 (-) NCBI Celera Cytogenetic Map 1 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rps3 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane affects expression EXP 6480464 o and p'-DDT affects the expression of RPS3 mRNA CTD PMID:17984292 Rps3 Rat 1,2-dimethylhydrazine increases expression ISO Rps3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of RPS3 mRNA CTD PMID:22206623 Rps3 Rat 1,2-dimethylhydrazine multiple interactions ISO Rps3 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of RPS3 mRNA] CTD PMID:22206623 Rps3 Rat 17alpha-ethynylestradiol affects expression ISO Rps3 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of RPS3 mRNA CTD PMID:17555576 Rps3 Rat 17beta-estradiol multiple interactions ISO RPS3 (Homo sapiens) 6480464 3 more ... CTD PMID:11179685 Rps3 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of RPS3 protein CTD PMID:32145629 Rps3 Rat 17beta-estradiol increases expression ISO RPS3 (Homo sapiens) 6480464 Estradiol results in increased expression of RPS3 mRNA CTD PMID:11179685 Rps3 Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one multiple interactions ISO RPS3 (Homo sapiens) 6480464 Metribolone promotes the reaction [NDRG1 protein binds to RPS3 protein] CTD PMID:17220478 Rps3 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Rps3 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Rps3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RPS3 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin inhibits the reaction [Estradiol results in increased expression of RPS3 mRNA] CTD PMID:11179685 Rps3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of RPS3 mRNA CTD PMID:33387578 Rps3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Rps3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of RPS3 mRNA CTD PMID:21570461 Rps3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Rps3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to RPS3 promoter] CTD PMID:19654925 Rps3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of RPS3 mRNA and Tetrachlorodibenzodioxin results in decreased expression of RPS3 protein CTD PMID:16548065 and PMID:34747641 Rps3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Rps3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of RPS3 mRNA CTD PMID:18796159 Rps3 Rat 2,6-dimethoxyphenol multiple interactions ISO RPS3 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of RPS3 protein CTD PMID:38598786 Rps3 Rat 2-nitrofluorene increases expression EXP 6480464 2-nitrofluorene results in increased expression of RPS3 mRNA CTD PMID:15890375 Rps3 Rat 3,3'-diindolylmethane multiple interactions ISO RPS3 (Homo sapiens) 6480464 3 and 3'-diindolylmethane inhibits the reaction [Estradiol results in increased expression of RPS3 mRNA] CTD PMID:11179685 Rps3 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RPS3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of RPS3 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of RPS3 mRNA CTD PMID:28628672 Rps3 Rat 4,4'-sulfonyldiphenol affects expression ISO Rps3 (Mus musculus) 6480464 bisphenol S affects the expression of RPS3 mRNA CTD PMID:39298647 Rps3 Rat 4,4'-sulfonyldiphenol increases expression ISO RPS3 (Homo sapiens) 6480464 bisphenol S results in increased expression of RPS3 protein CTD PMID:34186270 Rps3 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of RPS3 mRNA CTD PMID:36041667 Rps3 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases expression EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of RPS3 mRNA CTD PMID:15890375 Rps3 Rat 4-hydroxyphenyl retinamide increases expression ISO Rps3 (Mus musculus) 6480464 Fenretinide results in increased expression of RPS3 mRNA CTD PMID:28973697 Rps3 Rat acrolein multiple interactions ISO RPS3 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] affects the expression of RPS3 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which affects the expression of RPS3 mRNA CTD PMID:32699268 Rps3 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of RPS3 mRNA CTD PMID:28959563 Rps3 