Advanced Search (OLGA)

Gene: Supt4h1 (SPT4 homolog, DSIF elongation factor subunit) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Supt4h1

Name:

SPT4 homolog, DSIF elongation factor subunit

RGD ID:

1306372

Description:

Predicted to enable RNA polymerase II complex binding activity and protein heterodimerization activity. Predicted to be involved in regulation of DNA-templated transcription and transcription elongation by RNA polymerase II. Predicted to act upstream of or within negative regulation of transcription elongation by RNA polymerase II. Predicted to be located in nucleoplasm. Predicted to be part of DSIF complex. Orthologous to human SUPT4H1 (SPT4 homolog, DSIF elongation factor subunit); PARTICIPATES IN RNA polymerase I transcription pathway; RNA polymerase II transcription elongation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; amphetamine; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC287608; MGC188814; suppressor of Ty 4 homolog 1; suppressor of Ty 4 homolog 1 (S. cerevisiae); suppressor of Ty 4 homolog 2; suppressor of Ty 4 homolog 2 (S. cerevisiae); Supt4h2; transcription elongation factor SPT4

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	73,036,560 - 73,042,821 (+)	NCBI		GRCr8
mRatBN7.2	10	72,539,323 - 72,545,582 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	72,539,382 - 72,545,831 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	77,149,795 - 77,156,042 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	76,654,742 - 76,660,989 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	72,119,248 - 72,125,495 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	75,032,365 - 75,038,547 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	75,032,365 - 75,038,547 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	75,063,841 - 75,070,023 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	76,030,806 - 76,036,988 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	76,045,182 - 76,051,065 (+)	NCBI
Celera	10	71,452,699 - 71,458,881 (+)	NCBI		Celera
Cytogenetic Map	10	q26	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Supt4h1	Rat	hereditary breast ovarian cancer syndrome		ISO	RGD:1314951	8554872	ClinVar Annotator: match by term: Hereditary breast ovarian cancer syndrome	ClinVar	PMID:38922859
Supt4h1	Rat	intellectual disability		ISO	RGD:1314951	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar	PMID:25741868\|PMID:37071997
Supt4h1	Rat	Joubert syndrome 1		ISO	RGD:1314951	8554872	ClinVar Annotator: match by term: Familial aplasia of the vermis	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Supt4h1	Rat	(S)-nicotine	decreases expression	ISO	RGD:1314951	6480464	Nicotine results in decreased expression of SUPT4H1 mRNA	CTD	PMID:18247414
Supt4h1	Rat	1,2-dimethylhydrazine	decreases expression	ISO	RGD:1623282	6480464	1,2-Dimethylhydrazine results in decreased expression of SUPT4A mRNA	CTD	PMID:22206623
Supt4h1	Rat	17alpha-ethynylestradiol	affects expression	ISO	RGD:1623282	6480464	Ethinyl Estradiol affects the expression of SUPT4H1 mRNA	CTD	PMID:17555576
Supt4h1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1314951	6480464	Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of SUPT4H1 mRNA]	CTD	PMID:11007951
Supt4h1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of SUPT4H1 mRNA	CTD	PMID:34747641
Supt4h1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1623282	6480464	Tetrachlorodibenzodioxin affects the expression of SUPT4H1 mRNA	CTD	PMID:21570461
Supt4h1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of SUPT4H1 mRNA	CTD	PMID:22298810
Supt4h1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1623282	6480464	Tetrachlorodibenzodioxin affects the reaction [AHR protein binds to SUPT4H1 promoter]	CTD	PMID:19654925
Supt4h1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1314951	6480464	Tetrachlorodibenzodioxin results in decreased expression of SUPT4H1 mRNA	CTD	PMID:11007951
Supt4h1	Rat	2-hydroxypropanoic acid	decreases expression	ISO	RGD:1314951	6480464	Lactic Acid results in decreased expression of SUPT4H1 mRNA	CTD	PMID:30851411
Supt4h1	Rat	2-naphthylamine	increases expression	ISO	RGD:1314951	6480464	2-Naphthylamine results in increased expression of SUPT4H1 mRNA	CTD	PMID:18247414
