Symbol:
Actn4
Name:
actinin alpha 4
RGD ID:
61816
Description:
Enables ubiquitin protein ligase binding activity. A structural constituent of postsynaptic actin cytoskeleton. Involved in regulation of apoptotic process and response to hypoxia. Located in neuron projection and stress fiber. Part of protein-containing complex. Is active in glutamatergic synapse and postsynaptic actin cytoskeleton. Human ortholog(s) of this gene implicated in focal segmental glomerulosclerosis and focal segmental glomerulosclerosis 1. Orthologous to human ACTN4 (actinin alpha 4); PARTICIPATES IN platelet-derived growth factor signaling pathway; arrhythmogenic right ventricular cardiomyopathy pathway; Entamoebiasis pathway; INTERACTS WITH 2,2,2-tetramine; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
alpha actinin 4; alpha actinin 4 between D1Rat178 and D1Rat97; alpha-actinin-4; F-actin cross-linking protein; non-muscle alpha-actinin 4
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ACTN4 (actinin alpha 4) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Actn4 (actinin alpha 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Actn4 (actinin alpha 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ACTN4 (actinin alpha 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ACTN4 (actinin alpha 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Actn4 (actinin alpha 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ACTN4 (actinin alpha 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ACTN4 (actinin alpha 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Actn4 (actinin alpha 4) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ACTN1 (actinin alpha 1) HGNC
OrthoDB
Alliance orthologs 3
Mus musculus (house mouse):
Actn4 (actinin alpha 4)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ACTN4 (actinin alpha 4)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
actn4 (actinin, alpha 4)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
Actn
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
atn-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
actn4
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 93,310,294 - 93,379,369 (-) NCBI GRCr8 mRatBN7.2 1 84,182,783 - 84,251,867 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 84,182,788 - 84,251,847 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 89,592,702 - 89,661,646 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 98,051,807 - 98,120,960 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 91,348,565 - 91,417,509 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 87,078,012 - 87,147,347 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 87,078,020 - 87,147,333 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 88,258,630 - 88,327,965 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 84,000,723 - 84,073,767 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 84,079,711 - 84,151,876 (-) NCBI Celera 1 78,572,890 - 78,641,919 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Actn4 Rat (1->4)-beta-D-glucan multiple interactions ISO Actn4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ACTN4 mRNA CTD PMID:36331819 Actn4 Rat 17alpha-ethynylestradiol multiple interactions ISO Actn4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ACTN4 mRNA CTD PMID:17942748 Actn4 Rat 17beta-estradiol increases expression ISO ACTN4 (Homo sapiens) 6480464 Estradiol results in increased expression of ACTN4 mRNA CTD PMID:31614463 Actn4 Rat 2,2,2-tetramine multiple interactions EXP 6480464 Trientine inhibits the reaction [Streptozocin results in increased expression of ACTN4 protein] CTD PMID:19634143 Actn4 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Actn4 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Actn4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Actn4 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ACTN4 mRNA CTD PMID:17942748 Actn4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ACTN4 mRNA CTD PMID:34747641 Actn4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Actn4 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ACTN4 mRNA CTD PMID:20702594 and PMID:21570461 Actn4 Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO Actn4 (Mus musculus) 6480464 2 more ... CTD PMID:20702594 Actn4 Rat 2,6-dimethoxyphenol multiple interactions ISO ACTN4 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 more ... CTD PMID:38598786 Actn4 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of ACTN4 mRNA CTD PMID:21346803 Actn4 Rat 2-methylcholine affects expression ISO ACTN4 (Homo sapiens) 6480464 beta-methylcholine affects the expression of ACTN4 mRNA CTD PMID:21179406 Actn4 Rat 2-nitrotoluene decreases expression EXP 6480464 2-nitrotoluene results in decreased expression of ACTN4 mRNA CTD PMID:16460773 Actn4 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:23196670 Actn4 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of ACTN4 protein CTD PMID:26597043 Actn4 Rat 4,4'-sulfonyldiphenol increases expression ISO ACTN4 (Homo sapiens) 6480464 bisphenol S results in increased expression of ACTN4 protein CTD PMID:34186270 Actn4 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of ACTN4 mRNA CTD PMID:36041667 Actn4 Rat 4-hydroxynon-2-enal affects binding ISO ACTN4 (Homo sapiens) 