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of RPS3 mRNA CTD PMID:15890375 Rps3 Rat aflatoxin B1 increases expression ISO Rps3 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of RPS3 mRNA CTD PMID:19770486 Rps3 Rat all-trans-retinoic acid decreases expression ISO RPS3 (Homo sapiens) 6480464 Tretinoin results in decreased expression of RPS3 mRNA CTD PMID:23724009 Rps3 Rat alpha-pinene multiple interactions ISO RPS3 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] affects the expression of RPS3 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which affects the expression of RPS3 mRNA CTD PMID:32699268 Rps3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of RPS3 mRNA CTD PMID:16483693 Rps3 Rat antimycin A increases expression ISO RPS3 (Homo sapiens) 6480464 Antimycin A results in increased expression of RPS3 mRNA CTD PMID:33512557 Rps3 Rat Aroclor 1254 increases expression ISO Rps3 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of RPS3 mRNA CTD PMID:23650126 Rps3 Rat arsenite(3-) multiple interactions ISO RPS3 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to RPS3 mRNA] CTD PMID:32406909 Rps3 Rat benzatropine decreases expression ISO RPS3 (Homo sapiens) 6480464 Benztropine results in decreased expression of RPS3 protein CTD PMID:34122009 Rps3 Rat benzo[a]pyrene multiple interactions ISO Rps3 (Mus musculus) 6480464 AHR protein affects the reaction [Benzo(a)pyrene affects the expression of RPS3 mRNA] CTD PMID:22228805 Rps3 Rat benzo[a]pyrene increases methylation ISO RPS3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of RPS3 promoter CTD PMID:27901495 Rps3 Rat benzo[a]pyrene increases expression ISO Rps3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of RPS3 mRNA CTD PMID:20504355 and PMID:22228805 Rps3 Rat beta-lapachone increases expression ISO RPS3 (Homo sapiens) 6480464 beta-lapachone results in increased expression of RPS3 mRNA CTD PMID:38218311 Rps3 Rat beta-lapachone decreases expression ISO RPS3 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of RPS3 mRNA CTD PMID:38218311 Rps3 Rat bis(2-ethylhexyl) phthalate increases expression ISO Rps3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of RPS3 mRNA CTD PMID:33754040 Rps3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of RPS3 mRNA CTD PMID:25181051 Rps3 Rat bisphenol A decreases expression ISO RPS3 (Homo sapiens) 6480464 bisphenol A results in decreased expression of RPS3 protein CTD PMID:37567409 Rps3 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of RPS3 mRNA CTD PMID:36041667 Rps3 Rat bisphenol A increases expression ISO Rps3 (Mus musculus) 6480464 bisphenol A results in increased expression of RPS3 mRNA CTD PMID:32156529 and PMID:38074096 Rps3 Rat bisphenol A increases expression ISO RPS3 (Homo sapiens) 6480464 bisphenol A results in increased expression of RPS3 protein CTD PMID:34186270 Rps3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of RPS3 mRNA and bisphenol A results in decreased expression of RPS3 protein CTD PMID:32145629 and PMID:33296240 Rps3 Rat bisphenol A increases methylation ISO Rps3 (Mus musculus) 6480464 bisphenol A results in increased methylation of RPS3 promoter CTD PMID:27312807 Rps3 Rat bisphenol A multiple interactions ISO RPS3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of RPS3 mRNA CTD PMID:28628672 Rps3 Rat Bisphenol B increases expression ISO RPS3 (Homo sapiens) 6480464 bisphenol B results in increased expression of RPS3 protein CTD PMID:34186270 Rps3 Rat bisphenol F multiple interactions ISO RPS3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of RPS3 mRNA CTD PMID:28628672 Rps3 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of RPS3 mRNA CTD PMID:36041667 Rps3 Rat bisphenol F increases expression ISO RPS3 (Homo sapiens) 6480464 bisphenol F results in increased expression of RPS3 protein CTD PMID:34186270 Rps3 Rat Brodifacoum decreases expression EXP 6480464 bromfenacoum results in decreased expression of RPS3 protein CTD PMID:28903499 Rps3 Rat caffeine decreases phosphorylation ISO RPS3 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of