Supt4h1	Rat	4,4'-diaminodiphenylmethane	increases expression	ISO	RGD:1623282	6480464	4,4'-diaminodiphenylmethane results in increased expression of SUPT4H1 mRNA	CTD	PMID:18648102
Supt4h1	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	RGD:1623282	6480464	bisphenol S results in decreased expression of SUPT4A mRNA	CTD	PMID:39298647
Supt4h1	Rat	5-aza-2'-deoxycytidine	affects expression	ISO	RGD:1314951	6480464	Decitabine affects the expression of SUPT4H1 mRNA	CTD	PMID:23300844
Supt4h1	Rat	all-trans-retinoic acid	increases expression	ISO	RGD:1314951	6480464	Tretinoin results in increased expression of SUPT4H1 mRNA	CTD	PMID:33167477
Supt4h1	Rat	amphetamine	increases expression	EXP		6480464	Amphetamine results in increased expression of SUPT4H1 mRNA	CTD	PMID:30779732
Supt4h1	Rat	Aroclor 1254	increases expression	ISO	RGD:1623282	6480464	Chlorodiphenyl (54% Chlorine) results in increased expression of SUPT4H1 mRNA	CTD	PMID:23650126
Supt4h1	Rat	arsenite(3-)	multiple interactions	ISO	RGD:1314951	6480464	arsenite promotes the reaction [G3BP1 protein binds to SUPT4H1 mRNA]	CTD	PMID:32406909
Supt4h1	Rat	benzo[a]pyrene	multiple interactions	ISO	RGD:1623282	6480464	Benzo(a)pyrene affects the reaction [AHR protein binds to SUPT4H1 promoter]	CTD	PMID:19654925
Supt4h1	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1623282	6480464	Benzo(a)pyrene results in increased expression of SUPT4H1 mRNA	CTD	PMID:22228805
Supt4h1	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1314951	6480464	Benzo(a)pyrene results in increased expression of SUPT4H1 mRNA	CTD	PMID:18247414
Supt4h1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of SUPT4H1 mRNA	CTD	PMID:25181051\|PMID:32145629
Supt4h1	Rat	bisphenol A	decreases expression	ISO	RGD:1623282	6480464	bisphenol A results in decreased expression of SUPT4A mRNA	CTD	PMID:33221593
Supt4h1	Rat	cisplatin	affects expression	ISO	RGD:1314951	6480464	Cisplatin affects the expression of SUPT4H1 mRNA	CTD	PMID:23300844
Supt4h1	Rat	copper atom	multiple interactions	ISO	RGD:1314951	6480464	[Disulfiram binds to Copper] which results in decreased expression of SUPT4H1 mRNA	CTD	PMID:24690739
Supt4h1	Rat	copper(0)	multiple interactions	ISO	RGD:1314951	6480464	[Disulfiram binds to Copper] which results in decreased expression of SUPT4H1 mRNA	CTD	PMID:24690739
Supt4h1	Rat	CU-O LINKAGE	increases expression	ISO	RGD:1314951	6480464	cupric oxide results in increased expression of SUPT4H1 mRNA	CTD	PMID:22077320
Supt4h1	Rat	cycloheximide	multiple interactions	ISO	RGD:1314951	6480464	Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of SUPT4H1 mRNA]	CTD	PMID:11007951
Supt4h1	Rat	disulfiram	multiple interactions	ISO	RGD:1314951	6480464	[Disulfiram binds to Copper] which results in decreased expression of SUPT4H1 mRNA	CTD	PMID:24690739
Supt4h1	Rat	N-methyl-4-phenylpyridinium	increases expression	ISO	RGD:1623282	6480464	1-Methyl-4-phenylpyridinium results in increased expression of SUPT4A protein	CTD	PMID:26558463
Supt4h1	Rat	nicotine	decreases expression	ISO	RGD:1314951	6480464	Nicotine results in decreased expression of SUPT4H1 mRNA	CTD	PMID:18247414
Supt4h1	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:1623282	6480464	[perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of SUPT4A mRNA	CTD	PMID:36331819
Supt4h1	Rat	rac-lactic acid	decreases expression	ISO	RGD:1314951	6480464	Lactic Acid results in decreased expression of SUPT4H1 mRNA	CTD	PMID:30851411
Supt4h1	Rat	tamoxifen	affects expression	ISO	RGD:1623282	6480464	Tamoxifen affects the expression of SUPT4H1 mRNA	CTD	PMID:17555576
Supt4h1	Rat	titanium dioxide	decreases methylation	ISO	RGD:1623282	6480464	titanium dioxide results in decreased methylation of SUPT4H1 gene; titanium dioxide results in decreased methylation more ...	CTD	PMID:35295148
Supt4h1	Rat	titanium dioxide	increases methylation	ISO	RGD:1623282	6480464	titanium dioxide results in increased methylation of SUPT4H1 promoter	CTD	PMID:35295148
Supt4h1	Rat	triptonide	increases expression	ISO	RGD:1623282	6480464	triptonide results in increased expression of SUPT4A mRNA	CTD	PMID:33045310
Supt4h1	Rat	trovafloxacin	increases expression	ISO	RGD:1623282	6480464	trovafloxacin results in increased expression of SUPT4A mRNA	CTD	PMID:35537566
Supt4h1	Rat	vitamin E	increases expression	ISO	RGD:1314951	6480464	Vitamin E results in increased expression of SUPT4H1 mRNA	CTD	PMID:19244175

