Symbol:
Iqce
Name:
IQ motif containing E
RGD ID:
1311349
Description:
Predicted to be involved in several processes, including positive regulation of transcription by RNA polymerase II; protein localization to motile cilium; and regulation of smoothened signaling pathway. Predicted to be located in ciliary membrane and cytoplasmic side of plasma membrane. Predicted to be part of plasma membrane protein complex. Orthologous to human IQCE (IQ motif containing E); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 3,3',5,5'-tetrabromobisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
IQ domain-containing protein E; LOC304318; RGD1311349; similar to RIKEN cDNA 1700028P05
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 19,057,060 - 19,096,626 (+) NCBI GRCr8 mRatBN7.2 12 13,943,290 - 13,982,708 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 13,943,487 - 13,982,693 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 12 16,030,607 - 16,069,872 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 15,857,805 - 16,067,924 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 18,028,202 - 18,067,110 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 14,414,172 - 14,451,362 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 14,442,250 - 14,468,742 (+) NCBI Celera 12 15,703,595 - 15,742,833 (+) NCBI Celera Cytogenetic Map 12 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Iqce Rat 1,2-dimethylhydrazine multiple interactions ISO Iqce (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of IQCE mRNA CTD PMID:22206623 Iqce Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Iqce (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of IQCE mRNA CTD PMID:21570461 Iqce Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of IQCE mRNA CTD PMID:21724226 Iqce Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:21724226 Iqce Rat 3,3',5,5'-tetrabromobisphenol A decreases expression EXP 6480464 tetrabromobisphenol A results in decreased expression of IQCE mRNA CTD PMID:27914987 Iqce Rat 4,4'-sulfonyldiphenol decreases expression ISO Iqce (Mus musculus) 6480464 bisphenol S results in decreased expression of IQCE mRNA CTD PMID:39298647 Iqce Rat 4,4'-sulfonyldiphenol decreases methylation ISO IQCE (Homo sapiens) 6480464 bisphenol S results in decreased methylation of IQCE gene CTD PMID:31601247 Iqce Rat Aflatoxin B2 alpha decreases methylation ISO IQCE (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of IQCE intron CTD PMID:30157460 Iqce Rat all-trans-retinoic acid decreases expression ISO IQCE (Homo sapiens) 6480464 Tretinoin results in decreased expression of IQCE mRNA CTD PMID:23724009 Iqce Rat aristolochic acid A increases expression ISO IQCE (Homo sapiens) 6480464 aristolochic acid I results in increased expression of IQCE mRNA CTD PMID:33212167 Iqce Rat arsane affects methylation ISO IQCE (Homo sapiens) 6480464 Arsenic affects the methylation of IQCE gene CTD PMID:25304211 Iqce Rat arsane multiple interactions ISO IQCE (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of IQCE mRNA CTD PMID:39836092 Iqce Rat arsenic atom affects methylation ISO IQCE (Homo sapiens) 6480464 Arsenic affects the methylation of IQCE gene CTD PMID:25304211 Iqce Rat arsenic atom multiple interactions ISO IQCE (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of IQCE mRNA CTD PMID:39836092 Iqce Rat benzo[a]pyrene decreases expression ISO IQCE (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of IQCE mRNA CTD PMID:26238291 Iqce Rat benzo[a]pyrene decreases methylation ISO Iqce (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of IQCE exon and Benzo(a)pyrene results in decreased methylation of IQCE intron CTD PMID:27901495 Iqce Rat benzo[a]pyrene affects methylation ISO IQCE (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of IQCE intron and Benzo(a)pyrene affects the methylation of IQCE promoter CTD PMID:27901495 and PMID:30157460 Iqce Rat benzo[a]pyrene increases methylation ISO IQCE (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of IQCE 3' UTR CTD