6480464 ACTN4 protein binds to 4-hydroxy-2-nonenal CTD PMID:20043646 Actn4 Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:12376462 Actn4 Rat aflatoxin B1 decreases expression ISO ACTN4 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of ACTN4 mRNA CTD PMID:22100608 Actn4 Rat aflatoxin B1 increases methylation ISO ACTN4 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of ACTN4 intron CTD PMID:30157460 Actn4 Rat Aflatoxin B2 alpha increases methylation ISO ACTN4 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of ACTN4 intron CTD PMID:30157460 Actn4 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ACTN4 mRNA CTD PMID:16483693 Actn4 Rat antirheumatic drug increases expression ISO ACTN4 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of ACTN4 mRNA CTD PMID:24449571 Actn4 Rat aristolochic acid A increases expression ISO ACTN4 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of ACTN4 protein CTD PMID:33212167 Actn4 Rat arsenite(3-) multiple interactions ISO ACTN4 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to ACTN4 protein] CTD PMID:32406909 Actn4 Rat benzo[a]pyrene decreases methylation ISO Actn4 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of ACTN4 intron CTD PMID:27901495 Actn4 Rat beta-lapachone increases expression ISO ACTN4 (Homo sapiens) 6480464 beta-lapachone results in increased expression of ACTN4 mRNA CTD PMID:38218311 Actn4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ACTN4 mRNA CTD PMID:25181051 Actn4 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of ACTN4 mRNA CTD PMID:36041667 Actn4 Rat bisphenol A increases expression ISO ACTN4 (Homo sapiens) 6480464 bisphenol A results in increased expression of ACTN4 protein CTD PMID:34186270 and PMID:37567409 Actn4 Rat bisphenol A increases expression ISO Actn4 (Mus musculus) 6480464 bisphenol A results in increased expression of ACTN4 mRNA CTD PMID:32156529 Actn4 Rat bisphenol A multiple interactions ISO ACTN4 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ACTN4 gene CTD PMID:31601247 Actn4 Rat bisphenol A decreases methylation ISO ACTN4 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of ACTN4 gene CTD PMID:31601247 Actn4 Rat bisphenol A decreases expression ISO Actn4 (Mus musculus) 6480464 bisphenol A results in decreased expression of ACTN4 mRNA and bisphenol A results in decreased expression of ACTN4 protein CTD PMID:33221593 and PMID:35999755 Actn4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ACTN4 mRNA CTD PMID:34947998 Actn4 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ACTN4 mRNA CTD PMID:30816183 Actn4 Rat bisphenol A affects expression ISO ACTN4 (Homo sapiens) 6480464 bisphenol A affects the expression of ACTN4 mRNA CTD PMID:30903817 Actn4 Rat bisphenol AF increases expression ISO ACTN4 (Homo sapiens) 6480464 bisphenol AF results in increased expression of ACTN4 protein CTD PMID:34186270 Actn4 Rat Bisphenol B increases expression ISO ACTN4 (Homo sapiens) 6480464 bisphenol B results in increased expression of ACTN4 protein CTD PMID:34186270 Actn4 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of ACTN4 mRNA CTD PMID:36041667 Actn4 Rat bleomycin A2 decreases expression EXP 6480464 Bleomycin results in decreased expression of ACTN4 protein CTD PMID:25933445 Actn4 Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of ACTN4 mRNA CTD PMID:15056800 Actn4 Rat bromochloroacetic acid decreases expression EXP 6480464 bromochloroacetic acid results in decreased expression of ACTN4 mRNA CTD PMID:16460773 Actn4 Rat butan-1-ol multiple interactions ISO ACTN4 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of ACTN4 mRNA CTD PMID:29432896 Actn4 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of ACTN4 mRNA CTD PMID:19167457 Actn4 Rat caffeine decreases phosphorylation ISO ACTN4 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of ACTN4 protein CTD PMID:35688186 Actn4 Rat carbonyl sulfide increases expression EXP 6480464 carbonyl sulfide results in increased expression of ACTN4 mRNA CTD PMID:19395590 Actn4 Rat carvedilol decreases expression EXP 6480464 carvedilol results in decreased expression of ACTN4 protein CTD PMID:20403466 Actn4 Rat CGP 52608 multiple interactions ISO ACTN4 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ACTN4 gene] CTD PMID:28238834 Actn4 Rat chlordecone decreases expression ISO Actn4 (Mus musculus) 6480464 Chlordecone results in decreased expression of ACTN4 mRNA CTD PMID:33711761 Actn4 Rat chloropicrin increases expression ISO ACTN4 (Homo sapiens) 6480464 chloropicrin results in increased expression of ACTN4 mRNA CTD PMID:26352163 Actn4 Rat chlorpyrifos increases expression ISO Actn4 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of ACTN4 mRNA CTD PMID:37019170 Actn4 Rat cobalt dichloride decreases expression ISO ACTN4 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of ACTN4 mRNA CTD PMID:19320972 Actn4 Rat crocidolite asbestos increases expression ISO ACTN4 (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of ACTN4 protein CTD PMID:29553831 Actn4 Rat CU-O LINKAGE increases expression ISO ACTN4 (Homo sapiens) 6480464 cupric oxide results in increased expression of ACTN4 protein CTD PMID:25470785 Actn4 Rat cyclosporin A decreases expression ISO ACTN4 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ACTN4 mRNA