RPS3 protein CTD PMID:35688186 Rps3 Rat cannabidiol decreases expression ISO RPS3 (Homo sapiens) 6480464 Cannabidiol results in decreased expression of RPS3 protein CTD PMID:34122009 Rps3 Rat chloropicrin decreases expression ISO RPS3 (Homo sapiens) 6480464 chloropicrin results in decreased expression of RPS3 mRNA CTD PMID:26352163 Rps3 Rat chlorpyrifos increases expression ISO Rps3 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of RPS3 mRNA CTD PMID:37019170 Rps3 Rat chromium(6+) affects expression ISO Rps3 (Mus musculus) 6480464 chromium hexavalent ion affects the expression of RPS3 mRNA CTD PMID:28472532 Rps3 Rat clofibric acid multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of RPS3 mRNA CTD PMID:17602206 Rps3 Rat clozapine decreases expression ISO RPS3 (Homo sapiens) 6480464 Clozapine results in decreased expression of RPS3 protein CTD PMID:34122009 Rps3 Rat copper(II) sulfate decreases expression ISO RPS3 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of RPS3 mRNA CTD PMID:19549813 Rps3 Rat coumarin increases phosphorylation ISO RPS3 (Homo sapiens) 6480464 coumarin results in increased phosphorylation of RPS3 protein CTD PMID:35688186 Rps3 Rat CU-O LINKAGE increases expression ISO RPS3 (Homo sapiens) 6480464 cupric oxide results in increased expression of RPS3 protein CTD PMID:25470785 Rps3 Rat cyclophosphamide decreases expression EXP 6480464 Cyclophosphamide results in decreased expression of RPS3 mRNA CTD PMID:11906922 Rps3 Rat cyclosporin A increases expression ISO RPS3 (Homo sapiens) 6480464 Cyclosporine results in increased expression of RPS3 mRNA CTD PMID:20106945 Rps3 Rat cylindrospermopsin increases expression ISO Rps3 (Mus musculus) 6480464 cylindrospermopsin results in increased expression of RPS3 mRNA CTD PMID:20936652 Rps3 Rat deguelin increases expression ISO RPS3 (Homo sapiens) 6480464 deguelin results in increased expression of RPS3 mRNA CTD PMID:33512557 Rps3 Rat dexamethasone multiple interactions ISO RPS3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of RPS3 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of RPS3 mRNA CTD PMID:28628672 Rps3 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of RPS3 mRNA CTD PMID:15890375 Rps3 Rat disodium selenite increases expression ISO RPS3 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of RPS3 mRNA CTD PMID:18175754 Rps3 Rat enzyme inhibitor multiple interactions ISO RPS3 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of RPS3 protein CTD PMID:23301498 Rps3 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of RPS3 protein CTD PMID:19609968 Rps3 Rat ethanol affects splicing ISO Rps3 (Mus musculus) 6480464 Ethanol affects the splicing of RPS3 mRNA CTD PMID:30319688 Rps3 Rat fenpyroximate increases expression ISO RPS3 (Homo sapiens) 6480464 fenpyroximate results in increased expression of RPS3 mRNA CTD PMID:33512557 Rps3 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of RPS3 mRNA CTD PMID:24136188 Rps3 Rat folic acid decreases expression ISO Rps3 (Mus musculus) 6480464 Folic Acid results in decreased expression of RPS3 mRNA CTD PMID:25629700 Rps3 Rat folic acid multiple interactions ISO Rps3 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of RPS3 mRNA] CTD PMID:22206623 Rps3 Rat FR900359 affects phosphorylation ISO RPS3 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of RPS3 protein CTD PMID:37730182 Rps3 Rat furfural multiple interactions ISO RPS3 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of RPS3 protein CTD PMID:38598786 Rps3 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of RPS3 mRNA CTD PMID:22061828 Rps3 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of RPS3 mRNA CTD PMID:24136188 Rps3 Rat indometacin multiple interactions ISO RPS3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of RPS3 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of RPS3 mRNA CTD PMID:28628672 Rps3 Rat indometacin increases expression EXP 6480464 Indomethacin results in increased expression of RPS3 mRNA CTD PMID:36868495 Rps3 Rat ivermectin