PMID:27901495 Iqce Rat benzo[e]pyrene decreases methylation ISO IQCE (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of IQCE intron CTD PMID:30157460 Iqce Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of IQCE mRNA CTD PMID:25181051 and PMID:34947998 Iqce Rat bisphenol A decreases methylation ISO IQCE (Homo sapiens) 6480464 bisphenol A results in decreased methylation of IQCE gene CTD PMID:31601247 Iqce Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of IQCE mRNA CTD PMID:30816183 Iqce Rat clofibrate decreases expression ISO Iqce (Mus musculus) 6480464 Clofibrate results in decreased expression of IQCE mRNA CTD PMID:23811191 Iqce Rat crocidolite asbestos increases expression ISO Iqce (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of IQCE mRNA CTD PMID:19446018 Iqce Rat dicrotophos increases expression ISO IQCE (Homo sapiens) 6480464 dicrotophos results in increased expression of IQCE mRNA CTD PMID:28302478 Iqce Rat dorsomorphin multiple interactions ISO IQCE (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of IQCE mRNA CTD PMID:27188386 Iqce Rat doxorubicin decreases expression ISO IQCE (Homo sapiens) 6480464 Doxorubicin results in decreased expression of IQCE mRNA CTD PMID:29803840 Iqce Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of IQCE mRNA CTD PMID:29391264 Iqce Rat epoxiconazole increases expression ISO Iqce (Mus musculus) 6480464 epoxiconazole results in increased expression of IQCE mRNA CTD PMID:35436446 Iqce Rat ethanol affects splicing ISO Iqce (Mus musculus) 6480464 Ethanol affects the splicing of IQCE mRNA CTD PMID:30319688 Iqce Rat folic acid multiple interactions ISO Iqce (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of IQCE mRNA CTD PMID:22206623 Iqce Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of IQCE mRNA CTD PMID:33387578 Iqce Rat mercury dibromide decreases expression ISO IQCE (Homo sapiens) 6480464 mercuric bromide results in decreased expression of IQCE mRNA CTD PMID:26272509 Iqce Rat mercury dibromide multiple interactions ISO IQCE (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of IQCE mRNA CTD PMID:27188386 Iqce Rat methapyrilene decreases methylation ISO IQCE (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of IQCE intron CTD PMID:30157460 Iqce Rat methyl methanesulfonate increases expression ISO IQCE (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of IQCE mRNA CTD PMID:23649840 Iqce Rat methylmercury chloride decreases expression ISO IQCE (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of IQCE mRNA CTD PMID:28001369 Iqce Rat ozone multiple interactions ISO IQCE (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of IQCE mRNA CTD PMID:35430440 Iqce Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of IQCE mRNA CTD PMID:33387578 Iqce Rat SB 431542 multiple interactions ISO IQCE (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of IQCE mRNA CTD PMID:27188386 Iqce Rat serpentine asbestos decreases methylation ISO IQCE (Homo sapiens) 6480464 Asbestos and Serpentine results in decreased methylation of IQCE gene CTD PMID:29523930 Iqce Rat silicon dioxide increases expression ISO IQCE (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of IQCE mRNA CTD PMID:25895662 Iqce Rat sodium arsenite multiple interactions ISO IQCE (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of IQCE mRNA CTD PMID:39836092 Iqce Rat tetrachloromethane decreases expression ISO Iqce (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of IQCE mRNA CTD PMID:25270620 Iqce Rat tetraphene increases expression ISO Iqce (Mus musculus) 6480464 benz(a)anthracene results in increased expression of IQCE mRNA CTD PMID:26377693 Iqce Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of IQCE mRNA CTD PMID:34492290 Iqce Rat titanium dioxide decreases methylation ISO Iqce (Mus musculus) 6480464 titanium dioxide results in decreased methylation of IQCE gene CTD PMID:35295148 Iqce Rat triphenyl phosphate affects expression ISO IQCE (Homo sapiens) 6480464 triphenyl phosphate affects the expression of IQCE mRNA