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Supt4h1	Rat	biological_process		ND		1598407	02/2015: no relevant rat data;	RGD
Supt4h1	Rat	negative regulation of DNA-templated transcription, elongation	involved_in	ISO	RGD:1314951	1624291	PMID:9450929, PMID:9857195	RGD	PMID:9450929\|PMID:9857195
Supt4h1	Rat	negative regulation of transcription by RNA polymerase II	involved_in	ISO	RGD:1314951	1624291	PMID:9450929, PMID:9857195	RGD	PMID:9450929\|PMID:9857195
Supt4h1	Rat	negative regulation of transcription elongation by RNA polymerase II	acts_upstream_of_or_within	ISO	RGD:1623282	1624291	PMID:21670248	RGD	PMID:21670248
Supt4h1	Rat	positive regulation of DNA-templated transcription, elongation	involved_in	ISO	RGD:1314951	1624291	PMID:9450929	RGD	PMID:9450929
Supt4h1	Rat	positive regulation of transcription by RNA polymerase II	involved_in	ISO	RGD:1314951	1624291	PMID:9450929	RGD	PMID:9450929
Supt4h1	Rat	regulation of DNA-templated transcription	involved_in	IEA	InterPro:IPR009287	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Supt4h1	Rat	regulation of transcription elongation by RNA polymerase II	involved_in	ISO	RGD:1314951	1624291	PMID:9450929	RGD	PMID:9450929
Supt4h1	Rat	transcription elongation by RNA polymerase II	involved_in	ISO	RGD:1314951	1624291	PMID:9450929, PMID:9857195	RGD	PMID:9450929\|PMID:9857195
Supt4h1	Rat	transcription elongation by RNA polymerase II	involved_in	IBA	FB:FBgn0028683\|PANTHER:PTN000306261\|PomBase:SPBC21C3.16c\|UniProtKB:P63272	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Supt4h1	Rat	transcription elongation-coupled chromatin remodeling	involved_in	IEA	InterPro:IPR009287	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Supt4h1	Rat	DSIF complex	part_of	ISO	RGD:1314951	1624291	PMID:19860741, PMID:9450929	RGD	PMID:19860741\|PMID:9450929
Supt4h1	Rat	DSIF complex	part_of	IBA	FB:FBgn0028683\|PANTHER:PTN000306261\|PomBase:SPBC21C3.16c\|SGD:S000003295\|UniProtKB:P63272	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Supt4h1	Rat	nucleoplasm	located_in	ISO	RGD:1314951	1624291		RGD	GO_REF:0000052
Supt4h1	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Supt4h1	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Supt4h1	Rat	nucleus	located_in	IEA	InterPro:IPR009287	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Supt4h1	Rat	nucleus	located_in	ISO	RGD:1314951	1624291	PMID:9450929	RGD	PMID:9450929