CTD PMID:20106945 Actn4 Rat dibutyl phthalate increases expression ISO Actn4 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of ACTN4 mRNA CTD PMID:17361019 and PMID:21266533 Actn4 Rat dieldrin affects methylation ISO Actn4 (Mus musculus) 6480464 Dieldrin affects the methylation of ACTN4 gene CTD PMID:38995845 Actn4 Rat diuron decreases expression ISO ACTN4 (Homo sapiens) 6480464 Diuron results in decreased expression of ACTN4 mRNA CTD PMID:35967413 Actn4 Rat doxorubicin affects localization EXP 6480464 Doxorubicin affects the localization of ACTN4 protein CTD PMID:16636307 Actn4 Rat doxorubicin increases expression ISO ACTN4 (Homo sapiens) 6480464 Doxorubicin results in increased expression of ACTN4 mRNA CTD PMID:29803840 Actn4 Rat elemental selenium increases expression ISO ACTN4 (Homo sapiens) 6480464 Selenium results in increased expression of ACTN4 mRNA CTD PMID:19244175 Actn4 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of ACTN4 mRNA CTD PMID:31464424 Actn4 Rat enzyme inhibitor multiple interactions ISO ACTN4 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of ACTN4 protein CTD PMID:23301498 Actn4 Rat epoxiconazole decreases expression ISO Actn4 (Mus musculus) 6480464 epoxiconazole results in decreased expression of ACTN4 mRNA CTD PMID:35436446 Actn4 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of ACTN4 protein CTD PMID:26185205 Actn4 Rat fenthion increases expression ISO Actn4 (Mus musculus) 6480464 Fenthion results in increased expression of ACTN4 mRNA CTD PMID:34813904 Actn4 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of ACTN4 mRNA CTD PMID:24136188 Actn4 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of ACTN4 mRNA CTD PMID:18035473 Actn4 Rat FR900359 increases phosphorylation ISO ACTN4 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of ACTN4 protein CTD PMID:37730182 Actn4 Rat fulvestrant multiple interactions ISO ACTN4 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of ACTN4 gene CTD PMID:31601247 Actn4 Rat furfural multiple interactions ISO ACTN4 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of ACTN4 protein and [Sodium Chloride co-treated with Furaldehyde] results in increased expression of ACTN4 protein CTD PMID:38598786 Actn4 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ACTN4 mRNA CTD PMID:33387578 Actn4 Rat hydrazine increases expression ISO Actn4 (Mus musculus) 6480464 hydrazine results in increased expression of ACTN4 mRNA CTD PMID:15282401 Actn4 Rat inulin multiple interactions ISO Actn4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ACTN4 mRNA CTD PMID:36331819 Actn4 Rat ivermectin decreases expression ISO ACTN4 (Homo sapiens) 6480464 Ivermectin results in decreased expression of ACTN4 protein CTD PMID:32959892 Actn4 Rat lead diacetate multiple interactions ISO Actn4 (Mus musculus) 6480464 [lead acetate results in increased abundance of Lead] which results in decreased methylation of ACTN4 intron CTD PMID:33445541 Actn4 Rat lead(0) multiple interactions ISO Actn4 (Mus musculus) 6480464 [lead acetate results in increased abundance of Lead] which results in decreased methylation of ACTN4 intron CTD PMID:33445541 Actn4 Rat Mesaconitine increases expression EXP 6480464 mesaconitine results in increased expression of ACTN4 protein CTD PMID:37182599 Actn4 Rat methidathion increases expression ISO Actn4 (Mus musculus) 6480464 methidathion results in increased expression of ACTN4 mRNA CTD PMID:34813904 Actn4 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of ACTN4 gene CTD PMID:35440735 Actn4 Rat N-ethyl-N-nitrosourea increases expression EXP 6480464 Ethylnitrosourea results in increased expression of ACTN4 mRNA CTD PMID:15954086 Actn4 Rat N-nitrosomorpholine decreases expression EXP 6480464 N-nitrosomorpholine results in decreased expression of ACTN4 protein CTD PMID:19716841 Actn4 Rat nitrates multiple interactions ISO Actn4 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of ACTN4 mRNA CTD PMID:35964746 Actn4 Rat paracetamol affects expression ISO Actn4 (Mus musculus) 6480464 Acetaminophen affects the expression of ACTN4 mRNA CTD PMID:17562736 Actn4 Rat perfluorohexanesulfonic acid decreases expression ISO Actn4 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of ACTN4 mRNA CTD PMID:37995155 Actn4 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Actn4 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ACTN4 mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of ACTN4 mRNA CTD PMID:36331819 Actn4 Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of ACTN4 mRNA CTD PMID:12376462 Actn4 Rat pirinixic acid increases expression ISO Actn4 (Mus musculus) 6480464 pirinixic acid results in increased expression of ACTN4 mRNA CTD PMID:23811191 Actn4 Rat prostaglandin A1 increases metabolic processing ISO Actn4 (Mus musculus) 6480464 prostaglandin A1 analog results in increased metabolism of ACTN4 protein CTD PMID:19800325 Actn4 Rat quercitrin affects expression ISO ACTN4 (Homo sapiens) 6480464 quercitrin affects the expression of ACTN4 mRNA CTD PMID:25193878 Actn4 Rat resveratrol decreases expression ISO Actn4 (Mus musculus) 6480464 resveratrol results in decreased expression of ACTN4 protein CTD PMID:25505154 Actn4 Rat SB 431542 multiple interactions ISO ACTN4 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of