CTD PMID:37042841 Iqce Rat valproic acid increases methylation ISO IQCE (Homo sapiens) 6480464 Valproic Acid results in increased methylation of IQCE gene CTD PMID:29154799 Iqce Rat valproic acid increases expression ISO IQCE (Homo sapiens) 6480464 Valproic Acid results in increased expression of IQCE mRNA CTD PMID:23179753 and PMID:27188386 Iqce Rat valproic acid affects expression ISO IQCE (Homo sapiens) 6480464 Valproic Acid affects the expression of IQCE mRNA CTD PMID:25979313 Iqce Rat zinc atom decreases expression ISO IQCE (Homo sapiens) 6480464 Zinc results in decreased expression of IQCE mRNA CTD PMID:19071009 Iqce Rat zinc(0) decreases expression ISO IQCE (Homo sapiens) 6480464 Zinc results in decreased expression of IQCE mRNA CTD PMID:19071009
1,2-dimethylhydrazine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 3,3',5,5'-tetrabromobisphenol A (EXP) 4,4'-sulfonyldiphenol (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) clofibrate (ISO) crocidolite asbestos (ISO) dicrotophos (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) epoxiconazole (ISO) ethanol (ISO) folic acid (ISO) gentamycin (EXP) mercury dibromide (ISO) methapyrilene (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) ozone (ISO) paracetamol (EXP) SB 431542 (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) sodium arsenite (ISO) tetrachloromethane (ISO) tetraphene (ISO) thioacetamide (EXP) titanium dioxide (ISO) triphenyl phosphate (ISO) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO)
Iqce Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 19,057,060 - 19,096,626 (+) NCBI GRCr8 mRatBN7.2 12 13,943,290 - 13,982,708 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 13,943,487 - 13,982,693 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 12 16,030,607 - 16,069,872 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 15,857,805 - 16,067,924 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 18,028,202 - 18,067,110 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 14,414,172 - 14,451,362 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 14,442,250 - 14,468,742 (+) NCBI Celera 12 15,703,595 - 15,742,833 (+) NCBI Celera Cytogenetic Map 12 q11 NCBI
IQCE Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 2,558,979 - 2,614,728 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 2,558,972 - 2,614,733 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 2,598,613 - 2,654,362 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 2,565,158 - 2,620,894 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 2,371,872 - 2,423,779 NCBI Celera 7 2,567,993 - 2,623,218 (+) NCBI Celera Cytogenetic Map 7 p22.3 NCBI HuRef 7 2,517,599 - 2,572,724 (+) NCBI HuRef CHM1_1 7 2,598,231 - 2,653,765 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 2,672,578 - 2,728,247 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 2,646,544 - 2,702,212 (+) NCBI
Iqce Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 140,648,308 - 140,688,158 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 140,647,582 - 140,688,133 (-) Ensembl GRCm39 Ensembl GRCm38 5 140,662,553 - 140,702,403 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 140,661,827 - 140,702,378 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 141,139,459 - 141,178,332 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 140,915,979 - 140,954,852 (-) NCBI MGSCv36 mm8 Celera 5 137,723,918 - 137,762,791 (-) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 79.2 NCBI
Iqce Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955460 12,676,649 - 12,724,613 (+) NCBI ChiLan1.0 ChiLan1.0
IQCE Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 7,515,101 - 7,571,172 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 55,839,800 - 55,895,872 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 2,818,723 - 2,874,505 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 2,913,345 - 2,968,619 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 2,913,549 - 2,964,046 (+) Ensembl panpan1.1 panPan2