decreases expression ISO RPS3 (Homo sapiens) 6480464 Ivermectin results in decreased expression of RPS3 protein CTD PMID:32959892 Rps3 Rat lead(0) affects expression ISO RPS3 (Homo sapiens) 6480464 Lead affects the expression of RPS3 mRNA CTD PMID:28903495 Rps3 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of RPS3 mRNA CTD PMID:15890375 Rps3 Rat methylparaben increases expression ISO RPS3 (Homo sapiens) 6480464 methylparaben results in increased expression of RPS3 mRNA CTD PMID:31745603 Rps3 Rat N-methyl-4-phenylpyridinium increases expression ISO Rps3 (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in increased expression of RPS3 protein CTD PMID:26558463 Rps3 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with Clofibric Acid] affects the expression of RPS3 mRNA CTD PMID:17602206 Rps3 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of RPS3 mRNA CTD PMID:15890375 Rps3 Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of RPS3 mRNA CTD PMID:24136188 Rps3 Rat nickel atom multiple interactions ISO Rps3 (Mus musculus) 6480464 MT1 affects the reaction [Nickel affects the expression of RPS3 mRNA] and MT2 affects the reaction [Nickel affects the expression of RPS3 mRNA] CTD PMID:16166738 Rps3 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of RPS3 mRNA CTD PMID:24136188 Rps3 Rat nitrates multiple interactions ISO Rps3 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of RPS3 mRNA CTD PMID:35964746 Rps3 Rat ozone multiple interactions ISO RPS3 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] affects the expression of RPS3 mRNA more ... CTD PMID:32699268 Rps3 Rat ozone increases phosphorylation EXP 6480464 Ozone results in increased phosphorylation of RPS3 protein CTD PMID:33146391 Rps3 Rat paracetamol affects expression ISO Rps3 (Mus musculus) 6480464 Acetaminophen affects the expression of RPS3 mRNA CTD PMID:17562736 Rps3 Rat parathion increases expression ISO Rps3 (Mus musculus) 6480464 Parathion results in increased expression of RPS3 mRNA CTD PMID:34813904 Rps3 Rat perfluorooctanoic acid decreases expression ISO RPS3 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of RPS3 protein CTD PMID:26879310 Rps3 Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of RPS3 mRNA CTD PMID:15215175 Rps3 Rat picoxystrobin increases expression ISO RPS3 (Homo sapiens) 6480464 picoxystrobin results in increased expression of RPS3 mRNA CTD PMID:33512557 Rps3 Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of RPS3 mRNA CTD PMID:15890375 Rps3 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of RPS3 mRNA CTD PMID:15890375 Rps3 Rat pyrimidifen increases expression ISO RPS3 (Homo sapiens) 6480464 pyrimidifen results in increased expression of RPS3 mRNA CTD PMID:33512557 Rps3 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of RPS3 mRNA CTD PMID:19013527 Rps3 Rat rotenone increases expression ISO RPS3 (Homo sapiens) 6480464 Rotenone results in increased expression of RPS3 mRNA CTD PMID:33512557 Rps3 Rat SB 431542 multiple interactions ISO RPS3 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of RPS3 protein CTD PMID:37664457 Rps3 Rat sodium arsenate increases expression ISO Rps3 (Mus musculus) 6480464 sodium arsenate results in increased expression of RPS3 mRNA CTD PMID:30953684 Rps3 Rat sodium arsenite decreases expression ISO RPS3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of RPS3 mRNA CTD PMID:38568856 Rps3 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of RPS3 mRNA CTD PMID:35314868 Rps3 Rat sodium arsenite multiple interactions ISO RPS3 (Homo sapiens) 6480464 sodium arsenite inhibits the reaction [RPS3 protein binds to Ribonucleotides] and sodium arsenite results in decreased expression of and results in decreased activity of RPS3 protein CTD PMID:30528433 Rps3 Rat sodium chloride multiple interactions ISO RPS3 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of RPS3 protein more ... CTD PMID:38598786 Rps3 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of RPS3 mRNA CTD PMID:22561333 Rps3 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of