ACTN4 protein CTD PMID:37664457 Actn4 Rat selenium atom increases expression ISO ACTN4 (Homo sapiens) 6480464 Selenium results in increased expression of ACTN4 mRNA CTD PMID:19244175 Actn4 Rat silicon dioxide affects secretion ISO ACTN4 (Homo sapiens) 6480464 Silicon Dioxide analog affects the secretion of ACTN4 protein CTD PMID:25895662 Actn4 Rat simvastatin increases expression ISO ACTN4 (Homo sapiens) 6480464 Simvastatin results in increased expression of ACTN4 mRNA CTD PMID:16710349 Actn4 Rat sodium arsenite decreases expression ISO ACTN4 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ACTN4 mRNA CTD PMID:34032870 Actn4 Rat sodium arsenite increases expression ISO Actn4 (Mus musculus) 6480464 sodium arsenite results in increased expression of ACTN4 mRNA CTD PMID:36209798 Actn4 Rat sodium chloride multiple interactions ISO ACTN4 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of ACTN4 protein more ... CTD PMID:38598786 Actn4 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of ACTN4 protein CTD PMID:19634143 Actn4 Rat streptozocin multiple interactions EXP 6480464 Trientine inhibits the reaction [Streptozocin results in increased expression of ACTN4 protein] CTD PMID:19634143 Actn4 Rat sunitinib decreases expression ISO ACTN4 (Homo sapiens) 6480464 Sunitinib results in decreased expression of ACTN4 mRNA CTD PMID:31533062 Actn4 Rat temozolomide decreases expression ISO ACTN4 (Homo sapiens) 6480464 Temozolomide results in decreased expression of ACTN4 mRNA CTD PMID:31758290 Actn4 Rat testosterone increases expression ISO Actn4 (Mus musculus) 6480464 Testosterone deficiency results in increased expression of ACTN4 mRNA CTD PMID:33848595 Actn4 Rat testosterone multiple interactions ISO Actn4 (Mus musculus) 6480464 1 more ... CTD PMID:33848595 Actn4 Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of ACTN4 protein CTD PMID:35544339 Actn4 Rat thiram increases expression ISO ACTN4 (Homo sapiens) 6480464 Thiram results in increased expression of ACTN4 mRNA CTD PMID:38568856 Actn4 Rat titanium dioxide decreases methylation ISO Actn4 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ACTN4 gene and titanium dioxide results in decreased methylation of ACTN4 promoter CTD PMID:35295148 Actn4 Rat triphenyl phosphate affects expression ISO ACTN4 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ACTN4 mRNA CTD PMID:37042841 Actn4 Rat triptonide decreases expression ISO Actn4 (Mus musculus) 6480464 triptonide results in decreased expression of ACTN4 mRNA CTD PMID:33045310 Actn4 Rat tungsten decreases expression ISO Actn4 (Mus musculus) 6480464 Tungsten results in decreased expression of ACTN4 mRNA CTD PMID:30912803 Actn4 Rat valproic acid affects expression ISO Actn4 (Mus musculus) 6480464 Valproic Acid affects the expression of ACTN4 mRNA CTD PMID:17292431 Actn4 Rat valproic acid decreases expression ISO ACTN4 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ACTN4 mRNA CTD PMID:29154799 Actn4 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of ACTN4 mRNA CTD PMID:22570695 Actn4 Rat vitamin E increases expression ISO ACTN4 (Homo sapiens) 6480464 Vitamin E results in increased expression of ACTN4 mRNA CTD PMID:19244175 Actn4 Rat zoledronic acid decreases expression ISO ACTN4 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of ACTN4 protein CTD PMID:28871336
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2,2-tetramine (EXP) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-methylcholine (ISO) 2-nitrotoluene (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxynon-2-enal (ISO) 7,12-dimethyltetraphene (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP) bleomycin A2 (EXP) bromobenzene (EXP) bromochloroacetic acid (EXP) butan-1-ol (ISO) C60 fullerene (EXP) caffeine (ISO) carbonyl sulfide (EXP) carvedilol (EXP) CGP 52608 (ISO) chlordecone (ISO) chloropicrin (ISO) chlorpyrifos (ISO) cobalt dichloride (ISO) crocidolite asbestos (ISO) CU-O LINKAGE (ISO) cyclosporin A (ISO) dibutyl phthalate (ISO) dieldrin (ISO) diuron (ISO) doxorubicin (EXP,ISO) elemental selenium (ISO) endosulfan (EXP) enzyme inhibitor (ISO) epoxiconazole (ISO) ethanol (EXP) fenthion (ISO) finasteride (EXP) flavonoids (EXP) FR900359 (ISO) fulvestrant (ISO) furfural (ISO) gentamycin (EXP) hydrazine (ISO) inulin (ISO) ivermectin (ISO) lead diacetate (ISO) lead(0) (ISO) Mesaconitine (EXP) methidathion (ISO) methoxychlor (EXP) N-ethyl-N-nitrosourea (EXP) N-nitrosomorpholine (EXP) nitrates (ISO) paracetamol (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) PhIP (EXP) pirinixic acid (ISO) prostaglandin A1 (ISO) quercitrin (ISO) resveratrol (ISO) SB 431542 (ISO) selenium atom (ISO) silicon dioxide (ISO) simvastatin (ISO) sodium arsenite (ISO) sodium chloride (ISO) streptozocin (EXP) sunitinib (ISO) temozolomide (ISO) testosterone (ISO) thapsigargin (EXP) thiram (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) triptonide (ISO) tungsten (ISO) valproic acid (ISO) vinclozolin (EXP) vitamin E (ISO) zoledronic acid (ISO)
Biological Process