IQCE Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 14,538,693 - 14,579,095 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 14,532,181 - 14,577,435 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 15,995,640 - 16,041,843 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 14,659,001 - 14,705,205 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 6 14,462,989 - 14,509,190 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 14,391,420 - 14,437,616 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 14,677,263 - 14,723,464 (+) NCBI UU_Cfam_GSD_1.0
Iqce
IQCE Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 1,861,204 - 1,903,035 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 1,861,487 - 1,903,107 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 2,124,748 - 2,168,376 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
IQCE Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 28 18,963,871 - 19,014,509 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 28 18,963,944 - 19,019,009 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666090 2,752,561 - 2,807,874 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Iqce
.
Predicted Target Of
Count of predictions: 177 Count of miRNA genes: 100 Interacting mature miRNAs: 102 Transcripts: ENSRNOT00000001667, ENSRNOT00000051565 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
2312418 Kidm41 Kidney mass QTL 41 3.7 0.0001 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 12 1 19611090 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 61331 Eau2 Experimental allergic uveoretinitis QTL 2 0.0005 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 12 8525423 28064601 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 1331786 Kidm11 Kidney mass QTL 11 3.571 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 12 11073825 24234895 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 1600391 Edcs2 Endometrial carcinoma susceptibility QTL2 3.5 0.01 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 12 6833190 17870186 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 61416 Pia4 Pristane induced arthritis QTL 4 8.4 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 12 13635523 30827399 Rat 7204484 Bp358 Blood pressure QTL 358 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 13008296 19212979 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 61421 Cia12 Collagen induced arthritis QTL 12 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 13635523 35682913 Rat 1300157 Rf21 Renal function QTL 21 4.4 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 12 9318216 32103380 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2293086 Iddm30 Insulin dependent diabetes mellitus QTL 30 3.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 8449490 28302290 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1331755 Bp219 Blood pressure QTL 219 3.041 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 28064557 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001667 ⟹ ENSRNOP00000001667
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 13,943,487 - 13,982,693 (+) Ensembl Rnor_6.0 Ensembl 12 15,857,805 - 16,067,921 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000051565 ⟹ ENSRNOP00000040350
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 13,943,487 - 13,982,693 (+) Ensembl Rnor_6.0 Ensembl 12 16,030,788 - 16,067,924 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000117335 ⟹ ENSRNOP00000094917
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 13,943,487 - 13,982,693 (+) Ensembl
RefSeq Acc Id:
XM_006248962 ⟹ XP_006249024
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,057,060 - 19,096,626 (+) NCBI mRatBN7.2 12 13,943,296 - 13,982,708 (+) NCBI Rnor_6.0 12 16,030,607 - 16,069,872 (+) NCBI Rnor_5.0 12 18,028,202 - 18,067,110 (+) NCBI
Sequence:
TGGTTGGCCCCTCGCTCGTGCACACACTGCGCGTGCACAGGATTCGCCGGGCATCGGAGGAAGGACCACATCCGGGGCCCTGTGGCCGCGGCACGGTTGCCATGGTACCAGGTTGGCTGGCAGGCCTC
hide sequence
RefSeq Acc Id:
XM_017598488 ⟹ XP_017453977