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Supt4h1	Rat	protein binding	enables	ISO	RGD:1314951	1624291	UniProtKB:O00267 PMID:10075709, PMID:17404243, PMID:24981860, PMID:25416956, PMID:25502805, PMID:26496610, PMID:26789250, PMID:27107012, PMID:31515488, PMID:35271311	RGD	PMID:10075709\|PMID:17404243\|PMID:24981860\|PMID:25416956\|PMID:25502805\|PMID:26496610\|PMID:26789250\|PMID:27107012\|PMID:31515488\|PMID:35271311
Supt4h1	Rat	protein heterodimerization activity	enables	ISO	RGD:1314951	1624291	UniProtKB:O00267 PMID:9450929	RGD	PMID:9450929
Supt4h1	Rat	RNA polymerase II complex binding	enables	IBA	PANTHER:PTN000306261\|SGD:S000003295	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Supt4h1	Rat	zinc ion binding	enables	IEA	InterPro:IPR009287	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Supt4h1	Rat	RNA polymerase I transcription pathway		ISO	RGD:1314951	9588244		RGD
Supt4h1	Rat	RNA polymerase II transcription elongation pathway		ISO	RGD:1314951	9681735		RGD

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Control of transcriptional elongation.	Kwak H and Lis JT, Annu Rev Genet. 2013;47:483-508. doi: 10.1146/annurev-genet-110711-155440. Epub 2013 Sep 11.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Comprehensive gene review and curation	RGD comprehensive gene curation
7.	RNA polymerase I activity is regulated at multiple steps in the transcription cycle: recent insights into factors that influence transcription elongation.	Schneider DA Gene. 2012 Feb 10;493(2):176-84. doi: 10.1016/j.gene.2011.08.006. Epub 2011 Aug 26.

PMID:8649394	PMID:9450929	PMID:9857195	PMID:12477932	PMID:21670248	PMID:30361391

Supt4h1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	73,036,560 - 73,042,821 (+)	NCBI		GRCr8
mRatBN7.2	10	72,539,323 - 72,545,582 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	72,539,382 - 72,545,831 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	77,149,795 - 77,156,042 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	76,654,742 - 76,660,989 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	72,119,248 - 72,125,495 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	75,032,365 - 75,038,547 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	75,032,365 - 75,038,547 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	75,063,841 - 75,070,023 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	76,030,806 - 76,036,988 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	76,045,182 - 76,051,065 (+)	NCBI
Celera	10	71,452,699 - 71,458,881 (+)	NCBI		Celera
Cytogenetic Map	10	q26	NCBI

SUPT4H1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	58,345,178 - 58,352,201 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	58,345,175 - 58,353,093 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	56,422,539 - 56,429,562 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	53,777,538 - 53,784,562 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	53,777,537 - 53,784,562	NCBI
Celera	17	52,884,325 - 52,891,352 (-)	NCBI		Celera
Cytogenetic Map	17	q22	NCBI
HuRef	17	51,783,156 - 51,790,227 (-)	NCBI		HuRef
CHM1_1	17	56,487,550 - 56,494,613 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	59,213,053 - 59,220,076 (-)	NCBI		T2T-CHM13v2.0

Supt4a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	87,628,377 - 87,634,449 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	87,628,378 - 87,634,449 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	87,737,551 - 87,743,623 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	87,737,552 - 87,743,623 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	87,551,067 - 87,557,119 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	87,553,760 - 87,559,812 (+)	NCBI		MGSCv36	mm8
Celera	11	97,333,101 - 97,339,153 (+)	NCBI		Celera
Cytogenetic Map	11	C	NCBI
cM Map	11	52.2	NCBI

Supt4h1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955451	4,682,311 - 4,688,008 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955451	4,682,308 - 4,688,008 (+)	NCBI	ChiLan1.0	ChiLan1.0

SUPT4H1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	74,516,257 - 74,523,264 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	79,327,422 - 79,334,435 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	52,420,503 - 52,427,514 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	57,276,028 - 57,282,516 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