actin cytoskeleton organization (IBA) actin filament bundle assembly (ISO) bicellular tight junction assembly (ISO) gene expression (ISO) glomerulus development (ISO) muscle cell development (IBA) negative regulation of substrate adhesion-dependent cell spreading (IEA,ISO) peroxisome proliferator activated receptor signaling pathway (IEA,ISO,ISS) podocyte cell migration (ISO) positive regulation of cell migration (IEA,ISO) positive regulation of non-canonical NF-kappaB signal transduction (IEA,ISO) positive regulation of pinocytosis (ISO) positive regulation of transcription by RNA polymerase II (IEA,ISO) postsynaptic actin cytoskeleton organization (IEA) protein localization to bicellular tight junction (ISO) protein transport (IEA) regulation of apoptotic process (IMP) response to hypoxia (IEP) retinoic acid receptor signaling pathway (IEA,ISO,ISS) tumor necrosis factor-mediated signaling pathway (IEA,ISO) vesicle transport along actin filament (IEA,ISO)
Cellular Component
actin cytoskeleton (IEA,ISO) cell junction (IBA) cell projection (IBA) cell-cell junction (ISO) cortical actin cytoskeleton (IBA,ISO) cortical cytoskeleton (ISO) cytoplasm (IEA,ISO) cytosol (TAS) focal adhesion (ISO) glutamatergic synapse (IDA,IMP) neuron projection (IDA) nucleus (IEA,ISO) perinuclear region of cytoplasm (IEA,ISO,ISS) plasma membrane (IBA) postsynaptic actin cytoskeleton (IDA,IEA,ISO) protein-containing complex (IDA,ISO) pseudopodium (ISO) ribonucleoprotein complex (IEA,ISO,ISS) stress fiber (IDA,ISO) Z disc (IBA,ISO)
Molecular Function
actin binding (IEA) actin filament binding (IBA,IEA,ISO) calcium ion binding (IEA) chromatin DNA binding (IEA,ISO) nuclear receptor binding (ISO) nuclear retinoic acid receptor binding (IEA,ISO) nucleoside binding (IEA,ISO) protein binding (IPI,ISO) protein homodimerization activity (IEA,ISO) protein-containing complex binding (IPI) RNA polymerase II transcription regulatory region sequence-specific DNA binding (IEA,ISO) structural constituent of cytoskeleton (ISO) structural constituent of postsynaptic actin cytoskeleton (IDA,IMP) transcription coactivator activity (IEA,ISO,ISS) transmembrane transporter binding (IEA,ISO) ubiquitin protein ligase binding (IPI)
1.
Actin cytoskeleton regulates extracellular matrix-dependent survival signals in glomerular epithelial cells.
Bijian K, etal., Am J Physiol Renal Physiol. 2005 Dec;289(6):F1313-23. Epub 2005 Jul 12.
2.
BERP, a novel ring finger protein, binds to alpha-actinin-4.
El-Husseini AE, etal., Biochem Biophys Res Commun 2000 Jan 27;267(3):906-11.
3.
Insulin-dependent interactions of proteins with GLUT4 revealed through stable isotope labeling by amino acids in cell culture (SILAC).
Foster LJ, etal., J Proteome Res. 2006 Jan;5(1):64-75.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Astrocyte growth, reactivity, and the target of the antiproliferative antibody, TAPA.
Geisert EE Jr, etal., J Neurosci 1996 Sep 1;16(17):5478-87.
6.
A novel cell adhesion molecule, G-CAM, found on cultured rat glia.
Geisert EE Jr, etal., Neurosci Lett 1991 Dec 9;133(2):262-6.
7.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
8.
The upregulation of a glial cell surface antigen at the astrocytic scar in the rat.
Irwin MH and Geisert EE Jr, Neurosci Lett 1993 May 14;154(1-2):57-60.
9.
Actinin-4 Governs Dendritic Spine Dynamics and Promotes Their Remodeling by Metabotropic Glutamate Receptors.
Kalinowska M, etal., J Biol Chem. 2015 Jun 26;290(26):15909-20. doi: 10.1074/jbc.M115.640136. Epub 2015 May 5.
10.
Mutations in ACTN4, encoding alpha-actinin-4, cause familial focal segmental glomerulosclerosis.
Kaplan JM, etal., Nat Genet. 2000 Mar;24(3):251-6.
11.
Nephrin forms a complex with adherens junction proteins and CASK in podocytes and in Madin-Darby canine kidney cells expressing nephrin.
Lehtonen S, etal., Am J Pathol. 2004 Sep;165(3):923-36.
12.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
13.
Landscape of the hnRNP K protein-protein interactome.
Mikula M, etal., Proteomics. 2006 Apr;6(8):2395-406.
14.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
15.
Identification of a multiprotein "motor" complex binding to water channel aquaporin-2.
Noda Y, etal., Biochem Biophys Res Commun. 2005 May 20;330(4):1041-7.
16.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
17.
Involvement of LMO7 in the association of two cell-cell adhesion molecules, nectin and E-cadherin, through afadin and alpha-actinin in epithelial cells.
Ooshio T, etal., J Biol Chem 2004 Jul 23;279(30):31365-73. Epub 2004 May 12.
18.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
19.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
20.
[Complex evaluation of the health status indicators of military personnel].
Poliakov LE, etal., Voen Med Zh. 1978 Nov;(11):15-20.
21.
GOA pipeline
RGD automated data pipeline
22.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
23.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
24.
Rab13 regulates neurite outgrowth in PC12 cells through its effector protein, JRAB/MICAL-L2.
Sakane A, etal., Mol Cell Biol. 2010 Feb;30(4):1077-87. doi: 10.1128/MCB.01067-09. Epub 2009 Dec 14.
25.
Proteomics profiling of nuclear proteins for kidney fibroblasts suggests hypoxia, meiosis, and cancer may meet in the nucleus.
Shakib K, etal., Proteomics. 2005 Jul;5(11):2819-38.
26.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
27.
Pdlim2, a novel PDZ-LIM domain protein, interacts with alpha-actinins and filamin A.
Torrado M, etal., Invest Ophthalmol Vis Sci 2004 Nov;45(11):3955-63.