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,057,060 - 19,096,626 (+) NCBI mRatBN7.2 12 13,943,290 - 13,982,708 (+) NCBI Rnor_6.0 12 16,030,607 - 16,069,872 (+) NCBI
Sequence:
TGGTTGGCCCCTCGCTCGTGCACACACTGCGCGTGCACAGGATTCGCCGGGCATCGGAGGAAGGACCACATCCGGGGCCCTGTGGCCGCGGCACGGTTGCCATGGTACCAGGTTGGCTGGCAGGCCTC
hide sequence
RefSeq Acc Id:
XM_017598489 ⟹ XP_017453978
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,057,060 - 19,096,626 (+) NCBI mRatBN7.2 12 13,943,293 - 13,982,708 (+) NCBI Rnor_6.0 12 16,030,607 - 16,069,872 (+) NCBI
Sequence:
TGGTTGGCCCCTCGCTCGTGCACACACTGCGCGTGCACAGGATTCGCCGGGCATCGGAGGAAGGACCACATCCGGGGCCCTGTGGCCGCGGCACGGTTGCCATGGTACCAGGTTGGCTGGCAGGCCTC
hide sequence
RefSeq Acc Id:
XM_017598490 ⟹ XP_017453979
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,057,060 - 19,096,626 (+) NCBI mRatBN7.2 12 13,943,291 - 13,982,708 (+) NCBI Rnor_6.0 12 16,030,607 - 16,069,872 (+) NCBI
Sequence:
TGGTTGGCCCCTCGCTCGTGCACACACTGCGCGTGCACAGGATTCGCCGGGCATCGGAGGAAGGACCACATCCGGGGCCCTGTGGCCGCGGCACGGTTGCCATGGTACCAGGTTGGCTGGCAGGCCTC
hide sequence
RefSeq Acc Id:
XM_017598491 ⟹ XP_017453980
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,057,060 - 19,096,626 (+) NCBI mRatBN7.2 12 13,943,305 - 13,982,708 (+) NCBI Rnor_6.0 12 16,030,609 - 16,069,872 (+) NCBI
Sequence:
GTTGGCCCCTCGCTCGTGCACACACTGCGCGTGCACAGGATTCGCCGGGCATCGGAGGAAGGAC
hide sequence
RefSeq Acc Id:
XM_017598492 ⟹ XP_017453981
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,057,644 - 19,096,626 (+) NCBI mRatBN7.2 12 13,943,708 - 13,982,708 (+) NCBI Rnor_6.0 12 16,030,830 - 16,069,872 (+) NCBI
Sequence:
AGGCCTAGGGCAGAGGGAGGAAGGGCGCACGGTGGTAGCCAGCTCCGGCAGGCCGATTGTTACC
hide sequence
RefSeq Acc Id:
XM_017598493 ⟹ XP_017453982
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,065,784 - 19,096,626 (+) NCBI mRatBN7.2 12 13,951,865 - 13,982,708 (+) NCBI Rnor_6.0 12 16,038,927 - 16,069,872 (+) NCBI
Sequence:
TTTTTTTTCTGGCTTTATGCACGAGATCCATCATTAGGACATTCTAGAATGTTCTGAGTGATTCATAAAGAGTGTCATAGACAAGCCATTGTGTCATATCATACACCACCGCCCCCCAACTAGAATTA
hide sequence
RefSeq Acc Id:
XM_017598494 ⟹ XP_017453983
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,065,648 - 19,096,626 (+) NCBI mRatBN7.2 12 13,951,724 - 13,982,708 (+) NCBI Rnor_6.0 12 16,038,862 - 16,069,872 (+) NCBI
Sequence:
CATGCTCCCGGGGACAAGGCCAGGAGAGCAGAGAGGAAAGCCTCTAGTAATTGAGGGGTCACGTCTCTGGGACTTCTGTCTACAGAGAGAAAGAGGACATGTACGATGAGATCATCGAGTTGAAGAAG
hide sequence
RefSeq Acc Id:
XM_039089960 ⟹ XP_038945888
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,057,060 - 19,096,626 (+) NCBI mRatBN7.2 12 13,943,574 - 13,980,752 (+) NCBI
RefSeq Acc Id:
XM_039089961 ⟹ XP_038945889
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,057,060 - 19,090,248 (+) NCBI mRatBN7.2 12 13,943,292 - 13,976,322 (+) NCBI
RefSeq Acc Id:
XM_063271863 ⟹ XP_063127933
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,057,060 - 19,096,626 (+) NCBI
RefSeq Acc Id:
XM_063271864 ⟹ XP_063127934
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,057,060 - 19,096,626 (+) NCBI
RefSeq Acc Id:
XM_063271865 ⟹ XP_063127935
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,057,060 - 19,096,626 (+) NCBI
RefSeq Acc Id:
XM_063271866 ⟹ XP_063127936
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,057,060 - 19,096,626 (+) NCBI
RefSeq Acc Id:
XM_063271867 ⟹ XP_063127937
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,057,060 - 19,096,626 (+) NCBI
RefSeq Acc Id:
XM_063271868 ⟹ XP_063127938
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,065,786 - 19,096,626 (+) NCBI
RefSeq Acc Id:
XM_063271869 ⟹ XP_063127939
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,065,786 - 19,096,626 (+) NCBI
RefSeq Acc Id:
XM_063271870 ⟹ XP_063127940
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,057,060 - 19,090,248 (+) NCBI
RefSeq Acc Id:
XM_063271871 ⟹ XP_063127941
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,065,786 - 19,096,626 (+) NCBI
RefSeq Acc Id:
XM_063271872 ⟹ XP_063127942
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,065,781 - 19,090,248 (+) NCBI
RefSeq Acc Id:
XM_221965 ⟹ XP_221965