SUPT4H1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	32,990,060 - 32,996,023 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	32,990,061 - 33,191,176 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	32,227,026 - 32,233,008 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	33,796,673 - 33,802,638 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	33,796,674 - 33,802,664 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	32,582,834 - 32,588,782 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	32,866,332 - 32,872,298 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	32,959,764 - 32,965,781 (-)	NCBI		UU_Cfam_GSD_1.0

Supt4h1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	32,320,496 - 32,330,835 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936490	4,744,443 - 4,749,868 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936490	4,744,307 - 4,751,043 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SUPT4H1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	34,619,729 - 34,629,646 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	34,622,775 - 34,629,681 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	36,183,672 - 36,193,623 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SUPT4H1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	35,047,874 - 35,054,438 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	35,047,934 - 35,054,239 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	5,862,496 - 5,869,211 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Supt4h1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624871	184,298 - 189,798 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624871	183,495 - 189,838 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Supt4h1
18 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	355
Count of miRNA genes:	173
Interacting mature miRNAs:	199
Transcripts:	ENSRNOT00000010448
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
631565	Hcuc4	Hepatic copper content QTL 4	4.15		liver copper amount (VT:0003065)	liver copper weight to liver dry weight ratio (CMO:0001512)	10	66941813	73452992	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	49444551	81709989	Rat
152025224	Bw193	Body weight QTL 193	6.47		body mass (VT:0001259)		10	51663405	75085664	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
12903245	Cm110	Cardiac mass QTL 110		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	10	71115217	72606468	Rat
12903246	Cm111	Cardiac mass QTL 111		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	71115217	72606468	Rat
12903247	Cm112	Cardiac mass QTL 112		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	71115217	72606468	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	57576521	102576521	Rat
12902615	Bw185	Body weight QTL 185		0.01	body mass (VT:0001259)	body weight (CMO:0000012)	10	71115217	72606468	Rat
12903248	Am14	Aortic mass QTL 14		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	71115217	72606468	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	53797494	98952626	Rat
12903249	Kidm68	Kidney mass QTL 68		0.02	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	71115217	72606468	Rat
1579918	Bp279	Blood pressure QTL 279		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	71115217	72606468	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	72224939	107211142	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2293646	Bss25	Bone structure and strength QTL 25	10.96	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	10	69738412	107211142	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
2300172	Bmd57	Bone mineral density QTL 57	9.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	10	69738412	107211142	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72224939	107211142	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
1357344	Bp249	Blood pressure QTL 249		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	66743655	98003205	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
2306970	Anxrr22	Anxiety related response QTL 22	5.95		fear/anxiety-related behavior trait (VT:1000241)	number of periods of voluntary immobility (CMO:0001045)	10	61345276	98211570	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
2293663	Bss33	Bone structure and strength QTL 33	9.34	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	10	69738412	107211142	Rat
7387312	Bw125	Body weight QTL 125	3	0.0047	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight (CMO:0000356)	10	64890616	107211142	Rat
2312672	Insul15	Insulin level QTL 15		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	10	57134272	102134272	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	66978955	107211142	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	66978955	107211142	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
2298481	Eau9	Experimental allergic uveoretinitis QTL 9		0.0169	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	65927233	82565079	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68420376	107211142	Rat
70363	Bp71	Blood pressure QTL 71		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	61345276	81714865	Rat
61402	Niddm3	Non-insulin dependent diabetes mellitus QTL 3	4.58		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	61345413	82564856	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
10450498	Bp384	Blood pressure QTL 384		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	67750049	107211142	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70199100	107211142	Rat
2293698	Bss43	Bone structure and strength QTL 43	5.33	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	10	59209888	104209888	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
2289985	Bp305	Blood pressure QTL 305			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	67502108	73579767	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	54809292	99809292	Rat
1558643	Cm44	Cardiac mass QTL 44	4.8	0.0000368	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	61345276	99703528	Rat
631535	Cm51	Cardiac mass QTL 51	3		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	51786282	91669536	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	41944526	78307017	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	49444551	81709989	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49444551	81709989	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
6893336	Cm75	Cardiac mass QTL 75	0.1	0.87	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	61345276	99703528	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47369470	92369470	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
2312662	Slep8	Serum leptin concentration QTL 8		0.05	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	10	57134272	102134272	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	42876766	79813922	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
1642980	Bp300	Blood pressure QTL 300			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68383129	107211142	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
2312668	Scl65	Serum cholesterol level QTL 65		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	57134272	102134272	Rat