RPS3 mRNA CTD PMID:16684804 Rps3 Rat streptozocin multiple interactions EXP 6480464 vanadyl sulfate inhibits the reaction [Streptozocin results in increased expression of RPS3 mRNA] CTD PMID:16684804 Rps3 Rat tebufenpyrad increases expression ISO RPS3 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in increased expression of RPS3 mRNA CTD PMID:33512557 Rps3 Rat temozolomide increases expression ISO RPS3 (Homo sapiens) 6480464 Temozolomide results in increased expression of RPS3 mRNA CTD PMID:31758290 Rps3 Rat tetrachloromethane increases expression ISO Rps3 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of RPS3 mRNA CTD PMID:27339419 and PMID:31919559 Rps3 Rat thapsigargin increases expression EXP 6480464 Thapsigargin results in increased expression of RPS3 protein CTD PMID:35544339 Rps3 Rat triphenyl phosphate affects expression ISO RPS3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of RPS3 mRNA CTD PMID:37042841 Rps3 Rat tungsten increases expression ISO Rps3 (Mus musculus) 6480464 Tungsten results in increased expression of RPS3 mRNA CTD PMID:30912803 Rps3 Rat urethane increases expression ISO RPS3 (Homo sapiens) 6480464 Urethane results in increased expression of RPS3 mRNA CTD PMID:28818685 Rps3 Rat vanadyl sulfate multiple interactions EXP 6480464 vanadyl sulfate inhibits the reaction [Streptozocin results in increased expression of RPS3 mRNA] CTD PMID:16684804 Rps3 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of RPS3 mRNA CTD PMID:23034163 Rps3 Rat zearalenone decreases expression ISO Rps3 (Mus musculus) 6480464 Zearalenone results in decreased expression of RPS3 protein CTD PMID:35504548
1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dimethoxyphenol (ISO) 2-nitrofluorene (EXP) 3,3'-diindolylmethane (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP) 4-hydroxyphenyl retinamide (ISO) acrolein (ISO) acrylamide (EXP) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) ammonium chloride (EXP) antimycin A (ISO) Aroclor 1254 (ISO) arsenite(3-) (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (EXP,ISO) Brodifacoum (EXP) caffeine (ISO) cannabidiol (ISO) chloropicrin (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) clofibric acid (EXP) clozapine (ISO) copper(II) sulfate (ISO) coumarin (ISO) CU-O LINKAGE (ISO) cyclophosphamide (EXP) cyclosporin A (ISO) cylindrospermopsin (ISO) deguelin (ISO) dexamethasone (ISO) diethylstilbestrol (EXP) disodium selenite (ISO) enzyme inhibitor (ISO) ethanol (EXP,ISO) fenpyroximate (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) furfural (ISO) gentamycin (EXP) glafenine (EXP) indometacin (EXP,ISO) ivermectin (ISO) lead(0) (ISO) methapyrilene (EXP) methylparaben (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (EXP) N-nitrosodimethylamine (EXP) nefazodone (EXP) nickel atom (ISO) nimesulide (EXP) nitrates (ISO) ozone (EXP,ISO) paracetamol (ISO) parathion (ISO) perfluorooctanoic acid (ISO) PhIP (EXP) picoxystrobin (ISO) piperonyl butoxide (EXP) pirinixic acid (EXP) pyrimidifen (ISO) rotenone (EXP,ISO) SB 431542 (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) sodium dichromate (EXP) streptozocin (EXP) tebufenpyrad (ISO) temozolomide (ISO) tetrachloromethane (ISO) thapsigargin (EXP) triphenyl phosphate (ISO) tungsten (ISO) urethane (ISO) vanadyl sulfate (EXP) vinclozolin (EXP) zearalenone (ISO)
Cellular Component
cytoplasm (IEA,ISO) cytoplasmic side of rough endoplasmic reticulum membrane (ISO) cytoskeleton (IEA) cytosol (ISO) cytosolic ribosome (IEA,ISO) cytosolic small ribosomal subunit (IBA,IDA,ISO) dendrite (IDA) endoplasmic reticulum (ISO) membrane (IEA) mitochondrial inner membrane (IEA,ISO) mitochondrial matrix (ISO) mitochondrion (IEA) mitotic spindle (ISO) NF-kappaB complex (ISO) nucleolus (IEA,ISO) nucleus (IBA,IDA,IEA,ISO) plasma membrane (ISO) postsynaptic density (ISO) ribonucleoprotein complex (IEA,ISO,ISS) ribosome (IEA,ISO) ruffle membrane (ISO) small ribosomal subunit (IEA) spindle (IEA) synapse (ISO)
1.
Structures of the human and Drosophila 80S ribosome.