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 19,057,060 - 19,096,626 (+) NCBI mRatBN7.2 12 13,943,299 - 13,982,708 (+) NCBI Rnor_6.0 12 16,030,607 - 16,067,924 (+) NCBI Rnor_5.0 12 18,028,202 - 18,067,110 (+) NCBI RGSC_v3.4 12 14,414,172 - 14,451,362 (+) RGD
Sequence:
TGGTTGGCCCCTCGCTCGTGCACACACTGCGCGTGCACAGGATTCGCCGGGCATCGGAGGAAGGACCACATCCGGGGCCCTGTGGCCGCGGCACGGTTGCCATGGTACCAGGTTGGCTGGCAGGCCTC
hide sequence
RefSeq Acc Id:
XP_221965 ⟸ XM_221965
- Peptide Label:
isoform X6
- UniProtKB:
D4ADQ3 (UniProtKB/TrEMBL)
- Sequence:
MSLGTTDLTSETGDDSLSAISFDSDVESKTKRKPLHKPPSTSPKSPYYSKPKKVTSWRSLKTAGSMPLSSRMSLTPQKLWLGTSKQGSVTQPLSSLLTTEHTWTHPPSCTPGYLTEAVRAKRADLRRS
hide sequence
RefSeq Acc Id:
XP_006249024 ⟸ XM_006248962
- Peptide Label:
isoform X2
- Sequence:
MSLGTTDLTSETGDDSLSAISFDSDVESKTKRKPLHKPPSTSPKSPYYSKPKKVTSWRSLKTAG
hide sequence
RefSeq Acc Id:
XP_017453977 ⟸ XM_017598488
- Peptide Label:
isoform X1
- Sequence:
MSLGTTDLTSETGDDSLSAISFDSDVESKTKRKPLHKPPSTSPKSPYYSKPKKVTSWRSLKTAGSMPLSSRMSLTPQKLWLGTSKQGSVTQPLSSLLTTEHTWTHPPSCTPGYLTEAVRAKRADLRRS
hide sequence
RefSeq Acc Id:
XP_017453978 ⟸ XM_017598489
- Peptide Label:
isoform X3
- Sequence:
MSLGTTDLTSETGDDSLSAISFDSDVESKTKRKPLHKPPSTSPKSPYYSKPKKVTSWRSLKTAG
hide sequence
RefSeq Acc Id:
XP_017453979 ⟸ XM_017598490
- Peptide Label:
isoform X5
- Sequence:
MSLGTTDLTSETGDDSLSAISFDSDVESKTKRKPLHKPPSTSPKSPYYSKPKKVTSWRSLKTAGSMPLSSRMSLTPQKLWLGTSKQGSVTQPLSSLLTTEHTWTHPPSCTPGYLTEAVRAKRADLRRS
hide sequence
RefSeq Acc Id:
XP_017453980 ⟸ XM_017598491
- Peptide Label:
isoform X7
- Sequence:
MSLGTTDLTSETGDDSLSAISFDSDVESKTKRKPLHKPPSTSPKSPYYSKPKKVTSWRSLKTAG
hide sequence
RefSeq Acc Id:
XP_017453981 ⟸ XM_017598492
- Peptide Label:
isoform X11
- Sequence:
MPLSSRMSLTPQKLWLGTSKQGSVTQPLSSLLTTEHTWTHPPSCTPGYLTEAVRAKRADLRRSSSHGHVSGTSVYREKEDMYDEIIELKKSLHMQKSDVDLMRTKLRRLEEENSRKDRQIEQLLDPGR
hide sequence
RefSeq Acc Id:
XP_017453983 ⟸ XM_017598494
- Peptide Label:
isoform X19
- Sequence:
MYDEIIELKKSLHMQKSDVDLMRTKLRRLEEENSRKDRQIEQLLDPGRGPDFVRTLAEKKPDTGWVITGLKQRIFRLEQQCKEKDSTINKLQTDMKTTNLEEMRIAMETYYEEIHRLQTLLASSEATG
hide sequence
RefSeq Acc Id:
XP_017453982 ⟸ XM_017598493
- Peptide Label:
isoform X14
- Sequence:
MLCVLWDTYGGHVSGTSVYREKEDMYDEIIELKKSLHMQKSDVDLMRTKLRRLEEENSRKDRQI
hide sequence
Ensembl Acc Id:
ENSRNOP00000040350 ⟸ ENSRNOT00000051565
Ensembl Acc Id:
ENSRNOP00000001667 ⟸ ENSRNOT00000001667
RefSeq Acc Id:
XP_038945889 ⟸ XM_039089961
- Peptide Label:
isoform X17
RefSeq Acc Id:
XP_038945888 ⟸ XM_039089960
- Peptide Label:
isoform X10
Ensembl Acc Id:
ENSRNOP00000094917 ⟸ ENSRNOT00000117335
RefSeq Acc Id:
XP_063127933 ⟸ XM_063271863
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_063127935 ⟸ XM_063271865
- Peptide Label:
isoform X9
RefSeq Acc Id:
XP_063127936 ⟸ XM_063271866
- Peptide Label:
isoform X12
RefSeq Acc Id:
XP_063127934 ⟸ XM_063271864
- Peptide Label:
isoform X8
RefSeq Acc Id:
XP_063127937 ⟸ XM_063271867
- Peptide Label:
isoform X13
RefSeq Acc Id:
XP_063127940 ⟸ XM_063271870
- Peptide Label:
isoform X18
RefSeq Acc Id:
XP_063127942 ⟸ XM_063271872
- Peptide Label:
isoform X21
RefSeq Acc Id:
XP_063127938 ⟸ XM_063271868
- Peptide Label:
isoform X15
RefSeq Acc Id:
XP_063127939 ⟸ XM_063271869
- Peptide Label:
isoform X16
RefSeq Acc Id:
XP_063127941 ⟸ XM_063271871
- Peptide Label:
isoform X20
RGD ID: 13698460 Promoter ID: EPDNEW_R8977 Type: initiation region Name: Iqce_1 Description: IQ motif containing E SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 16,030,728 - 16,030,788 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Iqce
IQ motif containing E
Iqce_predicted
IQ motif containing E (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Iqce_predicted
IQ motif containing E (predicted)
RGD1311349_predicted
similar to RIKEN cDNA 1700028P05 (predicted)
Symbol and Name updated
1299863 APPROVED
2005-01-20
RGD1311349_predicted
similar to RIKEN cDNA 1700028P05 (predicted)
LOC304318_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC304318_predicted
similar to RIKEN cDNA 1700028P05 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