RH98919

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	72,544,163 - 72,544,868 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	258,037,657 - 258,037,786 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	280,045,070 - 280,045,198	NCBI	Rnor6.0
Rnor_6.0	10	75,037,138 - 75,037,842	NCBI	Rnor6.0
Rnor_5.0	10	75,064,546 - 75,065,250	UniSTS	Rnor5.0
Rnor_5.0	1	287,408,968 - 287,409,096	UniSTS	Rnor5.0
RGSC_v3.4	10	76,035,579 - 76,036,283	UniSTS	RGSC3.4
RGSC_v3.4	1	265,406,158 - 265,406,286	UniSTS	RGSC3.4
Celera	1	253,696,198 - 253,696,326	UniSTS
Celera	10	71,457,472 - 71,458,176	UniSTS
Cytogenetic Map	10	q26	UniSTS

RH128879

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	72,544,908 - 72,545,090 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	258,037,826 - 258,038,009 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	280,045,239 - 280,045,421	NCBI	Rnor6.0
Rnor_6.0	10	75,037,883 - 75,038,064	NCBI	Rnor6.0
Rnor_5.0	10	75,064,324 - 75,064,505	UniSTS	Rnor5.0
Rnor_5.0	1	287,409,137 - 287,409,319	UniSTS	Rnor5.0
RGSC_v3.4	1	265,406,327 - 265,406,509	UniSTS	RGSC3.4
RGSC_v3.4	10	76,036,324 - 76,036,505	UniSTS	RGSC3.4
Celera	10	71,458,217 - 71,458,398	UniSTS
Celera	1	253,696,367 - 253,696,549	UniSTS
Cytogenetic Map	10	q26	UniSTS

RH137149

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	72,545,329 - 72,545,517 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	75,038,304 - 75,038,491	NCBI	Rnor6.0
Rnor_5.0	10	75,063,897 - 75,064,084	UniSTS	Rnor5.0
RGSC_v3.4	10	76,036,745 - 76,036,932	UniSTS	RGSC3.4
Celera	10	71,458,638 - 71,458,825	UniSTS
Cytogenetic Map	10	q26	UniSTS

Supt4h

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	258,037,671 - 258,037,735 (+)	MAPPER	mRatBN7.2
mRatBN7.2	10	72,544,177 - 72,544,643 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	75,037,152 - 75,037,617	NCBI	Rnor6.0
Rnor_6.0	1	280,045,084 - 280,045,147	NCBI	Rnor6.0
Rnor_5.0	10	75,064,771 - 75,065,236	UniSTS	Rnor5.0
Rnor_5.0	1	287,408,982 - 287,409,045	UniSTS	Rnor5.0
RGSC_v3.4	1	265,406,172 - 265,406,235	UniSTS	RGSC3.4
RGSC_v3.4	10	76,035,593 - 76,036,058	UniSTS	RGSC3.4
Celera	10	71,457,486 - 71,457,951	UniSTS
Celera	1	253,696,212 - 253,696,275	UniSTS
Cytogenetic Map	10	q26	UniSTS

MARC_4325-4326:991938466:1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	72,544,162 - 72,544,861 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	258,037,656 - 258,037,779 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	280,045,069 - 280,045,191	NCBI	Rnor6.0
Rnor_6.0	10	75,037,137 - 75,037,835	NCBI	Rnor6.0
Rnor_5.0	10	75,064,553 - 75,065,251	UniSTS	Rnor5.0
Rnor_5.0	1	287,408,967 - 287,409,089	UniSTS	Rnor5.0
RGSC_v3.4	1	265,406,157 - 265,406,279	UniSTS	RGSC3.4
RGSC_v3.4	10	76,035,578 - 76,036,276	UniSTS	RGSC3.4
Celera	10	71,457,471 - 71,458,169	UniSTS
Celera	1	253,696,197 - 253,696,319	UniSTS
Cytogenetic Map	10	q26	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001105828	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085568	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085570	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085571	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085572	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268701	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063268702	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC168730	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213593	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215296	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217757	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224188	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228457	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010448 ⟹ ENSRNOP00000010448