Anger AM, etal., Nature. 2013 May 2;497(7447):80-5. doi: 10.1038/nature12104.
2.
The primary structure of rat ribosomal protein S3.
Chan YL, etal., Arch Biochem Biophys 1990 Dec;283(2):546-50.
3.
The isolation of eukaryotic ribosomal proteins. The purification and characterization of the 40 S ribosomal subunit proteins S2, S3, S4, S5, S6, S7, S8, S9, S13, S23/S24, S27, and S28.
Collatz E, etal., J Biol Chem. 1976 Aug 10;251(15):4666-72.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Ribosomal protein S3, a new substrate of Akt, serves as a signal mediator between neuronal apoptosis and DNA repair.
Lee SB, etal., J Biol Chem. 2010 Sep 17;285(38):29457-68. doi: 10.1074/jbc.M110.131367. Epub 2010 Jul 6.
7.
Immunoelectron microscopic studies on the location of ribosomal proteins on the surface of the 40S ribosomal subunit from rat liver.
Lutsch G, etal., Eur J Cell Biol. 1990 Feb;51(1):140-50.
8.
Dendritic ribosomes suggest local protein synthesis during estrous synaptogenesis.
McCarthy JB and Milner TA, Neuroreport. 2003 Jul 18;14(10):1357-60.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
Synaptotagmin 11 interacts with components of the RNA-induced silencing complex RISC in clonal pancreatic beta-cells.
Milochau A, etal., FEBS Lett. 2014 Jun 27;588(14):2217-22. doi: 10.1016/j.febslet.2014.05.031. Epub 2014 May 29.
11.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.
Functional dichotomy of ribosomal proteins during the synthesis of mammalian 40S ribosomal subunits.
O'Donohue MF, etal., J Cell Biol. 2010 Sep 6;190(5):853-66. doi: 10.1083/jcb.201005117.
13.
GOA pipeline
RGD automated data pipeline
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
The RNA-binding protein MARTA2 regulates dendritic targeting of MAP2 mRNAs in rat neurons.
Zivraj KH, etal., J Neurochem. 2013 Mar;124(5):670-84. doi: 10.1111/jnc.12079. Epub 2013 Jan 20.
Rps3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 163,190,476 - 163,195,885 (-) NCBI GRCr8 mRatBN7.2 1 153,778,363 - 153,783,663 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 153,777,472 - 153,783,680 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 161,774,286 - 161,779,586 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 168,954,438 - 168,959,738 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 161,827,972 - 161,833,272 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 164,435,868 - 164,441,167 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 164,435,878 - 164,441,167 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 170,637,728 - 170,643,027 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 156,811,470 - 156,816,770 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 156,889,883 - 156,895,183 (-) NCBI Celera 1 151,861,094 - 151,866,394 (-) NCBI Celera Cytogenetic Map 1 q32 NCBI
RPS3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 75,399,518 - 75,422,302 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 75,399,515 - 75,422,280 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 75,110,562 - 75,133,346 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 74,788,210 - 74,794,381 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 74,788,221 - 74,794,380 NCBI Celera 11 72,418,313 - 72,424,484 (+) NCBI Celera Cytogenetic Map 11 q13.4 NCBI HuRef 11 71,407,971 - 71,430,530 (+) NCBI HuRef CHM1_1 11 74,994,110 - 75,016,921 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 75,329,106 - 75,351,811 (+) NCBI T2T-CHM13v2.0
Rps3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 99,127,103 - 99,132,916 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 99,127,103 - 99,132,945 (-) Ensembl GRCm39 Ensembl GRCm38 7 99,477,896 - 99,483,709 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 99,477,896 - 99,483,738 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 106,626,406 - 106,632,219 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 99,346,578 - 99,357,709 (-) NCBI MGSCv36 mm8 Celera 7 99,802,893 - 99,808,694 (-) NCBI Celera Cytogenetic Map 7 E1 NCBI cM Map 7 54.07 NCBI
Rps3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955414 16,436,899 - 16,443,073 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955414 16,436,899 - 16,442,325 (-) NCBI ChiLan1.0 ChiLan1.0
RPS3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 76,331,396 - 76,337,606 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 77,374,084 - 77,380,294 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 70,460,702 - 70,466,909 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 73,762,794 - 73,768,982 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 73,762,794 - 73,768,982 (+) Ensembl panpan1.1 panPan2
RPS3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 21 23,180,515 - 23,187,034 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 21 23,180,515 - 23,187,034 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 21 22,946,186 - 22,952,704 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 21 23,383,445 - 23,389,963 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 21 23,383,445 - 23,389,963 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 21 23,181,778 - 23,188,296 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 21 23,378,071 - 23,384,591 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 21 23,295,999 - 23,302,524 (-) NCBI UU_Cfam_GSD_1.0
Rps3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 62,598,517 - 62,604,928 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936498 4,198,130 - 4,204,528 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936498 4,198,189 - 4,204,531 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RPS3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 9,624,990 - 9,630,401 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 9,612,939 - 9,630,404 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 10,814,836 - 10,818,618 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RPS3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 66,629,895 - 66,636,462 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 66,629,954 - 66,635,344 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666043 59,169,727 - 59,176,327 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rps3
.
Predicted Target Of
Count of predictions: 34 Count of miRNA genes: 34 Interacting mature miRNAs: 34 Transcripts: ENSRNOT00000023935 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
61442 Strs1 Sensitivity to stroke QTL 1 7.4 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 1 121767634 166767634 Rat 1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1598866 Bp287 Blood pressure QTL 287 5.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1578770 Stresp23 Stress response QTL 23 kidney sympathetic nerve activity (VT:0004050) stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786) 1 123350408 182418476 Rat 70160 Bw18 Body weight QTL 18 5.7 body mass (VT:0001259) body weight (CMO:0000012) 1 144267353 196383668 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 631199 Cm23 Cardiac mass QTL 23 4.6 0.0004 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 115585465 172949803 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1598850 Bp297 Blood pressure QTL 297 2.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121006655 166006655 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 152025232 Bw192 Body weight QTL 192 3.93 body mass (VT:0001259) 1 117917486 196963478 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 61343 Bp28 Blood pressure QTL 28 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 151646613 196646613 Rat 724521 Uae1 Urinary albumin excretion QTL 1 3.8 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 90508614 173018436 Rat 1358902 Bw47 Body weight QTL 47 1.67 body mass (VT:0001259) body weight (CMO:0000012) 1 90508614 180359386 Rat 61348 Bp30 Blood pressure QTL 30 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144017057 197814409 Rat 8655649 Arrd1 Age-related retinal degeneration QTL 1 4.89 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 100357752 183970443 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631202 Gluco13 Glucose level QTL 13 0.0001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 131763437 159756369 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 1300158 Bp173 Blood pressure QTL 173 3.48 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 1 115540693 185145286 Rat 631206 Niddm40 Non-insulin dependent diabetes mellitus QTL 40 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 136745990 163747690 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 1331751 Bp199 Blood pressure QTL 199 3.60022 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 94494440 181830018 Rat 9685799 Bp375 Blood pressure QTL 375 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 2293140 Bp313 Blood pressure QTL 313 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 121833674 166833674 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 9685802 Bp376 Blood pressure QTL 376 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 126540680 171540680 Rat 1641895 Bp298 Blood pressure QTL 298 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 123350408 182418476 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 634315 Niddm45 Non-insulin dependent diabetes mellitus QTL 45 7.16 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 144267916 172949660 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 61379 Bp44 Blood pressure QTL 44 19.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 144267916 174133260 Rat 1331793 Bp200 Blood pressure QTL 200 3.71601 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94494440 172949803 Rat 2313060 Bss71 Bone structure and strength QTL 71 2.6 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 1 118944747 163944747 Rat 6893347 Bw98 Body weight QTL 98 0.2 0.53 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 724550 Thym3 Thymus enlargement QTL 3 7.82 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 71118 Thym1 Thymus enlargement QTL 1 10.17 0.001 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 136829932 181829932 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 631519 Pia11 Pristane induced arthritis QTL 11 5.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 136830018 181830018 Rat 6893361 Bw104 Body weight QTL 104 0.59 0.27 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 738006 Anxrr14 Anxiety related response QTL 14 4 0.00035 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1558645 Bw55 Body weight QTL 55 3.2 0.004 body mass (VT:0001259) body weight (CMO:0000012) 1 133680936 178680936 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 634348 Bp138 Blood pressure QTL 138 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 168883176 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 738028 Anxrr12 Anxiety related response QTL 12 4.9 0.00001 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 130636910 175636910 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 8693608 Alc24 Alcohol consumption QTL 24 2.3 0.74 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 150452391 168228760 Rat 631654 Bp107 Blood pressure QTL 107 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 125611501 170611501 Rat 631544 Bp84 Blood pressure QTL 84 5.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350408 181759564 Rat 152025212 Bw190 Body weight QTL 190 5.7 body mass (VT:0001259) 1 123556856 196963478 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 1358189 Cstrr1 Cold stress response QTL 1 0.0001 catecholamine amount (VT:0010543) urine norepinephrine level (CMO:0001629) 1 123350408 182418476 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000023935 ⟹ ENSRNOP00000023935
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 153,778,366 - 153,783,349 (-) Ensembl Rnor_6.0 Ensembl 1 164,435,878 - 164,441,167 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000105265 ⟹ ENSRNOP00000087646
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 153,777,799 - 153,783,679 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000108507 ⟹ ENSRNOP00000079648
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 153,777,472 - 153,783,680 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000114051 ⟹ ENSRNOP00000076445
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 153,777,729 - 153,783,680 (-) Ensembl
RefSeq Acc Id:
NM_001009239 ⟹ NP_001009239
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 163,190,476 - 163,195,776 (-) NCBI mRatBN7.2 1 153,778,363 - 153,783,663 (-) NCBI Rnor_6.0 1 164,435,868 - 164,441,167 (-) NCBI Rnor_5.0 1 170,637,728 - 170,643,027 (-) NCBI RGSC_v3.4 1 156,811,470 - 156,816,770 (-) RGD Celera 1 151,861,094 - 151,866,394 (-) RGD
Sequence:
CGCGGCAGCAAGATGGCGGTGCAGATTTCCAAGAAGAGGAAGTTTGTAGCTGATGGCATCTTCAAAGCTGAACTGAATGAGTTTCTCACTCGGGAGCTGGCTGAAGATGGCTACTCTGGAGTTGAAGT
hide sequence
RefSeq Acc Id:
XM_063270251 ⟹ XP_063126321
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 163,190,478 - 163,195,885 (-) NCBI
RefSeq Acc Id:
NP_001009239 ⟸ NM_001009239
- UniProtKB:
P62909 (UniProtKB/Swiss-Prot), A6I6I3 (UniProtKB/TrEMBL), A0A8L2QCG7 (UniProtKB/TrEMBL)
- Sequence:
MAVQISKKRKFVADGIFKAELNEFLTRELAEDGYSGVEVRVTPTRTEIIILATRTQNVLGEKGRRIRELTAVVQKRFGFPEGSVELYAEKVATRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFIME
hide sequence
Ensembl Acc Id:
ENSRNOP00000023935 ⟸ ENSRNOT00000023935
Ensembl Acc Id:
ENSRNOP00000079648 ⟸ ENSRNOT00000108507
Ensembl Acc Id:
ENSRNOP00000087646 ⟸ ENSRNOT00000105265
Ensembl Acc Id:
ENSRNOP00000076445 ⟸ ENSRNOT00000114051
RefSeq Acc Id:
XP_063126321 ⟸ XM_063270251
- Peptide Label:
isoform X1
- UniProtKB:
P62909 (UniProtKB/Swiss-Prot), A6I6I3 (UniProtKB/TrEMBL), A0A8L2QCG7 (UniProtKB/TrEMBL)
RGD ID: 13690231 Promoter ID: EPDNEW_R752 Type: multiple initiation site Name: Rps3_1 Description: ribosomal protein S3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 164,441,185 - 164,441,245 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-02-26
Rps3
ribosomal protein S3
Symbol and Name status set to approved
625702 APPROVED
2002-08-07
Rps3
ribosomal protein S3
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_protein
243 amino acids and a molecular weight of 26,643
634046