Actn4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 93,310,294 - 93,379,369 (-) NCBI GRCr8 mRatBN7.2 1 84,182,783 - 84,251,867 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 84,182,788 - 84,251,847 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 89,592,702 - 89,661,646 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 98,051,807 - 98,120,960 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 91,348,565 - 91,417,509 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 87,078,012 - 87,147,347 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 87,078,020 - 87,147,333 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 88,258,630 - 88,327,965 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 84,000,723 - 84,073,767 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 84,079,711 - 84,151,876 (-) NCBI Celera 1 78,572,890 - 78,641,919 (-) NCBI Celera Cytogenetic Map 1 q21 NCBI
ACTN4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 38,647,649 - 38,731,589 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 38,647,649 - 38,731,589 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 39,138,289 - 39,222,229 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 43,830,167 - 43,913,010 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 43,830,166 - 43,913,010 NCBI Celera 19 35,940,352 - 36,023,163 (+) NCBI Celera Cytogenetic Map 19 q13.2 NCBI HuRef 19 35,584,836 - 35,667,954 (+) NCBI HuRef CHM1_1 19 39,139,090 - 39,221,979 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 41,451,629 - 41,535,643 (+) NCBI T2T-CHM13v2.0
Actn4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 28,592,673 - 28,661,799 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 28,592,673 - 28,661,765 (-) Ensembl GRCm39 Ensembl GRCm38 7 28,893,248 - 28,962,351 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 28,893,248 - 28,962,340 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 29,678,273 - 29,747,299 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 28,602,014 - 28,671,040 (-) NCBI MGSCv36 mm8 Celera 7 23,454,694 - 23,523,720 (-) NCBI Celera Cytogenetic Map 7 B1 NCBI cM Map 7 16.94 NCBI
Actn4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955468 770,573 - 842,209 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955468 770,573 - 841,859 (-) NCBI ChiLan1.0 ChiLan1.0
ACTN4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 44,939,775 - 45,022,391 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 46,810,115 - 46,892,741 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 35,742,758 - 35,825,321 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 44,313,569 - 44,395,508 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 44,313,569 - 44,395,508 (+) Ensembl panpan1.1 panPan2
ACTN4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 114,354,993 - 114,427,997 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 114,309,693 - 114,427,991 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 113,759,618 - 113,832,649 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 114,956,867 - 115,029,926 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 114,912,152 - 115,030,195 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 114,530,067 - 114,602,907 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 114,147,609 - 114,220,650 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 115,186,154 - 115,259,191 (-) NCBI UU_Cfam_GSD_1.0
Actn4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409349 13,167,758 - 13,237,529 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936801 1,333,077 - 1,404,054 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936801 1,333,077 - 1,402,885 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ACTN4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 47,493,919 - 47,565,998 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 47,493,834 - 47,565,999 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 43,045,503 - 43,126,155 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ACTN4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 33,290,639 - 33,373,059 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 33,290,622 - 33,374,693 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666073 11,240,578 - 11,323,802 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Actn4
.
Predicted Target Of
Count of predictions: 527 Count of miRNA genes: 237 Interacting mature miRNAs: 270 Transcripts: ENSRNOT00000027773 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
2313059 Bss55 Bone structure and strength QTL 55 3.2 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1578649 Bmd8 Bone mineral density QTL 8 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 49393172 94393172 Rat 1582234 Gluco18 Glucose level QTL 18 3.4 0.0003 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 78479925 123479925 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 1578654 Bss10 Bone structure and strength QTL 10 4 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 1 49393172 159356837 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 2302059 Pia36 Pristane induced arthritis QTL 36 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 43333002 88333002 Rat 1300121 Hrtrt1 Heart rate QTL 1 3.7 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 65789093 115540829 Rat 7421628 Bp361 Blood pressure QTL 361 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 66023617 118608521 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 631512 Scl6 Serum cholesterol level QTL 6 9.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 1 72197680 90508767 Rat 2298545 Neuinf8 Neuroinflammation QTL 8 4.6 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 1 57336763 151090257 Rat 2313072 Bss53 Bone structure and strength QTL 53 4.3 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 43284731 118944897 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313078 Bss54 Bone structure and strength QTL 54 3.5 0.0001 tibia area (VT:1000281) tibia midshaft cross-sectional area (CMO:0001717) 1 43284731 118944897 Rat 1549903 Bp267 Blood pressure QTL 267 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 77876254 106047988 Rat 2313083 Bmd74 Bone mineral density QTL 74 4 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 82174743 118944897 Rat 2313402 Anxrr24 Anxiety related response QTL 24 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 1 48963584 144267916 Rat 4889494 Scort2 Serum corticosterone level QTL 2 4.2 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 80592172 125592172 Rat 61342 Bp27 Blood pressure QTL 27 3.4 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 56732668 98773277 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 61344 Bp29 Blood pressure QTL 29 7.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 78350581 123350581 Rat 1358192 Ept13 Estrogen-induced pituitary tumorigenesis QTL 13 3.4 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 77494165 122494165 Rat 2313094 Bss58 Bone structure and strength QTL 58 3.7 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 43284731 118944897 Rat 6903308 Scl36 Serum cholesterol QTL 36 2 0.0125 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 53863041 90532583 Rat 2300164 Bmd44 Bone mineral density QTL 44 5.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 1 56949932 101949932 Rat 2313099 Bss56 Bone structure and strength QTL 56 2.4 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 1 43284731 118944897 Rat 2313098 Bmd70 Bone mineral density QTL 70 3.6 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 43284731 118944897 Rat 738022 Anxrr13 Anxiety related response QTL 13 4.6 0.00039 locomotor behavior trait (VT:0001392) number of 20 x 20 cm floor squares crossed into, out of or within a discrete space in an experimental apparatus (CMO:0001514) 1 83547917 128547917 Rat 152025249 Scl82 Serum cholesterol level QTL 82 4.77 blood cholesterol amount (VT:0000180) 1 50343510 99980958 Rat 10054135 Gmadr2 Adrenal mass QTL 2 1.97 0.0129 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 77857876 122857876 Rat 7411712 Strs4 Sensitivity to stroke QTL 4 8.7 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 1 78430536 123430536 Rat 2313051 Bss57 Bone structure and strength QTL 57 3.7 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 43284731 118944897 Rat 61433 Cia2 Collagen induced arthritis QTL 2 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 78430754 91209302 Rat
BM385106
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 84,207,270 - 84,207,455 (+) MAPPER mRatBN7.2 Rnor_6.0 1 87,102,767 - 87,102,951 NCBI Rnor6.0 Rnor_5.0 1 88,283,385 - 88,283,569 UniSTS Rnor5.0 RGSC_v3.4 1 84,025,209 - 84,025,393 UniSTS RGSC3.4 Celera 1 78,597,399 - 78,597,583 UniSTS RH 3.4 Map 1 824.7 UniSTS Cytogenetic Map 1 q22 UniSTS
RH130124
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 84,182,829 - 84,183,027 (+) MAPPER mRatBN7.2 Rnor_6.0 1 87,078,059 - 87,078,256 NCBI Rnor6.0 Rnor_5.0 1 88,258,677 - 88,258,874 UniSTS Rnor5.0 RGSC_v3.4 1 84,000,770 - 84,000,967 UniSTS RGSC3.4 Celera 1 78,572,937 - 78,573,134 UniSTS RH 3.4 Map 1 829.8 UniSTS Cytogenetic Map 1 q22 UniSTS Cytogenetic Map 1 q21 UniSTS
MARC_12245-12246:1008698037:1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 84,201,188 - 84,201,994 (+) MAPPER mRatBN7.2 Rnor_6.0 1 87,096,545 - 87,097,350 NCBI Rnor6.0 Rnor_5.0 1 88,277,163 - 88,277,968 UniSTS Rnor5.0 RGSC_v3.4 1 84,019,127 - 84,019,932 UniSTS RGSC3.4 Celera 1 78,591,317 - 78,592,122 UniSTS Cytogenetic Map 1 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000027773 ⟹ ENSRNOP00000027773
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 84,182,793 - 84,251,800 (-) Ensembl Rnor_6.0 Ensembl 1 87,078,020 - 87,147,308 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000089305 ⟹ ENSRNOP00000071262
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 84,183,178 - 84,251,847 (-) Ensembl Rnor_6.0 Ensembl 1 87,078,890 - 87,147,308 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000090402 ⟹ ENSRNOP00000073566
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 84,182,788 - 84,208,505 (-) Ensembl Rnor_6.0 Ensembl 1 87,078,847 - 87,147,333 (-) Ensembl
RefSeq Acc Id:
NM_031675 ⟹ NP_113863
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 93,310,294 - 93,379,320 (-) NCBI mRatBN7.2 1 84,182,783 - 84,251,818 (-) NCBI Rnor_6.0 1 87,078,012 - 87,147,308 (-) NCBI Rnor_5.0 1 88,258,630 - 88,327,965 (-) NCBI RGSC_v3.4 1 84,000,723 - 84,073,767 (-) RGD Celera 1 78,572,890 - 78,641,919 (-) RGD
Sequence:
TTGGGCGGGCTGAAAGCAGCTGAAGCGGCGGCCGAGTCGTAGGCTCCGACATAGGGGCGGGAGCTGAGCGGTAGCGGACCGGCTGGCGGGCTAGCGAAAGGCGGCGGGATGGTGGACTATCACGCGGC
hide sequence
RefSeq Acc Id:
XM_006228687 ⟹ XP_006228749
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 93,310,294 - 93,379,359 (-) NCBI mRatBN7.2 1 84,182,783 - 84,251,857 (-) NCBI Rnor_6.0 1 87,078,420 - 87,147,347 (-) NCBI Rnor_5.0 1 88,258,630 - 88,327,965 (-) NCBI
Sequence:
GTGCGCAGGCGCGGCGAGTGAACTGCGCAGGCGTCAGTCTTGGGCGGGCTGAAAGCAGCTGAAG
hide sequence
RefSeq Acc Id:
XM_006228688 ⟹ XP_006228750
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 93,310,294 - 93,379,369 (-) NCBI mRatBN7.2 1 84,182,783 - 84,251,867 (-) NCBI Rnor_6.0 1 87,079,046 - 87,147,347 (-) NCBI Rnor_5.0 1 88,258,630 - 88,327,965 (-) NCBI
Sequence:
GTGCGCAGGCGCGGCGAGTGAACTGCGCAGGCGTCAGTCTTGGGCGGGCTGAAAGCAGCTGAAGCGGCGGCCGAGTCGTAGGCTCCGACATAGGGGCGGGAGCTGAGCGGTAGCGGACCGGCTGGCGG
hide sequence
RefSeq Acc Id:
XM_006228689 ⟹ XP_006228751
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 93,310,294 - 93,379,359 (-) NCBI mRatBN7.2 1 84,182,783 - 84,251,857 (-) NCBI Rnor_6.0 1 87,079,046 - 87,147,200 (-) NCBI Rnor_5.0 1 88,258,630 - 88,327,965 (-) NCBI
Sequence:
ATGGTGGACTATCACGCGGCGAACCAGGCGTACCAGTACGGCCCAAGCAGCGGCGGCAATGGCA
hide sequence
RefSeq Acc Id:
XM_008759185 ⟹ XP_008757407
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 93,310,294 - 93,379,359 (-) NCBI mRatBN7.2 1 84,182,783 - 84,251,867 (-) NCBI Rnor_6.0 1 87,078,012 - 87,147,347 (-) NCBI
Sequence:
GTGCGCAGGCGCGGCGAGTGAACTGCGCAGGCGTCAGTCTTGGGCGGGCTGAAAGCAGCTGAAGCGGCGGCCGAGTCGTAGGCTCCGACATAGGGGCGGGAGCTGAGCGGTAGCGGACCGGCTGGCGG
hide sequence
RefSeq Acc Id:
NP_113863 ⟸ NM_031675
- UniProtKB:
Q6P786 (UniProtKB/Swiss-Prot), Q9QXQ0 (UniProtKB/Swiss-Prot), A6J9M1 (UniProtKB/TrEMBL), A0A8L2UKD4 (UniProtKB/TrEMBL)
- Sequence:
MVDYHAANQAYQYGPSSGGNGTGGGGGMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVS
hide sequence
RefSeq Acc Id:
XP_006228751 ⟸ XM_006228689
- Peptide Label:
isoform X3
- UniProtKB:
A0A8L2UKD4 (UniProtKB/TrEMBL)
- Sequence:
MVDYHAANQAYQYGPSSGGNGTGGGGGMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWCNSHL
hide sequence
RefSeq Acc Id:
XP_006228749 ⟸ XM_006228687
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2UKD4 (UniProtKB/TrEMBL)
- Sequence:
MVDYHAANQAYQYGPSSGGNGTGGGGGMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVS
hide sequence
RefSeq Acc Id:
XP_006228750 ⟸ XM_006228688
- Peptide Label:
isoform X2
- UniProtKB:
A0A0G2K013 (UniProtKB/TrEMBL), A0A8L2UKD4 (UniProtKB/TrEMBL)
- Sequence:
MVDYHAANQAYQYGPSSGGNGTGGGGGMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWCNSHL
hide sequence
RefSeq Acc Id:
XP_008757407 ⟸ XM_008759185
- Peptide Label:
isoform X4
- UniProtKB:
A0A8L2UKD4 (UniProtKB/TrEMBL)
- Sequence:
MVDYHAANQAYQYGPSSGGNGTGGGGGMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIASKGVKLVS
hide sequence
Ensembl Acc Id:
ENSRNOP00000071262 ⟸ ENSRNOT00000089305
Ensembl Acc Id:
ENSRNOP00000073566 ⟸ ENSRNOT00000090402
Ensembl Acc Id:
ENSRNOP00000027773 ⟸ ENSRNOT00000027773
RGD ID: 13689891 Promoter ID: EPDNEW_R414 Type: initiation region Name: Actn4_1 Description: actinin alpha 4 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 87,147,312 - 87,147,372 EPDNEW
BioCyc Gene G2FUF-60206 BioCyc
Ensembl Genes ENSRNOG00000020433 Ensembl, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000027773.8 UniProtKB/TrEMBL
ENSRNOT00000089305.2 UniProtKB/TrEMBL
ENSRNOT00000090402.2 UniProtKB/TrEMBL
Gene3D-CATH 1.10.418.10 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
1.20.58.60 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
EF-hand UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE IMAGE:5623735 IMAGE-MGC_LOAD
InterPro Actinin_actin-bd_CS UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
CH-domain UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
CH_dom_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
EF-hand-dom_pair UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
EF-hand_Ca_insen UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
EF_Hand_1_Ca_BS UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
EF_hand_dom UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Spectrin/alpha-actinin UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Spectrin_repeat UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:63836 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE MGC:72395 IMAGE-MGC_LOAD
NCBI Gene 63836 ENTREZGENE
PANTHER SPECTRIN/FILAMIN RELATED CYTOSKELETAL PROTEIN UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam EF-hand_7 UniProtKB/TrEMBL
EF-hand_8 UniProtKB/TrEMBL
EFhand_Ca_insen UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PF00307 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Spectrin UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Actn4 PhenoGen
PROSITE ACTININ_1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
ACTININ_2 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
EF_HAND_1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
EF_HAND_2 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PS50021 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx ENSRNOG00000020433 RatGTEx
SMART EFh UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
efhand_Ca_insen UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SM00033 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SPEC UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP Spectrin repeat UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SSF47473 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SSF47576 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt A0A0G2K013 ENTREZGENE, UniProtKB/TrEMBL
A0A0G2K5U9_RAT UniProtKB/TrEMBL
A0A8L2UKD4 ENTREZGENE, UniProtKB/TrEMBL
A6J9M1 ENTREZGENE, UniProtKB/TrEMBL
ACTN4_RAT UniProtKB/Swiss-Prot
Q6P786 ENTREZGENE
Q9QXQ0 ENTREZGENE
UniProt Secondary Q6P786 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Actn4
actinin alpha 4
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_physical_interaction
binds to BERP (a novel RING finger protein belonging to the RBCC protein family), may colocalized in the cytoplasm
61532