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	72,539,395 - 72,545,831 (+)	Ensembl
Rnor_6.0 Ensembl	10	75,032,365 - 75,038,547 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111321 ⟹ ENSRNOP00000092076

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	72,539,382 - 72,545,831 (+)	Ensembl

RefSeq Acc Id:

NM_001105828 ⟹ NP_001099298

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	73,036,574 - 73,042,821 (+)	NCBI
mRatBN7.2	10	72,539,335 - 72,545,582 (+)	NCBI
Rnor_6.0	10	75,032,365 - 75,038,547 (+)	NCBI
Rnor_5.0	10	75,063,841 - 75,070,023 (-)	NCBI
RGSC_v3.4	10	76,030,806 - 76,036,988 (+)	RGD
Celera	10	71,452,699 - 71,458,881 (+)	RGD

Sequence:

show sequence

TATTATCGTATACGGCGAGAATGGCCCTGGAGACGGTGCCAAAGGACCTGCGGCATCTGCGAGCTTGTTTGCTGTGCTCGTTAGTCAAGACTATAGACCAGTTTGAATATGATGGGTGTGACAATTGC
GATGCATACCTACAAATGAAGGGCAACAGAGAGATGGTGTACGACTGCACCAGCTCTTCATTTGATGGAATCATCGCGATGATGAGTCCAGAGGACAGCTGGGTCTCCAAGTGGCAGCGCGTCAGTAA
CTTTAAGCCAGGTGTATATGCTGTGTCAGTCACTGGTCGTCTGCCCCAAGGAATTGTGCGGGAGCTGAAAAGTCGAGGAGTGGCCTACAAATCGAGAGACACAGCAATAAAGACCTAGCTAGATGCAG
GCCATAGCGTCTTGTTCTCTACTTCTGTCCTTGTTTTCTTGTGGAACTAAAAGGTGGGACCCAAAGACTCCTTGCCCTCCAGCTCAGGATCAGCAGACCCCGTGAAGGCAGCACATCCGGCCTTAAGT
CACCTCCCTTTCTCTGACCACTGGTGAAGTGGGAGTGTCTGAGTGGATTCTCAGAGGCTGTATCAGGAGAGTAAGATGCTGATTTCCCACCTCTGTTCAGGGTTTTGCCTTTGTCCATGGGCAGGACT
TTGGTTCAAATGCCAATAAAACAAACCTTTGGAGTACTTAAACAAAACTTAAAGAGTACTAAGGCCTGTGCCTTTGTACCTTTTCCTCTCAGGATGAAGCCTCACTTCCCTGCTGACCGGAAGTCCAA
TATCCTGTCCTCTCTCCCTGGTGTACCCTCCTTTGAAGGAATCAAGGCTGCTTGGTGCCTTTTTCCTTGACCCTCTTTCACTTCCCTCTCTTCCTTTGTCTCTTTTCTTTGCTCCTGTTGTACCTTTG
CCAGGTGATCTGGGTTTTTGTGTTTCCATGGAAAACAGGCCCTCCTTTGGCTAAGAAGGGAGCCATGGGTAATGCCACATTGGCCAAGATGTCTTTCTTTCTTTTCTTTTTTTTTTAATAATAAAACA
TTTACCATATATTCTCACCAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039085568 ⟹ XP_038941496

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	73,036,585 - 73,042,816 (+)	NCBI
mRatBN7.2	10	72,539,323 - 72,545,582 (+)	NCBI

RefSeq Acc Id:

XM_039085570 ⟹ XP_038941498

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	73,036,560 - 73,040,211 (+)	NCBI
mRatBN7.2	10	72,539,323 - 72,542,972 (+)	NCBI

RefSeq Acc Id:

XM_039085571 ⟹ XP_038941499

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	73,036,579 - 73,042,816 (+)	NCBI
mRatBN7.2	10	72,539,323 - 72,545,582 (+)	NCBI

RefSeq Acc Id:

XM_039085572 ⟹ XP_038941500

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	73,036,579 - 73,042,816 (+)	NCBI
mRatBN7.2	10	72,539,323 - 72,545,582 (+)	NCBI

RefSeq Acc Id:

XM_063268701 ⟹ XP_063124771

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	73,036,560 - 73,041,443 (+)	NCBI

RefSeq Acc Id:

XM_063268702 ⟹ XP_063124772

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	73,036,560 - 73,041,447 (+)	NCBI


Protein RefSeqs	NP_001099298	(Get FASTA)	NCBI Sequence Viewer
	XP_038941496	(Get FASTA)	NCBI Sequence Viewer
	XP_038941498	(Get FASTA)	NCBI Sequence Viewer
	XP_038941499	(Get FASTA)	NCBI Sequence Viewer
	XP_038941500	(Get FASTA)	NCBI Sequence Viewer
	XP_063124771	(Get FASTA)	NCBI Sequence Viewer
	XP_063124772	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI68730	(Get FASTA)	NCBI Sequence Viewer
	EDM05606	(Get FASTA)	NCBI Sequence Viewer
	EDM05607	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010448.4
	ENSRNOP00000092076.1

RefSeq Acc Id:	NP_001099298 ⟸ NM_001105828
- UniProtKB:	B5DEM7 (UniProtKB/TrEMBL), F7F5Z5 (UniProtKB/TrEMBL), A0A8I6GK12 (UniProtKB/TrEMBL)
- Sequence:	show sequence MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT hide sequence

Ensembl Acc Id:

ENSRNOP00000010448 ⟸ ENSRNOT00000010448

RefSeq Acc Id:	XP_038941500 ⟸ XM_039085572
- Peptide Label:	isoform X6

RefSeq Acc Id:	XP_038941496 ⟸ XM_039085568
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038941499 ⟸ XM_039085571
- Peptide Label:	isoform X5

Protein Domains

Spt4/RpoE2 zinc finger

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B5DEM7-F1-model_v2	AlphaFold	B5DEM7	1-117	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13697575

Promoter ID:

EPDNEW_R8100

Type:

initiation region

Name:

Supt4h1_1

Description:

SPT4 homolog, DSIF elongation factor subunit

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	75,032,372 - 75,032,432	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-23746	BioCyc
Ensembl Genes	ENSRNOG00000007845	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000010448.8	UniProtKB/TrEMBL
	ENSRNOT00000111321.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.40.210	UniProtKB/TrEMBL
InterPro	RPABC4/Spt4	UniProtKB/TrEMBL
	Spt4	UniProtKB/TrEMBL
	Spt4/RpoE2_Znf	UniProtKB/TrEMBL
	Spt4_sf	UniProtKB/TrEMBL
KEGG Report	rno:287608	UniProtKB/TrEMBL
NCBI Gene	287608	ENTREZGENE
PANTHER	Spt4	UniProtKB/TrEMBL
	TRANSCRIPTION ELONGATION FACTOR SPT4	UniProtKB/TrEMBL
Pfam	Spt4	UniProtKB/TrEMBL
PhenoGen	Supt4h1	PhenoGen
PIRSF	Spt4	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000007845	RatGTEx
SMART	Spt4	UniProtKB/TrEMBL
Superfamily-SCOP	SSF63393	UniProtKB/TrEMBL
UniProt	A0A8I6GK12	ENTREZGENE, UniProtKB/TrEMBL
	A6HHV0	ENTREZGENE, UniProtKB/TrEMBL
	B5DEM7	ENTREZGENE, UniProtKB/TrEMBL
	F7F5Z5	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-10-01	Supt4h1	SPT4 homolog, DSIF elongation factor subunit	Supt4h1	suppressor of Ty 4 homolog 1 (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Supt4h1	suppressor of Ty 4 homolog 1 (S. cerevisiae)	Supt4h2_predicted	suppressor of Ty 4 homolog 2 (S. cerevisiae) (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-12	Supt4h2_predicted	suppressor of Ty 4 homolog 2 (S. cerevisiae) (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations