Symbol:
BMAL1
Name:
basic helix-loop-helix ARNT like 1
RGD ID:
732520
HGNC Page
HGNC:701
Description:
Enables E-box binding activity; Hsp90 protein binding activity; and aryl hydrocarbon receptor binding activity. Involved in several processes, including positive regulation of circadian rhythm; regulation of macromolecule metabolic process; and response to redox state. Located in nucleoplasm. Part of CLOCK-BMAL transcription complex. Implicated in alcohol dependence and bipolar disorder.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
ARNT-like protein 1, brain and muscle; ARNTL; ARNTL1; aryl hydrocarbon receptor nuclear translocator like; aryl hydrocarbon receptor nuclear translocator-like protein 1; basic helix-loop-helix ARNT-like protein 1; basic helix-loop-helix family member e5; basic-helix-loop-helix-PAS orphan MOP3; basic-helix-loop-helix-PAS protein MOP3; bHLH-PAS protein JAP3; bHLHe5; BMAL1c; brain and muscle ARNT-like 1; class E basic helix-loop-helix protein 5; JAP3; member of PAS protein 3; member of PAS superfamily 3; MGC47515; MOP3; mutant basic helix-loop-helix ARNT-like protein 1; PAS domain containing 3; PAS domain-containing protein 3; PASD3; testis tissue sperm-binding protein Li 50e; TIC
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Bmal1 (basic helix-loop-helix ARNT like 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Rattus norvegicus (Norway rat):
Bmal1 (basic helix-loop-helix ARNT like 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Chinchilla lanigera (long-tailed chinchilla):
Bmal1 (basic helix-loop-helix ARNT like 1) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
BMAL1 (basic helix-loop-helix ARNT like 1) NCBI
Ortholog
Canis lupus familiaris (dog):
ARNTL (aryl hydrocarbon receptor nuclear translocator like) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Bmal1 (basic helix-loop-helix ARNT like 1) NCBI
Ortholog
Sus scrofa (pig):
ARNTL (aryl hydrocarbon receptor nuclear translocator like) HGNC
EggNOG, Ensembl, NCBI, OrthoDB, Panther
Chlorocebus sabaeus (green monkey):
BMAL1 (basic helix-loop-helix ARNT like 1) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Bmal1 (basic helix-loop-helix ARNT like 1) NCBI
Ortholog
Other homologs 2
Rattus norvegicus (Norway rat):
Xpa (XPA, DNA damage recognition and repair factor) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Bmal1 (basic helix-loop-helix ARNT like 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Bmal1 (basic helix-loop-helix ARNT like 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
arntl1b (aryl hydrocarbon receptor nuclear translocator-like 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
arntl1a (aryl hydrocarbon receptor nuclear translocator-like 1a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
cyc
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
arntl
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus laevis (African clawed frog):
arntl.S
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
arntl.L
Alliance
DIOPT (Xenbase)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
NCBI Annotation Information:
Note: This gene has been reviewed for its involvement in coronavirus biology, and is involved in immune response or antiviral activity.
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 13,276,652 - 13,387,266 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 13,276,652 - 13,387,266 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 13,298,199 - 13,408,813 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 13,255,901 - 13,365,389 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 13,255,925 - 13,365,386 NCBI Celera 11 13,425,472 - 13,534,997 (+) NCBI Celera Cytogenetic Map 11 p15.3 NCBI HuRef 11 12,979,421 - 13,089,003 (+) NCBI HuRef CHM1_1 11 13,298,302 - 13,407,784 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 13,369,378 - 13,480,010 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
BMAL1 Human (+)-epicatechin-3-O-gallate multiple interactions EXP 6480464 [Gallic Acid co-treated with gallocatechol co-treated with epigallocatechin gallate co-treated with epicatechin gallate] affects the reaction [Hydrogen Peroxide affects the expression of BMAL1 mRNA] more ... CTD PMID:29061316 BMAL1 Human (+)-schisandrin B multiple interactions ISO Bmal1 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of BMAL1 mRNA] CTD PMID:31150632 BMAL1 Human (-)-epigallocatechin 3-gallate multiple interactions EXP 6480464 [Gallic Acid co-treated with gallocatechol co-treated with epigallocatechin gallate co-treated with epicatechin gallate] affects the reaction [Hydrogen Peroxide affects the expression of BMAL1 mRNA] more ... CTD PMID:22079256 and PMID:29061316 BMAL1 Human (1->4)-beta-D-glucan multiple interactions ISO Bmal1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ARNTL mRNA CTD PMID:36331819 BMAL1 Human 1,2-dichloroethane increases expression ISO Bmal1 (Mus musculus) 6480464 ethylene dichloride results in increased expression of BMAL1 mRNA CTD PMID:28960355 BMAL1 Human 1,2-dimethylhydrazine increases expression ISO Bmal1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of BMAL1 mRNA CTD PMID:22206623 BMAL1 Human 1,2-dimethylhydrazine multiple interactions ISO Bmal1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of BMAL1 mRNA] CTD PMID:22206623 BMAL1 Human 1,3-dichloropropan-2-ol multiple interactions EXP 6480464 BMAL1 protein inhibits the reaction [1 more ... CTD PMID:36805544 BMAL1 Human 1,3-dichloropropan-2-ol decreases expression ISO Bmal1 (Mus musculus) 6480464 1 and 3-dichloro-2-propanol results in decreased expression of BMAL1 protein CTD PMID:36805544 BMAL1 Human 17beta-estradiol decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 Estradiol results in decreased expression of ARNTL mRNA CTD PMID:32145629 BMAL1 Human 17beta-estradiol increases expression ISO Bmal1 (Mus musculus) 6480464 Estradiol results in increased expression of BMAL1 mRNA CTD PMID:39298647 BMAL1 Human 17beta-estradiol multiple interactions ISO Bmal1 (Mus musculus) 6480464 [Polyphenols co-treated with Estradiol] results in decreased expression of BMAL1 mRNA CTD PMID:30077407 BMAL1 Human 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Bmal1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 and PMID:32784060 BMAL1 Human 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Bmal1 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 BMAL1 Human 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Bmal1 (Mus musculus) 6480464 [Flame Retardants results in increased abundance of 2 more ... CTD PMID:38995820 BMAL1 Human 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Bmal1 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 BMAL1 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Bmal1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of BMAL1 mRNA CTD PMID:21215274 BMAL1 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Bmal1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:21182907 more ... BMAL1 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Bmal1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of BMAL1 mRNA and Tetrachlorodibenzodioxin affects the expression of BMAL1 protein CTD PMID:21182907 more ... BMAL1 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Bmal1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of BMAL1 mRNA CTD PMID:18487412 BMAL1 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Bmal1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of BMAL1 mRNA CTD PMID:18295293 more ... BMAL1 Human 2-amino-2-deoxy-D-glucopyranose decreases expression ISO Bmal1 (Mus musculus) 6480464 Glucosamine results in decreased expression of BMAL1 mRNA and Glucosamine results in decreased expression of BMAL1 protein CTD PMID:24442997 BMAL1 Human 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 3 more ... CTD PMID:23196670 BMAL1 Human 3,3',4,4',5-pentachlorobiphenyl increases expression ISO Bmal1 (Mus musculus) 6480464 3 more ... CTD PMID:37080397 BMAL1 Human 3,3',5,5'-tetrabromobisphenol A increases expression ISO Bmal1 (Rattus norvegicus) 6480464 tetrabromobisphenol A results in increased expression of BMAL1 mRNA CTD PMID:28300664 BMAL1 Human 3,4-methylenedioxymethamphetamine decreases expression ISO Bmal1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of BMAL1 mRNA CTD PMID:26251327 BMAL1 Human 3-chloropropane-1,2-diol decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 alpha-Chlorohydrin results in decreased expression of BMAL1 mRNA CTD PMID:28522335 BMAL1 Human 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of BMAL1 mRNA CTD PMID:28628672 BMAL1 Human 4,4'-sulfonyldiphenol increases expression ISO Bmal1 (Mus musculus) 6480464 bisphenol S results in increased expression of BMAL1 mRNA CTD PMID:39298647 BMAL1 Human 6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide increases acetylation ISO Bmal1 (Mus musculus) 6480464 6-chloro-2 more ... CTD PMID:31768571 BMAL1 Human acrylamide increases expression ISO Bmal1 (Rattus norvegicus) 6480464 Acrylamide results in increased expression of BMAL1 mRNA CTD PMID:28959563 BMAL1 Human acrylamide decreases expression ISO Bmal1 (Mus musculus) 6480464 Acrylamide results in decreased expression of BMAL1 mRNA CTD PMID:30807115 BMAL1 Human aflatoxin B1 increases methylation EXP 6480464 Aflatoxin B1 results in increased methylation of BMAL1 gene CTD PMID:27153756 BMAL1 Human aldehydo-D-glucosamine decreases expression ISO Bmal1 (Mus musculus) 6480464 Glucosamine results in decreased expression of BMAL1 mRNA and Glucosamine results in decreased expression of BMAL1 protein CTD PMID:24442997 BMAL1 Human all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of BMAL1 mRNA CTD PMID:23724009 BMAL1 Human all-trans-retinoic acid multiple interactions ISO Bmal1 (Mus musculus) 6480464 RARA protein inhibits the reaction [Tretinoin results in increased activity of [CLOCK protein binds to BMAL1 protein]] and Tretinoin results in increased activity of [CLOCK protein binds to BMAL1 protein] CTD PMID:17069763 BMAL1 Human all-trans-retinoic acid increases expression ISO Bmal1 (Mus musculus) 6480464 Tretinoin results in increased expression of BMAL1 mRNA CTD PMID:9704006 BMAL1 Human alpha-Zearalanol multiple interactions ISO Bmal1 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of ARNTL mRNA CTD PMID:35163327 BMAL1 Human amino acid increases abundance ISO Bmal1 (Mus musculus) 6480464 BMAL1 gene mutant form results in increased abundance of Amino Acids CTD PMID:27056296 BMAL1 Human ammonium chloride affects expression ISO Bmal1 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of BMAL1 mRNA CTD PMID:16483693 BMAL1 Human antirheumatic drug decreases expression EXP 6480464 Antirheumatic Agents results in decreased expression of BMAL1 mRNA CTD PMID:24449571 BMAL1 Human aristolochic acid A decreases expression EXP 6480464 aristolochic acid I results in decreased expression of BMAL1 mRNA CTD PMID:33212167 BMAL1 Human Aroclor 1254 decreases expression ISO Bmal1 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of BMAL1 mRNA CTD PMID:23650126 BMAL1 Human arsane affects methylation EXP 6480464 Arsenic affects the methylation of BMAL1 gene CTD PMID:25304211 BMAL1 Human arsenic atom affects methylation EXP 6480464 Arsenic affects the methylation of BMAL1 gene CTD PMID:25304211 BMAL1 Human atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of BMAL1 mRNA CTD PMID:22378314 BMAL1 Human atrazine decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 Atrazine results in decreased expression of BMAL1 mRNA CTD PMID:36841081 BMAL1 Human benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of BMAL1 mRNA CTD PMID:21632981 more ... BMAL1 Human benzo[a]pyrene increases expression ISO Bmal1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of BMAL1 mRNA CTD PMID:22228805 BMAL1 Human benzo[a]pyrene decreases expression ISO Bmal1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of BMAL1 mRNA CTD PMID:19770486 BMAL1 Human benzo[a]pyrene multiple interactions ISO Bmal1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of BMAL1 mRNA CTD PMID:27858113 BMAL1 Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of BMAL1 5' UTR CTD PMID:27901495 BMAL1 Human benzo[a]pyrene diol epoxide I decreases expression EXP 6480464 7 more ... CTD PMID:19150397 BMAL1 Human benzo[b]fluoranthene multiple interactions ISO Bmal1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of BMAL1 mRNA CTD PMID:27858113 BMAL1 Human benzo[b]fluoranthene decreases expression ISO Bmal1 (Mus musculus) 6480464 benzo(b)fluoranthene results in decreased expression of BMAL1 mRNA CTD PMID:26377693 BMAL1 Human Benzo[k]fluoranthene decreases expression ISO Bmal1 (Mus musculus) 6480464 benzo(k)fluoranthene results in decreased expression of BMAL1 mRNA CTD PMID:26377693 BMAL1 Human beta-D-glucosamine decreases expression ISO Bmal1 (Mus musculus) 6480464 Glucosamine results in decreased expression of BMAL1 mRNA and Glucosamine results in decreased expression of BMAL1 protein CTD PMID:24442997 BMAL1 Human beta-lapachone increases expression EXP 6480464 beta-lapachone results in increased expression of ARNTL mRNA CTD PMID:38218311 BMAL1 Human beta-naphthoflavone multiple interactions ISO Bmal1 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of BMAL1 mRNA CTD PMID:18164116 BMAL1 Human beta-naphthoflavone multiple interactions ISO Bmal1 (Mus musculus) 6480464 beta-Naphthoflavone inhibits the reaction [CLOCK protein binds to BMAL1 protein] more ... CTD PMID:20106950 and PMID:21849270 BMAL1 Human beta-naphthoflavone increases expression EXP 6480464 beta-Naphthoflavone results in increased expression of BMAL1 mRNA CTD PMID:32151702 BMAL1 Human bezafibrate multiple interactions ISO Bmal1 (Mus musculus) 6480464 [CLOCK protein binds to BMAL1 protein] promotes the reaction [Bezafibrate results in increased expression of SERPINE1 mRNA] CTD PMID:20400680 BMAL1 Human bis(2-ethylhexyl) phthalate decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 Diethylhexyl Phthalate results in decreased expression of ARNTL mRNA and Diethylhexyl Phthalate results in decreased expression of BMAL1 mRNA CTD PMID:28871463 and PMID:33789034 BMAL1 Human bis(2-ethylhexyl) phthalate multiple interactions ISO Bmal1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 and PMID:32784060 BMAL1 Human bis(2-ethylhexyl) phthalate decreases expression ISO Bmal1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of BMAL1 mRNA CTD PMID:19245819 BMAL1 Human bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of BMAL1 mRNA CTD PMID:31163220 BMAL1 Human bisphenol A affects expression ISO Bmal1 (Rattus norvegicus) 6480464 bisphenol A affects the expression of BMAL1 mRNA CTD PMID:25181051 BMAL1 Human bisphenol A increases methylation ISO Bmal1 (Mus musculus) 6480464 bisphenol A results in increased methylation of BMAL1 promoter CTD PMID:27312807 BMAL1 Human bisphenol A decreases expression ISO Bmal1 (Mus musculus) 6480464 bisphenol A results in decreased expression of BMAL1 mRNA CTD PMID:25594700 and PMID:37611474 BMAL1 Human bisphenol A decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of ARNTL mRNA CTD PMID:32145629 BMAL1 Human bisphenol A increases expression ISO Bmal1 (Mus musculus) 6480464 bisphenol A results in increased expression of BMAL1 mRNA and bisphenol A results in increased expression of BMAL1 protein CTD PMID:30500912 and PMID:33297044 BMAL1 Human bisphenol A multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of BMAL1 mRNA CTD PMID:28628672 BMAL1 Human bisphenol A multiple interactions ISO Bmal1 (Mus musculus) 6480464 [ATF3 protein affects the reaction [bisphenol A results in increased expression of NPY mRNA]] which affects the expression of BMAL1 mRNA more ... CTD PMID:28433925 more ... BMAL1 Human bisphenol AF decreases expression ISO Bmal1 (Mus musculus) 6480464 bisphenol AF results in decreased expression of BMAL1 mRNA CTD PMID:37611474 BMAL1 Human bisphenol F decreases expression ISO Bmal1 (Mus musculus) 6480464 bisphenol F results in decreased expression of BMAL1 mRNA CTD PMID:37611474 BMAL1 Human bromobenzene increases expression ISO Bmal1 (Rattus norvegicus) 6480464 bromobenzene results in increased expression of BMAL1 mRNA CTD PMID:32479839 BMAL1 Human C60 fullerene decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 fullerene C60 results in decreased expression of BMAL1 mRNA CTD PMID:19167457 BMAL1 Human cadmium dichloride affects expression ISO Bmal1 (Rattus norvegicus) 6480464 Cadmium Chloride affects the expression of BMAL1 and Cadmium Chloride affects the expression of BMAL1 mRNA CTD PMID:21442002 and PMID:23085516 BMAL1 Human cadmium dichloride multiple interactions ISO Bmal1 (Rattus norvegicus) 6480464 Melatonin inhibits the reaction [Cadmium Chloride affects the expression of BMAL1] CTD PMID:23085516 BMAL1 Human cadmium dichloride decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 Cadmium Chloride results in decreased expression of BMAL1 mRNA CTD PMID:20107868 BMAL1 Human calcium silicate increases expression ISO Bmal1 (Mus musculus) 6480464 calcium silicate results in increased expression of BMAL1 mRNA CTD PMID:29279043 BMAL1 Human cannabidiol increases expression ISO Bmal1 (Mus musculus) 6480464 Cannabidiol results in increased expression of BMAL1 mRNA CTD PMID:30307084 BMAL1 Human carbon nanotube decreases expression ISO Bmal1 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of BMAL1 mRNA CTD PMID:25554681 and PMID:25620056 BMAL1 Human carbon nanotube increases expression ISO Bmal1 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of BMAL1 mRNA CTD PMID:25554681 and PMID:25620056 BMAL1 Human carmustine decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 Carmustine results in decreased expression of BMAL1 mRNA CTD PMID:16005536 BMAL1 Human carnosine increases abundance ISO Bmal1 (Mus musculus) 6480464 BMAL1 gene mutant form results in increased abundance of Carnosine CTD PMID:27056296 BMAL1 Human casticin decreases expression ISO Bmal1 (Mus musculus) 6480464 casticin results in decreased expression of BMAL1 mRNA CTD PMID:28444820 BMAL1 Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to BMAL1 gene] CTD PMID:28238834 BMAL1 Human CGS-21680 multiple interactions EXP 6480464 [2-(4-(2-carboxyethyl)phenethylamino)-5'-N-ethylcarboxamidoadenosine co-treated with TNF protein] results in increased expression of BMAL1 mRNA CTD PMID:22923002 BMAL1 Human CGS-21680 increases expression EXP 6480464 2-(4-(2-carboxyethyl)phenethylamino)-5'-N-ethylcarboxamidoadenosine results in increased expression of BMAL1 mRNA CTD PMID:22923002 BMAL1 Human chloroprene decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 Chloroprene results in decreased expression of BMAL1 mRNA CTD PMID:23125180 BMAL1 Human choline multiple interactions ISO Bmal1 (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of BMAL1 mRNA CTD PMID:29127188 BMAL1 Human chrysene decreases expression ISO Bmal1 (Mus musculus) 6480464 chrysene results in decreased expression of BMAL1 mRNA CTD PMID:26377693 BMAL1 Human chrysene multiple interactions ISO Bmal1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of BMAL1 mRNA CTD PMID:27858113 BMAL1 Human cisplatin decreases expression ISO Bmal1 (Mus musculus) 6480464 Cisplatin results in decreased expression of BMAL1 mRNA CTD PMID:25270620 BMAL1 Human clofibrate decreases expression ISO Bmal1 (Mus musculus) 6480464 Clofibrate results in decreased expression of BMAL1 mRNA CTD PMID:17585979 BMAL1 Human cocaine decreases expression ISO Bmal1 (Mus musculus) 6480464 Cocaine results in decreased expression of BMAL1 mRNA CTD PMID:15994025 BMAL1 Human cocaine hydrochloride decreases expression ISO Bmal1 (Mus musculus) 405866348 cocaine hydrochloride decreases expression of Bmal1 mRNA in caudate-putamen RGD BMAL1 Human colforsin daropate hydrochloride increases expression ISO Bmal1 (Mus musculus) 6480464 Colforsin results in increased expression of BMAL1 mRNA CTD PMID:30524225 BMAL1 Human copper atom multiple interactions EXP 6480464 [NSC 689534 binds to Copper] which results in increased expression of BMAL1 mRNA CTD PMID:20971185 BMAL1 Human copper(0) multiple interactions EXP 6480464 [NSC 689534 binds to Copper] which results in increased expression of BMAL1 mRNA CTD PMID:20971185 BMAL1 Human copper(II) sulfate decreases expression EXP 6480464 Copper Sulfate results in decreased expression of BMAL1 mRNA CTD PMID:19549813 BMAL1 Human cortisol decreases expression EXP 6480464 Hydrocortisone results in decreased expression of BMAL1 mRNA CTD PMID:21980503 BMAL1 Human creatinine increases abundance ISO Bmal1 (Mus musculus) 6480464 BMAL1 gene mutant form results in increased abundance of Creatinine CTD PMID:27056296 BMAL1 Human cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of BMAL1 mRNA CTD PMID:25562108 BMAL1 Human DDE decreases expression EXP 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of ARNTL mRNA CTD PMID:38568856 BMAL1 Human deoxynivalenol multiple interactions ISO Bmal1 (Mus musculus) 6480464 BMAL1 protein inhibits the reaction [deoxynivalenol results in increased activity of GOT1 protein] more ... CTD PMID:36602574 BMAL1 Human dexamethasone affects expression EXP 6480464 Dexamethasone affects the expression of BMAL1 mRNA CTD PMID:23251369 BMAL1 Human dexamethasone affects expression ISO Bmal1 (Mus musculus) 6480464 Dexamethasone affects the expression of BMAL1 mRNA CTD PMID:29040059 BMAL1 Human dexamethasone multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of BMAL1 mRNA CTD PMID:28628672 BMAL1 Human dibenz[a,h]anthracene decreases expression ISO Bmal1 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 BMAL1 Human Dibutyl phosphate affects expression EXP 6480464 di-n-butylphosphoric acid affects the expression of ARNTL mRNA CTD PMID:37042841 BMAL1 Human dichloromethane decreases expression ISO Bmal1 (Mus musculus) 6480464 Methylene Chloride results in decreased expression of BMAL1 mRNA CTD PMID:28392392 BMAL1 Human dimethylarsinic acid multiple interactions ISO Bmal1 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of BMAL1 mRNA CTD PMID:34876320 BMAL1 Human dioxygen multiple interactions ISO Bmal1 (Rattus norvegicus) 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of BMAL1 mRNA CTD PMID:33729688 BMAL1 Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of BMAL1 mRNA CTD PMID:27188386 BMAL1 Human doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of BMAL1 mRNA CTD PMID:29803840 BMAL1 Human doxorubicin multiple interactions ISO Bmal1 (Mus musculus) 6480464 Doxorubicin affects the reaction [SIRT1 protein affects the acetylation of BMAL1 protein] and Doxorubicin results in decreased expression of and results in increased acetylation of BMAL1 protein CTD PMID:31768571 BMAL1 Human doxorubicin decreases acetylation ISO Bmal1 (Mus musculus) 6480464 Doxorubicin results in decreased acetylation of BMAL1 protein CTD PMID:31768571 BMAL1 Human entinostat increases expression EXP 6480464 entinostat results in increased expression of BMAL1 mRNA CTD PMID:27188386 BMAL1 Human epoxiconazole affects expression ISO Bmal1 (Mus musculus) 6480464 epoxiconazole affects the expression of BMAL1 mRNA CTD PMID:35436446 BMAL1 Human Erionite increases expression ISO Bmal1 (Mus musculus) 6480464 erionite results in increased expression of BMAL1 mRNA CTD PMID:29279043 BMAL1 Human flavonoids decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 Flavonoids results in decreased expression of BMAL1 mRNA CTD PMID:18035473 BMAL1 Human fluoxetine increases expression ISO Bmal1 (Mus musculus) 405866348 fluoxetine increases expression of Bmal1 mRNA in hippocampal formation RGD BMAL1 Human fluoxetine increases expression ISO Bmal1 (Mus musculus) 6480464 Fluoxetine results in increased expression of BMAL1 mRNA CTD PMID:15994025 BMAL1 Human folic acid multiple interactions ISO Bmal1 (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of BMAL1 mRNA more ... CTD PMID:22206623 and PMID:29127188 BMAL1 Human furan increases expression ISO Bmal1 (Mus musculus) 6480464 furan results in increased expression of BMAL1 mRNA CTD PMID:24183702 BMAL1 Human furosemide decreases secretion ISO Bmal1 (Mus musculus) 6480464 BMAL1 gene mutant form results in decreased secretion of Furosemide CTD PMID:27056296 BMAL1 Human gadolinium atom multiple interactions EXP 6480464 [gadolinium chloride results in increased abundance of Gadolinium] which results in increased expression of BMAL1 protein CTD PMID:34878122 BMAL1 Human gadolinium trichloride multiple interactions EXP 6480464 [gadolinium chloride results in increased abundance of Gadolinium] which results in increased expression of BMAL1 protein CTD PMID:34878122 BMAL1 Human gallic acid multiple interactions EXP 6480464 [Gallic Acid co-treated with gallocatechol co-treated with epigallocatechin gallate co-treated with epicatechin gallate] affects the reaction [Hydrogen Peroxide affects the expression of BMAL1 mRNA] more ... CTD PMID:29061316 BMAL1 Human gallic acid increases expression EXP 6480464 Gallic Acid results in increased expression of BMAL1 mRNA CTD PMID:34408198 BMAL1 Human gallocatechin multiple interactions EXP 6480464 [Gallic Acid co-treated with gallocatechol co-treated with epigallocatechin gallate co-treated with epicatechin gallate] affects the reaction [Hydrogen Peroxide affects the expression of BMAL1 mRNA] more ... CTD PMID:29061316 BMAL1 Human geraniol increases expression EXP 6480464 geraniol results in increased expression of BMAL1 mRNA CTD PMID:27683099 BMAL1 Human glyphosate decreases expression ISO Bmal1 (Mus musculus) 6480464 Glyphosate results in decreased expression of BMAL1 mRNA CTD PMID:33957581 BMAL1 Human gold atom multiple interactions ISO Bmal1 (Mus musculus) 6480464 [Gold co-treated with Polyethylene Glycols] results in decreased expression of BMAL1 mRNA CTD PMID:19695318 BMAL1 Human gold(0) multiple interactions ISO Bmal1 (Mus musculus) 6480464 [Gold co-treated with Polyethylene Glycols] results in decreased expression of BMAL1 mRNA CTD PMID:19695318 BMAL1 Human graphene oxide decreases expression ISO Bmal1 (Mus musculus) 6480464 graphene oxide analog results in decreased expression of BMAL1 mRNA and graphene oxide results in decreased expression of BMAL1 mRNA CTD PMID:33227293 BMAL1 Human hexadecanoic acid decreases expression ISO Bmal1 (Mus musculus) 6480464 Palmitic Acid results in decreased expression of BMAL1 mRNA and Palmitic Acid results in decreased expression of BMAL1 protein CTD PMID:24442997 BMAL1 Human hydrogen peroxide affects expression EXP 6480464 Hydrogen Peroxide affects the expression of BMAL1 mRNA and Hydrogen Peroxide affects the expression of BMAL1 protein CTD PMID:29061316 and PMID:30316844 BMAL1 Human hydrogen peroxide multiple interactions ISO Bmal1 (Mus musculus) 6480464 BMAL1 protein affects the reaction [Polyphenols inhibits the reaction [Hydrogen Peroxide results in decreased expression of COX2 protein]] more ... CTD PMID:30316844 BMAL1 Human hydrogen peroxide multiple interactions EXP 6480464 [Gallic Acid co-treated with gallocatechol co-treated with epigallocatechin gallate co-treated with epicatechin gallate] affects the reaction [Hydrogen Peroxide affects the expression of BMAL1 mRNA] more ... CTD PMID:29061316 and PMID:30316844 BMAL1 Human Hypaconitine multiple interactions ISO Bmal1 (Mus musculus) 6480464 [BMAL1 protein affects the expression of CYP3A11 mRNA] which affects the susceptibility to hypaconitine and [BMAL1 protein affects the expression of CYP3A11 protein] which affects the metabolism of hypaconitine CTD PMID:31150629 BMAL1 Human Indeno[1,2,3-cd]pyrene decreases expression ISO Bmal1 (Mus musculus) 6480464 indeno(1 more ... CTD PMID:26377693 BMAL1 Human indole-3-methanol multiple interactions ISO Bmal1 (Rattus norvegicus) 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of BMAL1 mRNA CTD PMID:22129741 BMAL1 Human indometacin multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of BMAL1 mRNA CTD PMID:28628672 BMAL1 Human isoprenaline increases expression ISO Bmal1 (Mus musculus) 6480464 Isoproterenol results in increased expression of BMAL1 mRNA CTD PMID:20003209 BMAL1 Human L-methionine multiple interactions ISO Bmal1 (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of BMAL1 mRNA CTD PMID:29127188 BMAL1 Human lead diacetate multiple interactions ISO Bmal1 (Rattus norvegicus) 6480464 [lead acetate results in increased abundance of Lead] which results in decreased expression of BMAL1 mRNA CTD PMID:36642386 BMAL1 Human lead(0) affects expression EXP 6480464 Lead affects the expression of BMAL1 mRNA CTD PMID:28903495 BMAL1 Human lead(0) multiple interactions ISO Bmal1 (Rattus norvegicus) 6480464 [lead acetate results in increased abundance of Lead] which results in decreased expression of BMAL1 mRNA CTD PMID:36642386 BMAL1 Human lysophosphatidylcholine affects abundance ISO Bmal1 (Mus musculus) 6480464 BMAL1 gene mutant form affects the abundance of Lysophosphatidylcholines CTD PMID:27056296 BMAL1 Human manganese(II) chloride decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 manganese chloride results in decreased expression of BMAL1 mRNA CTD PMID:28511934 BMAL1 Human melatonin multiple interactions ISO Bmal1 (Rattus norvegicus) 6480464 Melatonin affects the reaction [Rotenone affects the expression of BMAL1 mRNA] and Melatonin inhibits the reaction [Cadmium Chloride affects the expression of BMAL1] CTD PMID:23085516 and PMID:25430725 BMAL1 Human metformin decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 Metformin results in decreased expression of BMAL1 mRNA CTD PMID:31324951 BMAL1 Human methamphetamine increases expression ISO Bmal1 (Rattus norvegicus) 6480464 Methamphetamine results in increased expression of BMAL1 mRNA and Methamphetamine results in increased expression of BMAL1 protein CTD PMID:35863504 BMAL1 Human methotrexate decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 Methotrexate results in decreased expression of BMAL1 mRNA CTD PMID:16005536 BMAL1 Human methotrexate affects expression ISO Bmal1 (Mus musculus) 6480464 Methotrexate affects the expression of BMAL1 mRNA CTD PMID:18502557 BMAL1 Human methotrexate decreases expression EXP 6480464 Methotrexate results in decreased expression of BMAL1 mRNA CTD PMID:24449571 BMAL1 Human methylarsonic acid multiple interactions ISO Bmal1 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of BMAL1 mRNA CTD PMID:34876320 BMAL1 Human milrinone decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 Milrinone results in decreased expression of BMAL1 mRNA CTD PMID:22936366 BMAL1 Human mitomycin C decreases expression ISO Bmal1 (Mus musculus) 6480464 Mitomycin results in decreased expression of BMAL1 mRNA CTD PMID:25270620 BMAL1 Human N-acetyl-L-cysteine multiple interactions ISO Bmal1 (Rattus norvegicus) 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of BMAL1 mRNA CTD PMID:22129741 BMAL1 Human N-nitrosodiethylamine multiple interactions ISO Bmal1 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of BMAL1 mRNA and [indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of BMAL1 mRNA CTD PMID:18164116 and PMID:22129741 BMAL1 Human NAD zwitterion decreases oxidation ISO Bmal1 (Mus musculus) 6480464 BMAL1 gene mutant form results in decreased oxidation of NAD CTD PMID:27056296 BMAL1 Human NAD(+) decreases oxidation ISO Bmal1 (Mus musculus) 6480464 BMAL1 gene mutant form results in decreased oxidation of NAD CTD PMID:27056296 BMAL1 Human nitrates multiple interactions ISO Bmal1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of BMAL1 mRNA CTD PMID:35964746 BMAL1 Human paracetamol affects expression ISO Bmal1 (Mus musculus) 6480464 Acetaminophen affects the expression of BMAL1 mRNA CTD PMID:17562736 BMAL1 Human paraquat increases expression ISO Bmal1 (Rattus norvegicus) 6480464 Paraquat results in increased expression of BMAL1 mRNA CTD PMID:32680482 BMAL1 Human perfluorooctane-1-sulfonic acid decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 perfluorooctane sulfonic acid results in decreased expression of BMAL1 mRNA CTD PMID:19162173 BMAL1 Human perfluorooctane-1-sulfonic acid multiple interactions ISO Bmal1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ARNTL mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of ARNTL mRNA CTD PMID:36331819 BMAL1 Human perfluorooctanoic acid decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 perfluorooctanoic acid results in decreased expression of BMAL1 mRNA CTD PMID:19162173 BMAL1 Human perfluorooctanoic acid multiple interactions ISO Bmal1 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of ARNTL mRNA CTD PMID:35163327 BMAL1 Human phenobarbital increases expression ISO Bmal1 (Mus musculus) 6480464 Phenobarbital results in increased expression of BMAL1 mRNA CTD PMID:19270015 BMAL1 Human phenobarbital affects expression ISO Bmal1 (Mus musculus) 6480464 Phenobarbital affects the expression of BMAL1 mRNA CTD PMID:23091169 BMAL1 Human phenobarbital decreases expression ISO Bmal1 (Mus musculus) 6480464 Phenobarbital results in decreased expression of BMAL1 mRNA CTD PMID:19270015 BMAL1 Human phosphatidylcholine increases abundance ISO Bmal1 (Mus musculus) 6480464 BMAL1 gene mutant form results in increased abundance of Phosphatidylcholines CTD PMID:27056296 BMAL1 Human pirinixic acid increases expression ISO Bmal1 (Mus musculus) 6480464 pirinixic acid results in increased expression of BMAL1 mRNA CTD PMID:18445702 and PMID:23811191 BMAL1 Human pirinixic acid decreases expression ISO Bmal1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of BMAL1 mRNA CTD PMID:17426115 BMAL1 Human potassium chromate decreases expression EXP 6480464 potassium chromate(VI) results in decreased expression of BMAL1 mRNA CTD PMID:22079256 BMAL1 Human potassium chromate multiple interactions EXP 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of BMAL1 mRNA CTD PMID:22079256 BMAL1 Human prednisolone increases expression EXP 6480464 Prednisolone results in increased expression of BMAL1 mRNA CTD PMID:16269518 BMAL1 Human prednisolone increases expression ISO Bmal1 (Mus musculus) 6480464 Prednisolone results in increased expression of BMAL1 mRNA CTD PMID:16269518 BMAL1 Human pregnenolone 16alpha-carbonitrile decreases expression ISO Bmal1 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of BMAL1 mRNA CTD PMID:27413110 BMAL1 Human progesterone increases expression EXP 6480464 Progesterone results in increased expression of BMAL1 mRNA CTD PMID:20096720 BMAL1 Human quercetin increases expression EXP 6480464 Quercetin results in increased expression of BMAL1 mRNA CTD PMID:21632981 BMAL1 Human resveratrol multiple interactions ISO Bmal1 (Mus musculus) 6480464 Resveratrol inhibits the reaction [Sodium Fluoride results in decreased expression of BMAL1 protein] CTD PMID:36063856 BMAL1 Human rotenone affects expression ISO Bmal1 (Rattus norvegicus) 6480464 Rotenone affects the expression of BMAL1 mRNA CTD PMID:25430725 BMAL1 Human rotenone decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 Rotenone results in decreased expression of BMAL1 mRNA CTD PMID:28374803 BMAL1 Human rotenone multiple interactions ISO Bmal1 (Rattus norvegicus) 6480464 [lipopolysaccharide more ... CTD PMID:25430725 and PMID:30328585 BMAL1 Human SB 431542 multiple interactions EXP 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of BMAL1 mRNA CTD PMID:27188386 BMAL1 Human Se-methyl-L-selenocysteine decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 selenomethylselenocysteine results in decreased expression of BMAL1 mRNA CTD PMID:19122877 BMAL1 Human Se-methylselenocysteine decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 selenomethylselenocysteine results in decreased expression of BMAL1 mRNA CTD PMID:19122877 BMAL1 Human sevoflurane affects expression ISO Bmal1 (Rattus norvegicus) 6480464 Sevoflurane affects the expression of BMAL1 mRNA CTD PMID:15967596 BMAL1 Human silicon dioxide increases expression ISO Bmal1 (Rattus norvegicus) 6480464 Silicon Dioxide results in increased expression of BMAL1 mRNA CTD PMID:32721576 BMAL1 Human silver atom decreases expression ISO Bmal1 (Mus musculus) 6480464 Silver results in decreased expression of BMAL1 mRNA CTD PMID:27131904 BMAL1 Human silver(0) decreases expression ISO Bmal1 (Mus musculus) 6480464 Silver results in decreased expression of BMAL1 mRNA CTD PMID:27131904 BMAL1 Human sodium arsenate multiple interactions ISO Bmal1 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of BMAL1 mRNA CTD PMID:34876320 BMAL1 Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of ARNTL mRNA and sodium arsenite results in decreased expression of BMAL1 mRNA CTD PMID:34032870 and PMID:38568856 BMAL1 Human sodium arsenite increases expression ISO Bmal1 (Mus musculus) 6480464 sodium arsenite results in increased expression of BMAL1 mRNA CTD PMID:18812580 BMAL1 Human sodium arsenite decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 sodium arsenite results in decreased expression of BMAL1 mRNA CTD PMID:35314868 BMAL1 Human sodium arsenite multiple interactions ISO Bmal1 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of BMAL1 mRNA CTD PMID:34876320 BMAL1 Human sodium fluoride multiple interactions ISO Bmal1 (Mus musculus) 6480464 Resveratrol inhibits the reaction [Sodium Fluoride results in decreased expression of BMAL1 protein] CTD PMID:36063856 BMAL1 Human sodium fluoride decreases expression ISO Bmal1 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of BMAL1 mRNA and Sodium Fluoride results in decreased expression of BMAL1 protein CTD PMID:36063856 BMAL1 Human streptozocin multiple interactions ISO Bmal1 (Mus musculus) 6480464 [Streptozocin co-treated with Dietary Fats] results in increased expression of BMAL1 mRNA CTD PMID:29127188 BMAL1 Human styrene decreases expression ISO Bmal1 (Mus musculus) 6480464 Styrene results in decreased expression of BMAL1 mRNA CTD PMID:28951217 BMAL1 Human sunitinib increases expression EXP 6480464 Sunitinib results in increased expression of BMAL1 mRNA CTD PMID:31533062 BMAL1 Human taurine increases abundance ISO Bmal1 (Mus musculus) 6480464 BMAL1 gene mutant form results in increased abundance of Taurine CTD PMID:27056296 BMAL1 Human testosterone increases expression EXP 6480464 Testosterone results in increased expression of BMAL1 mRNA CTD PMID:33359661 BMAL1 Human testosterone increases expression ISO Bmal1 (Mus musculus) 6480464 Testosterone results in increased expression of BMAL1 mRNA CTD PMID:22539767 BMAL1 Human tetrachloromethane increases expression ISO Bmal1 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in increased expression of BMAL1 mRNA CTD PMID:31150632 BMAL1 Human tetrachloromethane increases expression ISO Bmal1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of BMAL1 mRNA CTD PMID:31919559 BMAL1 Human tetrachloromethane multiple interactions ISO Bmal1 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of BMAL1 mRNA] CTD PMID:31150632 BMAL1 Human tetraphene decreases expression ISO Bmal1 (Mus musculus) 6480464 benz(a)anthracene results in decreased expression of BMAL1 mRNA CTD PMID:26377693 BMAL1 Human tetraphene multiple interactions ISO Bmal1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of BMAL1 mRNA CTD PMID:27858113 BMAL1 Human thioacetamide increases expression ISO Bmal1 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of BMAL1 mRNA CTD PMID:34492290 BMAL1 Human tioguanine decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 Thioguanine results in decreased expression of BMAL1 mRNA CTD PMID:16005536 BMAL1 Human titanium dioxide affects expression ISO Bmal1 (Rattus norvegicus) 6480464 titanium dioxide affects the expression of BMAL1 mRNA CTD PMID:30012374 BMAL1 Human titanium dioxide increases expression ISO Bmal1 (Mus musculus) 6480464 titanium dioxide results in increased expression of BMAL1 mRNA CTD PMID:23557971 BMAL1 Human titanium dioxide decreases methylation ISO Bmal1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ARNTL gene CTD PMID:35295148 BMAL1 Human tremolite asbestos increases expression ISO Bmal1 (Mus musculus) 6480464 tremolite results in increased expression of BMAL1 mRNA CTD PMID:29279043 BMAL1 Human tributylstannane decreases expression ISO Bmal1 (Mus musculus) 6480464 tributyltin results in decreased expression of BMAL1 mRNA CTD PMID:31939706 BMAL1 Human triphenyl phosphate decreases expression ISO Bmal1 (Rattus norvegicus) 6480464 triphenyl phosphate results in decreased expression of BMAL1 mRNA CTD PMID:30589522 BMAL1 Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of ARNTL mRNA CTD PMID:37042841 BMAL1 Human triptonide increases expression ISO Bmal1 (Mus musculus) 6480464 triptonide results in increased expression of BMAL1 mRNA CTD PMID:33045310 BMAL1 Human tris(2-butoxyethyl) phosphate affects expression EXP 6480464 tris(2-butoxyethyl) phosphate affects the expression of BMAL1 mRNA CTD PMID:29024780 BMAL1 Human urea increases abundance ISO Bmal1 (Mus musculus) 6480464 BMAL1 gene mutant form results in increased abundance of Urea CTD PMID:27056296 BMAL1 Human urethane increases expression EXP 6480464 Urethane results in increased expression of BMAL1 mRNA CTD PMID:28818685 BMAL1 Human valproic acid decreases methylation EXP 6480464 Valproic Acid results in decreased methylation of BMAL1 gene CTD PMID:29154799 BMAL1 Human valproic acid affects expression ISO Bmal1 (Mus musculus) 6480464 Valproic Acid affects the expression of BMAL1 mRNA CTD PMID:17963808 BMAL1 Human valproic acid increases expression ISO Bmal1 (Mus musculus) 6480464 Valproic Acid results in increased expression of BMAL1 mRNA CTD PMID:29229235 BMAL1 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of BMAL1 mRNA CTD PMID:23179753 more ... BMAL1 Human valproic acid multiple interactions EXP 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of BMAL1 mRNA CTD PMID:27188386 BMAL1 Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of BMAL1 mRNA CTD PMID:25979313 BMAL1 Human vinclozolin increases methylation ISO Bmal1 (Rattus norvegicus) 6480464 vinclozolin results in increased methylation of BMAL1 gene CTD PMID:31682807 BMAL1 Human vorinostat increases expression ISO Bmal1 (Mus musculus) 6480464 Vorinostat results in increased expression of BMAL1 mRNA CTD PMID:29229235 BMAL1 Human zinc atom multiple interactions EXP 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of BMAL1 mRNA CTD PMID:18593933 BMAL1 Human zinc(0) multiple interactions EXP 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of BMAL1 mRNA CTD PMID:18593933 BMAL1 Human zoledronic acid increases expression EXP 6480464 Zoledronic Acid results in increased expression of BMAL1 mRNA CTD PMID:20977926
(+)-epicatechin-3-O-gallate (EXP) (+)-schisandrin B (ISO) (-)-epigallocatechin 3-gallate (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1,3-dichloropropan-2-ol (EXP,ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-amino-2-deoxy-D-glucopyranose (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (ISO) 3-isobutyl-1-methyl-7H-xanthine (EXP) 4,4'-sulfonyldiphenol (ISO) 6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide (ISO) acrylamide (ISO) aflatoxin B1 (EXP) aldehydo-D-glucosamine (ISO) all-trans-retinoic acid (EXP,ISO) alpha-Zearalanol (ISO) amino acid (ISO) ammonium chloride (ISO) antirheumatic drug (EXP) aristolochic acid A (EXP) Aroclor 1254 (ISO) arsane (EXP) arsenic atom (EXP) atrazine (EXP,ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (EXP) benzo[b]fluoranthene (ISO) Benzo[k]fluoranthene (ISO) beta-D-glucosamine (ISO) beta-lapachone (EXP) beta-naphthoflavone (EXP,ISO) bezafibrate (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) bromobenzene (ISO) C60 fullerene (ISO) cadmium dichloride (ISO) calcium silicate (ISO) cannabidiol (ISO) carbon nanotube (ISO) carmustine (ISO) carnosine (ISO) casticin (ISO) CGP 52608 (EXP) CGS-21680 (EXP) chloroprene (ISO) choline (ISO) chrysene (ISO) cisplatin (ISO) clofibrate (ISO) cocaine (ISO) cocaine hydrochloride (ISO) colforsin daropate hydrochloride (ISO) copper atom (EXP) copper(0) (EXP) copper(II) sulfate (EXP) cortisol (EXP) creatinine (ISO) cyclosporin A (EXP) DDE (EXP) deoxynivalenol (ISO) dexamethasone (EXP,ISO) dibenz[a,h]anthracene (ISO) Dibutyl phosphate (EXP) dichloromethane (ISO) dimethylarsinic acid (ISO) dioxygen (ISO) dorsomorphin (EXP) doxorubicin (EXP,ISO) entinostat (EXP) epoxiconazole (ISO) Erionite (ISO) flavonoids (ISO) fluoxetine (ISO) folic acid (ISO) furan (ISO) furosemide (ISO) gadolinium atom (EXP) gadolinium trichloride (EXP) gallic acid (EXP) gallocatechin (EXP) geraniol (EXP) glyphosate (ISO) gold atom (ISO) gold(0) (ISO) graphene oxide (ISO) hexadecanoic acid (ISO) hydrogen peroxide (EXP,ISO) Hypaconitine (ISO) Indeno[1,2,3-cd]pyrene (ISO) indole-3-methanol (ISO) indometacin (EXP) isoprenaline (ISO) L-methionine (ISO) lead diacetate (ISO) lead(0) (EXP,ISO) lysophosphatidylcholine (ISO) manganese(II) chloride (ISO) melatonin (ISO) metformin (ISO) methamphetamine (ISO) methotrexate (EXP,ISO) methylarsonic acid (ISO) milrinone (ISO) mitomycin C (ISO) N-acetyl-L-cysteine (ISO) N-nitrosodiethylamine (ISO) NAD zwitterion (ISO) NAD(+) (ISO) nitrates (ISO) paracetamol (ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) phosphatidylcholine (ISO) pirinixic acid (ISO) potassium chromate (EXP) prednisolone (EXP,ISO) pregnenolone 16alpha-carbonitrile (ISO) progesterone (EXP) quercetin (EXP) resveratrol (ISO) rotenone (ISO) SB 431542 (EXP) Se-methyl-L-selenocysteine (ISO) Se-methylselenocysteine (ISO) sevoflurane (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sodium fluoride (ISO) streptozocin (ISO) styrene (ISO) sunitinib (EXP) taurine (ISO) testosterone (EXP,ISO) tetrachloromethane (ISO) tetraphene (ISO) thioacetamide (ISO) tioguanine (ISO) titanium dioxide (ISO) tremolite asbestos (ISO) tributylstannane (ISO) triphenyl phosphate (EXP,ISO) triptonide (ISO) tris(2-butoxyethyl) phosphate (EXP) urea (ISO) urethane (EXP) valproic acid (EXP,ISO) vinclozolin (ISO) vorinostat (ISO) zinc atom (EXP) zinc(0) (EXP) zoledronic acid (EXP)
1.
Clock genes polymorphisms in male bipolar patients with comorbid alcohol abuse.
Banach E, etal., J Affect Disord. 2018 Dec 1;241:142-146. doi: 10.1016/j.jad.2018.07.080. Epub 2018 Jul 31.
2.
Mop3 is an essential component of the master circadian pacemaker in mammals.
Bunger MK, etal., Cell 2000 Dec 22;103(7):1009-17.
3.
GOAs Human GO annotations
GOA_HUMAN data from the GO Consortium
4.
Reduced expression of circadian clock genes in male alcoholic patients.
Huang MC, etal., Alcohol Clin Exp Res. 2010 Nov;34(11):1899-904. doi: 10.1111/j.1530-0277.2010.01278.x. Epub 2010 Aug 24.
5.
Early aging and age-related pathologies in mice deficient in BMAL1, the core componentof the circadian clock.
Kondratov RV, etal., Genes Dev. 2006 Jul 15;20(14):1868-73.
6.
Circadian clock gene polymorphisms in alcohol use disorders and alcohol consumption.
Kovanen L, etal., Alcohol Alcohol. 2010 Jul-Aug;45(4):303-11. doi: 10.1093/alcalc/agq035. Epub 2010 Jun 16.
7.
[Changes of biological clock protein in neonatal rats with hypoxic-ischemic brain damage].
Li YF, etal., Zhongguo Dang Dai Er Ke Za Zhi. 2013 Jan;15(1):62-6.
8.
Increased melatonin synthesis in pineal glands of rats in streptozotocin induced type 1 diabetes.
Peschke E, etal., J Pineal Res. 2008 Jul 1.
9.
Melatonin inhibits cholangiocyte hyperplasia in cholestatic rats by interaction with MT1 but not MT2 melatonin receptors.
Renzi A, etal., Am J Physiol Gastrointest Liver Physiol. 2011 Oct;301(4):G634-43. doi: 10.1152/ajpgi.00206.2011. Epub 2011 Jul 14.
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Effect of fluoxetine and cocaine on the expression of clock genes in the mouse hippocampus and striatum.
Uz T, etal., Neuroscience. 2005;134(4):1309-16. doi: 10.1016/j.neuroscience.2005.05.003.
BMAL1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 13,276,652 - 13,387,266 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 13,276,652 - 13,387,266 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 13,298,199 - 13,408,813 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 13,255,901 - 13,365,389 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 13,255,925 - 13,365,386 NCBI Celera 11 13,425,472 - 13,534,997 (+) NCBI Celera Cytogenetic Map 11 p15.3 NCBI HuRef 11 12,979,421 - 13,089,003 (+) NCBI HuRef CHM1_1 11 13,298,302 - 13,407,784 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 13,369,378 - 13,480,010 (+) NCBI T2T-CHM13v2.0
Bmal1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 112,777,820 - 112,913,333 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 112,806,672 - 112,913,333 (+) Ensembl GRCm39 Ensembl GRCm38 7 113,178,471 - 113,314,126 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 113,207,465 - 113,314,126 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 120,350,979 - 120,457,636 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 112,998,646 - 113,105,303 (+) NCBI MGSCv36 mm8 Celera 7 113,186,397 - 113,287,835 (+) NCBI Celera Cytogenetic Map 7 F1 NCBI cM Map 7 59.17 NCBI
Bmal1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 176,766,222 - 176,864,741 (+) NCBI GRCr8 mRatBN7.2 1 167,331,756 - 167,430,235 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 167,331,633 - 167,430,231 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 175,666,810 - 175,765,622 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 182,852,900 - 182,951,712 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 175,548,108 - 175,646,871 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 178,039,002 - 178,137,469 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 178,039,063 - 178,137,465 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 185,007,527 - 185,105,413 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 171,062,181 - 171,162,426 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 171,251,951 - 171,282,040 (+) NCBI Celera 1 165,202,275 - 165,299,946 (+) NCBI Celera Cytogenetic Map 1 q33 NCBI
Bmal1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955414 28,684,226 - 28,748,360 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955414 28,652,663 - 28,748,360 (+) NCBI ChiLan1.0 ChiLan1.0
BMAL1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 15,716,032 - 15,825,471 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 15,678,367 - 15,788,400 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 13,436,580 - 13,547,135 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 13,163,028 - 13,240,376 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 13,163,028 - 13,240,376 (+) Ensembl panpan1.1 panPan2
ARNTL Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 21 36,254,235 - 36,323,915 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 21 36,290,070 - 36,323,622 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 21 35,726,263 - 35,827,668 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 21 37,105,577 - 37,207,038 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 21 37,105,604 - 37,207,069 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 21 36,364,101 - 36,465,527 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 21 36,540,532 - 36,641,924 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 21 36,829,310 - 36,930,753 (+) NCBI UU_Cfam_GSD_1.0
Bmal1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 49,133,675 - 49,231,340 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936528 5,164,481 - 5,239,128 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936528 5,167,611 - 5,239,128 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ARNTL Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 45,895,289 - 45,988,570 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 45,895,637 - 46,025,174 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 49,303,279 - 49,335,397 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BMAL1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 51,430,670 - 51,540,344 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 51,431,180 - 51,462,674 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 149,016,016 - 149,124,776 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Bmal1
.
Confirmed Target Of
MIR142 hsa-miR-142-3p Mirtarbase external_info Luciferase reporter assay//qRT-PCR Functional MTI 21799909 MIR142 hsa-miR-142-3p Mirtarbase external_info Luciferase reporter assay Functional MTI 22958478 MIR142 hsa-miR-142-3p Mirtarbase external_info Microarray Functional MTI (Weak) 17612493 MIR494 hsa-miR-494-3p Mirtarbase external_info Luciferase reporter assay//qRT-PCR Functional MTI 21799909 MIR155 hsa-miR-155-5p Mirtarbase external_info Proteomics Functional MTI (Weak) 20584899
Predicted Target Of
Count of predictions: 4914 Count of miRNA genes: 1096 Interacting mature miRNAs: 1371 Transcripts: ENST00000361003, ENST00000389707, ENST00000389708, ENST00000396441, ENST00000401424, ENST00000403290, ENST00000403482, ENST00000403510, ENST00000472842, ENST00000480685, ENST00000482049, ENST00000485918, ENST00000497429, ENST00000524392, ENST00000527998, ENST00000529050, ENST00000529388, ENST00000529390, ENST00000529825, ENST00000530357, ENST00000531665, ENST00000533520, ENST00000534102, ENST00000534544 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
407055938 GWAS704914_H hematocrit QTL GWAS704914 (human) 4e-17 hematocrit hematocrit (CMO:0000037) 11 13314379 13314380 Human 597031570 GWAS1127644_H progesterone measurement QTL GWAS1127644 (human) 2e-08 progesterone measurement 11 13341732 13341733 Human 597146012 GWAS1242086_H osteoarthritis, knee QTL GWAS1242086 (human) 8e-12 osteoarthritis, knee 11 13307432 13307433 Human 597336727 GWAS1432801_H C-reactive protein measurement QTL GWAS1432801 (human) 2e-39 C-reactive protein measurement blood C-reactive protein level (CMO:0003160) 11 13339977 13339978 Human 597086616 GWAS1182690_H type 2 diabetes mellitus QTL GWAS1182690 (human) 1e-09 type 2 diabetes mellitus 11 13319163 13319164 Human 407001933 GWAS650909_H age at menarche QTL GWAS650909 (human) 7e-20 age at menarche 11 13293892 13293893 Human 597155975 GWAS1252049_H sex hormone-binding globulin measurement QTL GWAS1252049 (human) 2e-12 sex hormone-binding globulin measurement 11 13339458 13339459 Human 597035655 GWAS1131729_H triglyceride measurement QTL GWAS1131729 (human) 3e-20 triglyceride measurement blood triglyceride level (CMO:0000118) 11 13339977 13339978 Human 597148547 GWAS1244621_H educational attainment QTL GWAS1244621 (human) 0.0000004 educational attainment 11 13307592 13307593 Human 597148546 GWAS1244620_H educational attainment QTL GWAS1244620 (human) 3e-08 educational attainment 11 13282382 13282383 Human 597106826 GWAS1202900_H testosterone measurement QTL GWAS1202900 (human) 2e-09 blood triglyceride amount (VT:0002644) serum testosterone level (CMO:0000568) 11 13339977 13339978 Human 597340804 GWAS1436878_H body mass index QTL GWAS1436878 (human) 6e-18 body mass index body mass index (BMI) (CMO:0000105) 11 13280328 13280329 Human 597157001 GWAS1253075_H sex hormone-binding globulin measurement QTL GWAS1253075 (human) 9e-17 sex hormone-binding globulin measurement 11 13339458 13339459 Human 597310909 GWAS1406983_H erythrocyte count QTL GWAS1406983 (human) 1e-11 erythrocyte count red blood cell count (CMO:0000025) 11 13314379 13314380 Human 597329331 GWAS1425405_H osteoarthritis QTL GWAS1425405 (human) 0.0000002 osteoarthritis 11 13309777 13309778 Human 597189809 GWAS1285883_H free androgen index QTL GWAS1285883 (human) 1e-08 sex hormone-binding globulin measurement 11 13339458 13339459 Human 407368556 GWAS1017532_H iron biomarker measurement, transferrin measurement QTL GWAS1017532 (human) 4e-10 iron biomarker measurement, transferrin measurement 11 13334223 13334224 Human 597107644 GWAS1203718_H sex hormone-binding globulin measurement QTL GWAS1203718 (human) 5e-24 sex hormone-binding globulin measurement 11 13339458 13339459 Human 597339831 GWAS1435905_H wellbeing measurement QTL GWAS1435905 (human) 2e-08 wellness/fitness trait (VT:1000152) 11 13298291 13298292 Human 597213110 GWAS1309184_H high density lipoprotein cholesterol measurement QTL GWAS1309184 (human) 1e-10 high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 11 13334223 13334224 Human 597114285 GWAS1210359_H psoriasis QTL GWAS1210359 (human) 0.000007 psoriasis 11 13335636 13335637 Human 597283746 GWAS1379820_H diastolic blood pressure QTL GWAS1379820 (human) 1e-13 diastolic blood pressure diastolic blood pressure (CMO:0000005) 11 13279788 13279789 Human 597135786 GWAS1231860_H smoking initiation QTL GWAS1231860 (human) 2e-09 smoking initiation 11 13326702 13326703 Human 597045416 GWAS1141490_H systolic blood pressure QTL GWAS1141490 (human) 0.0000001 systolic blood pressure systolic blood pressure (CMO:0000004) 11 13334483 13334484 Human 597142953 GWAS1239027_H low density lipoprotein cholesterol measurement QTL GWAS1239027 (human) 3e-11 low density lipoprotein cholesterol measurement blood low density lipoprotein cholesterol level (CMO:0000053) 11 13341268 13341269 Human 597140695 GWAS1236769_H bilirubin measurement QTL GWAS1236769 (human) 2e-08 bilirubin measurement serum total bilirubin level (CMO:0000376) 11 13339977 13339978 Human 597027543 GWAS1123617_H mean arterial pressure QTL GWAS1123617 (human) 0.0000008 mean arterial pressure mean arterial blood pressure (CMO:0000009) 11 13278705 13278706 Human 597320408 GWAS1416482_H triglyceride measurement QTL GWAS1416482 (human) 2e-20 triglyceride measurement blood triglyceride level (CMO:0000118) 11 13339977 13339978 Human 597189598 GWAS1285672_H sex hormone-binding globulin measurement QTL GWAS1285672 (human) 3e-15 sex hormone-binding globulin measurement 11 13339458 13339459 Human 597030610 GWAS1126684_H body mass index QTL GWAS1126684 (human) 2e-18 body mass index body mass index (BMI) (CMO:0000105) 11 13328584 13328585 Human 597108190 GWAS1204264_H C-reactive protein measurement QTL GWAS1204264 (human) 4e-12 total cholesterol measurement, triglyceride measurement, low density lipoprotein cholesterol measurement, high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 11 13335636 13335637 Human 597049817 GWAS1145891_H erythrocyte count QTL GWAS1145891 (human) 7e-12 erythrocyte count red blood cell count (CMO:0000025) 11 13324046 13324047 Human 597173960 GWAS1270034_H body mass index QTL GWAS1270034 (human) 4e-26 body mass index body mass index (BMI) (CMO:0000105) 11 13328584 13328585 Human 597143238 GWAS1239312_H high density lipoprotein cholesterol measurement QTL GWAS1239312 (human) 1e-09 high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 11 13339977 13339978 Human 596961223 GWAS1080742_H metabolic syndrome QTL GWAS1080742 (human) 1e-21 metabolic syndrome 11 13339977 13339978 Human 1559107 SCL32_H Serum cholesterol level QTL 32 (human) 3.27 Lipid level LDL cholesterol 11 2892430 28892430 Human 407073303 GWAS722279_H triglyceride measurement, alcohol drinking QTL GWAS722279 (human) 5e-10 triglyceride measurement, alcohol drinking blood triglyceride level (CMO:0000118) 11 13338198 13338199 Human 597242572 GWAS1338646_H sex hormone-binding globulin measurement QTL GWAS1338646 (human) 3e-18 sex hormone-binding globulin measurement 11 13345175 13345176 Human 597318339 GWAS1414413_H diet measurement QTL GWAS1414413 (human) 1e-12 eating behavior trait (VT:0001431) food intake measurement (CMO:0000772) 11 13328584 13328585 Human 597045452 GWAS1141526_H triglyceride measurement QTL GWAS1141526 (human) 6e-14 triglyceride measurement blood triglyceride level (CMO:0000118) 11 13334483 13334484 Human 597241795 GWAS1337869_H triglyceride measurement QTL GWAS1337869 (human) 8e-13 triglyceride measurement blood triglyceride level (CMO:0000118) 11 13345175 13345176 Human 597090765 GWAS1186839_H mammographic density percentage QTL GWAS1186839 (human) 0.0000001 mammographic density percentage 11 13292555 13292562 Human 597341639 GWAS1437713_H osteoarthritis QTL GWAS1437713 (human) 0.000002 osteoarthritis 11 13309777 13309778 Human 597072075 GWAS1168149_H guilt measurement QTL GWAS1168149 (human) 8e-12 guilt measurement 11 13310261 13310262 Human 1559113 SCL31_H Serum cholesterol level QTL 31 (human) 3.72 Lipid level LDL cholesterol 11 2892430 28892430 Human 597040118 GWAS1136192_H diet measurement QTL GWAS1136192 (human) 2e-10 eating behavior trait (VT:0001431) food intake measurement (CMO:0000772) 11 13304148 13304149 Human 597243640 GWAS1339714_H triglyceride measurement QTL GWAS1339714 (human) 8e-08 triglyceride measurement blood triglyceride level (CMO:0000118) 11 13280328 13280329 Human 597090551 GWAS1186625_H mammographic density measurement QTL GWAS1186625 (human) 8e-10 mammographic density measurement 11 13292555 13292562 Human 597227516 GWAS1323590_H worry measurement QTL GWAS1323590 (human) 7e-09 worry measurement 11 13297040 13297041 Human 597227517 GWAS1323591_H worry measurement QTL GWAS1323591 (human) 7e-11 worry measurement 11 13314379 13314380 Human 407388450 GWAS1037426_H triglyceride measurement, C-reactive protein measurement QTL GWAS1037426 (human) 9e-09 triglyceride measurement, C-reactive protein measurement blood C-reactive protein level (CMO:0003160) 11 13335636 13335637 Human 597092858 GWAS1188932_H circadian rhythm QTL GWAS1188932 (human) 0.000009 circadian rhythm 11 13323098 13323099 Human 597242100 GWAS1338174_H body fat percentage QTL GWAS1338174 (human) 5e-14 body fat mass (VT:0010482) body fat percentage (CMO:0000302) 11 13280328 13280329 Human 597144570 GWAS1240644_H body mass index QTL GWAS1240644 (human) 1e-08 body mass index body mass index (BMI) (CMO:0000105) 11 13307432 13307433 Human 597162234 GWAS1258308_H citrate measurement QTL GWAS1258308 (human) 9e-11 citrate measurement 11 13338198 13338199 Human 597099258 GWAS1195332_H sex hormone-binding globulin measurement QTL GWAS1195332 (human) 1e-41 sex hormone-binding globulin measurement 11 13339458 13339459 Human 597059320 GWAS1155394_H age at menarche QTL GWAS1155394 (human) 1e-30 age at menarche 11 13296977 13296978 Human 407053868 GWAS702844_H hemoglobin measurement QTL GWAS702844 (human) 3e-15 hemoglobin measurement hemoglobin measurement (CMO:0000508) 11 13309777 13309778 Human 597025763 GWAS1121837_H alcohol drinking, high density lipoprotein cholesterol measurement QTL GWAS1121837 (human) 0.000004 alcohol drinking, high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 11 13338198 13338199 Human 597237472 GWAS1333546_H C-reactive protein measurement QTL GWAS1333546 (human) 1e-43 C-reactive protein measurement blood C-reactive protein level (CMO:0003160) 11 13339977 13339978 Human 597244645 GWAS1340719_H sex hormone-binding globulin measurement QTL GWAS1340719 (human) 1e-18 sex hormone-binding globulin measurement 11 13280328 13280329 Human 597203431 GWAS1299505_H neuroticism measurement QTL GWAS1299505 (human) 4e-12 neuroticism measurement 11 13314379 13314380 Human 1576345 LVC1_H Left ventricular contractility QTL 1 (human) 3.93 Left ventricular contractility 11 7970767 33970767 Human 2289313 BW388_H Body weight QTL 388 (human) 1.57 0.00356 Body fat amount abdominal 11 4434671 30434671 Human 597254684 GWAS1350758_H C-reactive protein measurement QTL GWAS1350758 (human) 8e-18 C-reactive protein measurement blood C-reactive protein level (CMO:0003160) 11 13345175 13345176 Human 597295644 GWAS1391718_H hematocrit QTL GWAS1391718 (human) 4e-10 hematocrit hematocrit (CMO:0000037) 11 13314379 13314380 Human 407055306 GWAS704282_H hemoglobin measurement QTL GWAS704282 (human) 2e-12 hemoglobin measurement hemoglobin measurement (CMO:0000508) 11 13312304 13312305 Human 597062943 GWAS1159017_H triglyceride measurement QTL GWAS1159017 (human) 0.0000003 triglyceride measurement blood triglyceride level (CMO:0000118) 11 13338198 13338199 Human 597074972 GWAS1171046_H coronary artery disease QTL GWAS1171046 (human) 5e-08 coronary artery disease 11 13281524 13281525 Human 597026841 GWAS1122915_H body mass index QTL GWAS1122915 (human) 5e-18 body mass index body mass index (BMI) (CMO:0000105) 11 13324747 13324748 Human 407382982 GWAS1031958_H neurotic disorder QTL GWAS1031958 (human) 3e-09 neurotic disorder 11 13293658 13293659 Human 597349141 GWAS1445215_H body mass index QTL GWAS1445215 (human) 8e-10 body mass index body mass index (BMI) (CMO:0000105) 11 13327930 13327931 Human 597026565 GWAS1122639_H asparaginase hypersensitivity QTL GWAS1122639 (human) 0.000007 asparaginase hypersensitivity 11 13341732 13341733 Human 407012819 GWAS661795_H body mass index QTL GWAS661795 (human) 0.000008 body mass index body mass index (BMI) (CMO:0000105) 11 13324046 13324047 Human 597240075 GWAS1336149_H aspartate aminotransferase measurement, serum alanine aminotransferase measurement, low density lipoprotein triglyceride measurement, body fat percentage, high density lipoprotein cholesterol measurement, sex hormone-binding globulin measurement QTL GWAS1336149 (human) 1e-12 body fat mass (VT:0010482) blood high density lipoprotein cholesterol level (CMO:0000052) 11 13280328 13280329 Human 597337353 GWAS1433427_H osteoarthritis QTL GWAS1433427 (human) 0.0000003 osteoarthritis 11 13309777 13309778 Human 406967253 GWAS616229_H schizophrenia QTL GWAS616229 (human) 0.000005 schizophrenia 11 13309679 13309680 Human 597100547 GWAS1196621_H sex hormone-binding globulin measurement QTL GWAS1196621 (human) 4e-16 sex hormone-binding globulin measurement 11 13339458 13339459 Human 597071875 GWAS1167949_H feeling miserable measurement QTL GWAS1167949 (human) 9e-09 feeling miserable measurement 11 13304148 13304149 Human 597040908 GWAS1136982_H triglyceride measurement QTL GWAS1136982 (human) 2e-16 triglyceride measurement blood triglyceride level (CMO:0000118) 11 13339977 13339978 Human 597157386 GWAS1253460_H triglyceride:HDL cholesterol ratio QTL GWAS1253460 (human) 7e-13 blood triglyceride amount (VT:0002644) 11 13339977 13339978 Human 597108790 GWAS1204864_H C-reactive protein measurement QTL GWAS1204864 (human) 3e-08 C-reactive protein measurement blood C-reactive protein level (CMO:0003160) 11 13335636 13335637 Human 597091893 GWAS1187967_H body mass index QTL GWAS1187967 (human) 0.000006 body mass index body mass index (BMI) (CMO:0000105) 11 13324046 13324047 Human 597281594 GWAS1377668_H sex hormone-binding globulin measurement QTL GWAS1377668 (human) 8e-10 sex hormone-binding globulin measurement 11 13334483 13334484 Human 597194812 GWAS1290886_H free androgen index QTL GWAS1290886 (human) 2e-09 free androgen index 11 13339458 13339459 Human 597172287 GWAS1268361_H body mass index QTL GWAS1268361 (human) 8e-13 body mass index body mass index (BMI) (CMO:0000105) 11 13304148 13304149 Human 597048126 GWAS1144200_H neuroticism measurement QTL GWAS1144200 (human) 6e-12 neuroticism measurement 11 13307432 13307433 Human 597225522 GWAS1321596_H body mass index QTL GWAS1321596 (human) 8e-15 body mass index body mass index (BMI) (CMO:0000105) 11 13298986 13298987 Human 597025854 GWAS1121928_H triglyceride measurement QTL GWAS1121928 (human) 7e-13 triglyceride measurement blood triglyceride level (CMO:0000118) 11 13338198 13338199 Human 597607728 GWAS1664588_H triglyceride measurement QTL GWAS1664588 (human) 1e-18 triglyceride measurement blood triglyceride level (CMO:0000118) 11 13335636 13335637 Human 597083942 GWAS1180016_H coronary artery disease QTL GWAS1180016 (human) 3e-09 coronary artery disease 11 13281538 13281539 Human 597225513 GWAS1321587_H chronotype measurement QTL GWAS1321587 (human) 5e-10 sleep behavior trait (VT:0001501) 11 13292555 13292562 Human 597339179 GWAS1435253_H puberty onset measurement QTL GWAS1435253 (human) 5e-10 puberty onset measurement 11 13298291 13298292 Human 407386623 GWAS1035599_H hematocrit QTL GWAS1035599 (human) 2e-14 hematocrit hematocrit (CMO:0000037) 11 13312304 13312305 Human 407060730 GWAS709706_H tea consumption measurement QTL GWAS709706 (human) 1e-09 tea consumption measurement drink intake measurement (CMO:0000771) 11 13286075 13286076 Human 407376882 GWAS1025858_H triglyceride measurement, alcohol drinking QTL GWAS1025858 (human) 2e-14 triglyceride measurement, alcohol drinking blood triglyceride level (CMO:0000118) 11 13338198 13338199 Human 597066285 GWAS1162359_H triglyceride measurement QTL GWAS1162359 (human) 1e-09 triglyceride measurement blood triglyceride level (CMO:0000118) 11 13338198 13338199 Human 597146922 GWAS1242996_H triglyceride measurement QTL GWAS1242996 (human) 4e-14 triglyceride measurement blood triglyceride level (CMO:0000118) 11 13339977 13339978 Human 597226023 GWAS1322097_H chronotype measurement QTL GWAS1322097 (human) 9e-09 sleep behavior trait (VT:0001501) 11 13298347 13298348 Human 597603167 GWAS1660027_H type 2 diabetes mellitus QTL GWAS1660027 (human) 1e-12 type 2 diabetes mellitus 11 13298347 13298348 Human 597266266 GWAS1362340_H triglyceride measurement QTL GWAS1362340 (human) 4e-32 triglyceride measurement blood triglyceride level (CMO:0000118) 11 13339977 13339978 Human 407221635 GWAS870611_H plasminogen activator inhibitor 1 measurement QTL GWAS870611 (human) 2e-10 plasminogen activator inhibitor 1 measurement blood plasminogen activator inhibitor 1 level (CMO:0003034) 11 13339977 13339978 Human 597328722 GWAS1424796_H osteoarthritis QTL GWAS1424796 (human) 6e-08 osteoarthritis 11 13309777 13309778 Human 597060445 GWAS1156519_H metabolic syndrome QTL GWAS1156519 (human) 1e-21 metabolic syndrome 11 13339977 13339978 Human 597047898 GWAS1143972_H C-reactive protein measurement QTL GWAS1143972 (human) 3e-39 C-reactive protein measurement blood C-reactive protein level (CMO:0003160) 11 13339977 13339978 Human 407375749 GWAS1024725_H metabolic syndrome QTL GWAS1024725 (human) 8e-09 metabolic syndrome 11 13326201 13326208 Human 597620307 GWAS1677167_H triglyceride measurement QTL GWAS1677167 (human) 4e-11 triglyceride measurement blood triglyceride level (CMO:0000118) 11 13335636 13335637 Human 597113689 GWAS1209763_H erythrocyte count QTL GWAS1209763 (human) 2e-20 erythrocyte count red blood cell count (CMO:0000025) 11 13324046 13324047 Human 597182039 GWAS1278113_H body mass index QTL GWAS1278113 (human) 4e-18 body mass index body mass index (BMI) (CMO:0000105) 11 13304148 13304149 Human 597264200 GWAS1360274_H triglyceride measurement QTL GWAS1360274 (human) 3e-22 triglyceride measurement blood triglyceride level (CMO:0000118) 11 13339458 13339459 Human 597304904 GWAS1400978_H coronary artery disease QTL GWAS1400978 (human) 1e-08 coronary artery disease 11 13280001 13280002 Human 597337928 GWAS1434002_H puberty onset measurement QTL GWAS1434002 (human) 0.000006 puberty onset measurement 11 13298291 13298292 Human 407369364 GWAS1018340_H diastolic blood pressure QTL GWAS1018340 (human) 2e-08 diastolic blood pressure diastolic blood pressure (CMO:0000005) 11 13278705 13278706 Human 597038149 GWAS1134223_H diastolic blood pressure QTL GWAS1134223 (human) 0.0000004 diastolic blood pressure diastolic blood pressure (CMO:0000005) 11 13278705 13278706 Human 597284170 GWAS1380244_H C-reactive protein measurement QTL GWAS1380244 (human) 3e-29 C-reactive protein measurement blood C-reactive protein level (CMO:0003160) 11 13339977 13339978 Human 597098562 GWAS1194636_H sex hormone-binding globulin measurement QTL GWAS1194636 (human) 4e-20 sex hormone-binding globulin measurement 11 13339458 13339459 Human 597314892 GWAS1410966_H bilirubin measurement QTL GWAS1410966 (human) 6e-20 bilirubin measurement serum total bilirubin level (CMO:0000376) 11 13334483 13334484 Human 597048129 GWAS1144203_H neuroticism measurement QTL GWAS1144203 (human) 6e-09 neuroticism measurement 11 13339458 13339459 Human 596966220 GWAS1085739_H body mass index QTL GWAS1085739 (human) 2e-17 body mass index 11 13280328 13280329 Human 597284675 GWAS1380749_H hemoglobin measurement QTL GWAS1380749 (human) 2e-10 hemoglobin measurement hemoglobin measurement (CMO:0000508) 11 13314379 13314380 Human 597144909 GWAS1240983_H smoking initiation QTL GWAS1240983 (human) 5e-11 smoking initiation 11 13324747 13324748 Human 597281602 GWAS1377676_H sex hormone-binding globulin measurement QTL GWAS1377676 (human) 3e-09 sex hormone-binding globulin measurement 11 13338198 13338199 Human 597025397 GWAS1121471_H triglyceride measurement QTL GWAS1121471 (human) 2e-08 triglyceride measurement blood triglyceride level (CMO:0000118) 11 13338198 13338199 Human 597051763 GWAS1147837_H hematocrit QTL GWAS1147837 (human) 3e-17 hematocrit hematocrit (CMO:0000037) 11 13312304 13312305 Human 597262204 GWAS1358278_H high density lipoprotein cholesterol measurement QTL GWAS1358278 (human) 1e-08 high density lipoprotein cholesterol measurement blood high density lipoprotein cholesterol level (CMO:0000052) 11 13334223 13334224 Human 597278847 GWAS1374921_H sex hormone-binding globulin measurement QTL GWAS1374921 (human) 9e-11 sex hormone-binding globulin measurement 11 13339458 13339459 Human 597073777 GWAS1169851_H coronary artery disease QTL GWAS1169851 (human) 9e-09 coronary artery disease 11 13281538 13281539 Human 597096831 GWAS1192905_H testosterone measurement QTL GWAS1192905 (human) 6e-09 testosterone measurement serum testosterone level (CMO:0000568) 11 13304148 13304149 Human 597339504 GWAS1435578_H complex trait QTL GWAS1435578 (human) 4e-08 complex trait 11 13339458 13339459 Human 597316971 GWAS1413045_H body mass index QTL GWAS1413045 (human) 2e-17 body mass index body mass index (BMI) (CMO:0000105) 11 13280328 13280329 Human 407380921 GWAS1029897_H hemoglobin measurement QTL GWAS1029897 (human) 1e-15 hemoglobin measurement hemoglobin measurement (CMO:0000508) 11 13314379 13314380 Human 597189482 GWAS1285556_H sex hormone-binding globulin measurement QTL GWAS1285556 (human) 2e-20 sex hormone-binding globulin measurement 11 13339458 13339459 Human 597105763 GWAS1201837_H sex hormone-binding globulin measurement QTL GWAS1201837 (human) 1e-24 sex hormone-binding globulin measurement 11 13339458 13339459 Human 597241708 GWAS1337782_H bilirubin measurement QTL GWAS1337782 (human) 1e-10 bilirubin measurement serum total bilirubin level (CMO:0000376) 11 13345175 13345176 Human 597329004 GWAS1425078_H osteoarthritis QTL GWAS1425078 (human) 1e-09 osteoarthritis 11 13309777 13309778 Human 597099873 GWAS1195947_H body mass index QTL GWAS1195947 (human) 4e-17 body mass index body mass index (BMI) (CMO:0000105) 11 13328012 13328013 Human 407074741 GWAS723717_H triglyceride measurement QTL GWAS723717 (human) 4e-10 triglyceride measurement blood triglyceride level (CMO:0000118) 11 13338198 13338199 Human 597040750 GWAS1136824_H diet measurement QTL GWAS1136824 (human) 2e-09 eating behavior trait (VT:0001431) food intake measurement (CMO:0000772) 11 13312304 13312305 Human 597095787 GWAS1191861_H sex hormone-binding globulin measurement QTL GWAS1191861 (human) 2e-44 sex hormone-binding globulin measurement 11 13339458 13339459 Human 597198950 GWAS1295024_H bilirubin measurement QTL GWAS1295024 (human) 2e-08 bilirubin measurement serum total bilirubin level (CMO:0000376) 11 13334483 13334484 Human
D6S1560
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 33,554,695 - 33,554,928 UniSTS GRCh37 Build 36 6 33,662,673 - 33,662,906 RGD NCBI36 Celera 6 35,109,074 - 35,109,307 RGD HuRef 6 33,296,158 - 33,296,391 UniSTS HuRef 11 13,045,939 - 13,046,452 UniSTS HuRef 11 121,219,431 - 121,219,625 UniSTS Marshfield Genetic Map 6 47.71 RGD Genethon Genetic Map 6 47.6 UniSTS deCODE Assembly Map 6 52.75 UniSTS Whitehead-YAC Contig Map 6 UniSTS
D11S1794
Human Assembly Chr Position (strand) Source JBrowse GRCh37 11 13,335,758 - 13,336,010 UniSTS GRCh37 Build 36 11 13,292,334 - 13,292,586 RGD NCBI36 Celera 11 13,461,906 - 13,462,158 RGD Cytogenetic Map 11 p15 UniSTS HuRef 11 13,015,902 - 13,016,154 UniSTS Marshfield Genetic Map 11 19.86 RGD Marshfield Genetic Map 11 19.86 UniSTS Genethon Genetic Map 11 22.3 UniSTS TNG Radiation Hybrid Map 11 6444.0 UniSTS deCODE Assembly Map 11 22.28 UniSTS Whitehead-YAC Contig Map 11 UniSTS
RH119816
Human Assembly Chr Position (strand) Source JBrowse GRCh37 11 13,399,099 - 13,399,232 UniSTS GRCh37 Build 36 11 13,355,675 - 13,355,808 RGD NCBI36 Celera 11 13,525,277 - 13,525,410 RGD Cytogenetic Map 11 p15 UniSTS HuRef 11 13,079,283 - 13,079,416 UniSTS TNG Radiation Hybrid Map 11 6470.0 UniSTS
D11S4441
Human Assembly Chr Position (strand) Source JBrowse GRCh37 11 13,360,410 - 13,360,605 UniSTS GRCh37 Build 36 11 13,316,986 - 13,317,181 RGD NCBI36 Celera 11 13,486,581 - 13,486,776 RGD Cytogenetic Map 11 p15 UniSTS HuRef 11 13,040,578 - 13,040,773 UniSTS
RH78096
Human Assembly Chr Position (strand) Source JBrowse GRCh37 11 13,406,551 - 13,406,689 UniSTS GRCh37 Build 36 11 13,363,127 - 13,363,265 RGD NCBI36 Celera 11 13,532,733 - 13,532,871 RGD Cytogenetic Map 11 p15 UniSTS HuRef 11 13,086,739 - 13,086,877 UniSTS GeneMap99-GB4 RH Map 11 56.65 UniSTS NCBI RH Map 11 63.0 UniSTS
ARNTL_1824
Human Assembly Chr Position (strand) Source JBrowse GRCh37 11 13,408,153 - 13,408,882 UniSTS GRCh37 Build 36 11 13,364,729 - 13,365,458 RGD NCBI36 Celera 11 13,534,337 - 13,535,066 RGD HuRef 11 13,088,343 - 13,089,072 UniSTS
WI-14129
Human Assembly Chr Position (strand) Source JBrowse GRCh37 11 13,406,353 - 13,406,502 UniSTS GRCh37 Build 36 11 13,362,929 - 13,363,078 RGD NCBI36 Celera 11 13,532,535 - 13,532,684 RGD Cytogenetic Map 11 p15 UniSTS HuRef 11 13,086,541 - 13,086,690 UniSTS GeneMap99-GB4 RH Map 11 52.99 UniSTS Whitehead-RH Map 11 50.6 UniSTS NCBI RH Map 11 60.7 UniSTS
MARC_12777-12778:999891099:1
Human Assembly Chr Position (strand) Source JBrowse GRCh37 11 13,407,282 - 13,408,252 UniSTS GRCh37 Celera 11 13,533,464 - 13,534,436 UniSTS HuRef 11 13,087,470 - 13,088,442 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2248
4973
1726
2351
6
624
1924
465
2269
7284
6450
53
3734
1
852
1744
1617
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000389707 ⟹ ENSP00000374357
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,277,798 - 13,387,266 (+) Ensembl
Ensembl Acc Id:
ENST00000401424 ⟹ ENSP00000385915
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,277,778 - 13,387,261 (+) Ensembl
Ensembl Acc Id:
ENST00000403290 ⟹ ENSP00000384517
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,277,790 - 13,387,266 (+) Ensembl
Ensembl Acc Id:
ENST00000403482 ⟹ ENSP00000385897
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,356,878 - 13,387,266 (+) Ensembl
Ensembl Acc Id:
ENST00000403510 ⟹ ENSP00000385581
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,277,790 - 13,387,262 (+) Ensembl
Ensembl Acc Id:
ENST00000472842
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,375,679 - 13,387,263 (+) Ensembl
Ensembl Acc Id:
ENST00000480685
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,277,829 - 13,356,929 (+) Ensembl
Ensembl Acc Id:
ENST00000482049 ⟹ ENSP00000436721
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,277,885 - 13,358,558 (+) Ensembl
Ensembl Acc Id:
ENST00000485918
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,349,945 - 13,354,631 (+) Ensembl
Ensembl Acc Id:
ENST00000497429
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,358,434 - 13,372,409 (+) Ensembl
Ensembl Acc Id:
ENST00000524392 ⟹ ENSP00000436442
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,374,093 - 13,387,266 (+) Ensembl
Ensembl Acc Id:
ENST00000527998 ⟹ ENSP00000433540
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,277,639 - 13,358,440 (+) Ensembl
Ensembl Acc Id:
ENST00000529050 ⟹ ENSP00000434044
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,276,652 - 13,354,377 (+) Ensembl
Ensembl Acc Id:
ENST00000529388 ⟹ ENSP00000433571
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,277,752 - 13,387,263 (+) Ensembl
Ensembl Acc Id:
ENST00000529390
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,372,209 - 13,376,771 (+) Ensembl
Ensembl Acc Id:
ENST00000529825 ⟹ ENSP00000434263
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,277,794 - 13,358,481 (+) Ensembl
Ensembl Acc Id:
ENST00000530357 ⟹ ENSP00000436313
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,277,815 - 13,365,592 (+) Ensembl
Ensembl Acc Id:
ENST00000531665 ⟹ ENSP00000434781
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,309,986 - 13,357,096 (+) Ensembl
Ensembl Acc Id:
ENST00000533520 ⟹ ENSP00000431488
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,277,793 - 13,358,514 (+) Ensembl
Ensembl Acc Id:
ENST00000534102
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,365,416 - 13,369,740 (+) Ensembl
Ensembl Acc Id:
ENST00000534544 ⟹ ENSP00000431566
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,276,652 - 13,356,777 (+) Ensembl
Ensembl Acc Id:
ENST00000673626 ⟹ ENSP00000500988
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,277,829 - 13,387,261 (+) Ensembl
Ensembl Acc Id:
ENST00000673817 ⟹ ENSP00000501212
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,277,830 - 13,387,262 (+) Ensembl
Ensembl Acc Id:
ENST00000673834 ⟹ ENSP00000500983
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,277,829 - 13,387,180 (+) Ensembl
Ensembl Acc Id:
ENST00000673868 ⟹ ENSP00000500968
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,360,348 - 13,387,261 (+) Ensembl
Ensembl Acc Id:
ENST00000673888 ⟹ ENSP00000501059
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,277,878 - 13,387,262 (+) Ensembl
Ensembl Acc Id:
ENST00000673892 ⟹ ENSP00000501106
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,277,842 - 13,387,263 (+) Ensembl
Ensembl Acc Id:
ENST00000674108 ⟹ ENSP00000501035
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 11 13,277,798 - 13,387,266 (+) Ensembl
RefSeq Acc Id:
NM_001030272 ⟹ NP_001025443
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI GRCh37 11 13,299,325 - 13,408,813 (+) ENTREZGENE Build 36 11 13,255,901 - 13,365,389 (+) NCBI Archive HuRef 11 12,979,421 - 13,089,003 (+) ENTREZGENE CHM1_1 11 13,298,251 - 13,407,784 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGA
hide sequence
RefSeq Acc Id:
NM_001030273 ⟹ NP_001025444
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI GRCh37 11 13,299,325 - 13,408,813 (+) ENTREZGENE Build 36 11 13,255,901 - 13,365,389 (+) NCBI Archive HuRef 11 12,979,421 - 13,089,003 (+) ENTREZGENE CHM1_1 11 13,298,251 - 13,407,784 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGC
hide sequence
RefSeq Acc Id:
NM_001178 ⟹ NP_001169
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI GRCh37 11 13,299,325 - 13,408,813 (+) ENTREZGENE Build 36 11 13,255,901 - 13,365,389 (+) NCBI Archive HuRef 11 12,979,421 - 13,089,003 (+) ENTREZGENE CHM1_1 11 13,298,251 - 13,407,784 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGC
hide sequence
RefSeq Acc Id:
NM_001297719 ⟹ NP_001284648
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI CHM1_1 11 13,298,251 - 13,407,784 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGC
hide sequence
RefSeq Acc Id:
NM_001297722 ⟹ NP_001284651
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI CHM1_1 11 13,298,251 - 13,407,784 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGC
hide sequence
RefSeq Acc Id:
NM_001297724 ⟹ NP_001284653
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI CHM1_1 11 13,298,251 - 13,407,784 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGA
hide sequence
RefSeq Acc Id:
NM_001351804 ⟹ NP_001338733
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,276,652 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,369,378 - 13,480,010 (+) NCBI
Sequence:
ACCCTACCCCAGCAGGCGCTAAAGGAGAGCTGACATGATGGATAACGAAAAAGAAGACGCTGTCCTTCTATTCAGGGAGTTTAACATCTGGAAGAGCCGGGAGTTCTTTGTGCTAAAGGCCCTCTACA
hide sequence
RefSeq Acc Id:
NM_001351805 ⟹ NP_001338734
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGA
hide sequence
RefSeq Acc Id:
NM_001351806 ⟹ NP_001338735
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGC
hide sequence
RefSeq Acc Id:
NM_001351807 ⟹ NP_001338736
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGA
hide sequence
RefSeq Acc Id:
NM_001351808 ⟹ NP_001338737
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGC
hide sequence
RefSeq Acc Id:
NM_001351809 ⟹ NP_001338738
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGA
hide sequence
RefSeq Acc Id:
NM_001351810 ⟹ NP_001338739
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGC
hide sequence
RefSeq Acc Id:
NM_001351811 ⟹ NP_001338740
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGC
hide sequence
RefSeq Acc Id:
NM_001351812 ⟹ NP_001338741
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGA
hide sequence
RefSeq Acc Id:
NM_001351813 ⟹ NP_001338742
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGA
hide sequence
RefSeq Acc Id:
NM_001351814 ⟹ NP_001338743
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGA
hide sequence
RefSeq Acc Id:
NM_001351815 ⟹ NP_001338744
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGA
hide sequence
RefSeq Acc Id:
NM_001351816 ⟹ NP_001338745
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGC
hide sequence
RefSeq Acc Id:
NM_001351817 ⟹ NP_001338746
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGC
hide sequence
RefSeq Acc Id:
NM_001351818 ⟹ NP_001338747
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGC
hide sequence
RefSeq Acc Id:
NM_001351819 ⟹ NP_001338748
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGA
hide sequence
RefSeq Acc Id:
NM_001351820 ⟹ NP_001338749
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGC
hide sequence
RefSeq Acc Id:
NM_001351821 ⟹ NP_001338750
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGA
hide sequence
RefSeq Acc Id:
NM_001351822 ⟹ NP_001338751
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGC
hide sequence
RefSeq Acc Id:
NM_001351823 ⟹ NP_001338752
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGC
hide sequence
RefSeq Acc Id:
NM_001351824 ⟹ NP_001338753
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGA
hide sequence
RefSeq Acc Id:
NR_147785
RefSeq Status:
REVIEWED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGC
hide sequence
RefSeq Acc Id:
NR_147786
RefSeq Status:
REVIEWED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGA
hide sequence
RefSeq Acc Id:
NR_147787
RefSeq Status:
REVIEWED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGC
hide sequence
RefSeq Acc Id:
NR_147788
RefSeq Status:
REVIEWED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGA
hide sequence
RefSeq Acc Id:
NR_147789
RefSeq Status:
REVIEWED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGC
hide sequence
RefSeq Acc Id:
NR_147790
RefSeq Status:
REVIEWED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGC
hide sequence
RefSeq Acc Id:
NR_147791
RefSeq Status:
REVIEWED
Type:
NON-CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
Sequence:
AGTGGTGCGACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGC
hide sequence
RefSeq Acc Id:
XM_011520105 ⟹ XP_011518407
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,276,652 - 13,387,266 (+) NCBI
Sequence:
ACAGAATTAGGCCAATTTATTTAATTCCATTTGTTCATGTATCCAGCCAACAGATATTTATGGT
hide sequence
RefSeq Acc Id:
XM_011520107 ⟹ XP_011518409
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,276,652 - 13,387,266 (+) NCBI
Sequence:
ACAGAATTAGGCCAATTTATTTAATTCCATTTGTTCATGTATCCAGCCAACAGATATTTATGGTGCACTTGTTGGGTGCCAGCCCCGCCCCCACCACTCCACCCTACCCCAGCAGGCGCTAAAGGAGA
hide sequence
RefSeq Acc Id:
XM_011520109 ⟹ XP_011518411
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI
Sequence:
GACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCA
hide sequence
RefSeq Acc Id:
XM_017017738 ⟹ XP_016873227
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,276,652 - 13,387,266 (+) NCBI
Sequence:
ACAGAATTAGGCCAATTTATTTAATTCCATTTGTTCATGTATCCAGCCAACAGATATTTATGGTGCACTTGTTGGGTGCCAGCCCCGCCCCCACCACTCCACCCTACCCCAGCAGGCGCTAAAGGAGA
hide sequence
RefSeq Acc Id:
XM_017017739 ⟹ XP_016873228
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,276,652 - 13,387,266 (+) NCBI
Sequence:
ACAGAATTAGGCCAATTTATTTAATTCCATTTGTTCATGTATCCAGCCAACAGATATTTATGGT
hide sequence
RefSeq Acc Id:
XM_017017741 ⟹ XP_016873230
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI
Sequence:
GACATTTAGGGAAGGCAGAAAGTAGGTCAGGGACGGAGGTGCCTGTTTACCCGCGCCGGACTCACCGCCGCCGCCGCCGCGGGATCCGAGTGCGGGCGCGGGCGCGGGCGCTCCCGGCGAGCCACGGT
hide sequence
RefSeq Acc Id:
XM_024448522 ⟹ XP_024304290
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,354,530 - 13,387,266 (+) NCBI
Sequence:
TTTCATCCTGGAAAAGGGGATGGGAATAAAAAACCCAACTCTAGGTGGCGACACAGTTGGTTTT
hide sequence
RefSeq Acc Id:
XM_047426952 ⟹ XP_047282908
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI
RefSeq Acc Id:
XM_047426953 ⟹ XP_047282909
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI
RefSeq Acc Id:
XM_047426954 ⟹ XP_047282910
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI
RefSeq Acc Id:
XM_047426955 ⟹ XP_047282911
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,387,266 (+) NCBI
RefSeq Acc Id:
XM_047426956 ⟹ XP_047282912
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,318,572 - 13,387,266 (+) NCBI
RefSeq Acc Id:
XM_047426957 ⟹ XP_047282913
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,276,652 - 13,381,245 (+) NCBI
RefSeq Acc Id:
XM_047426958 ⟹ XP_047282914
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 11 13,276,652 - 13,369,756 (+) NCBI
RefSeq Acc Id:
XM_054368794 ⟹ XP_054224769
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 11 13,369,378 - 13,480,010 (+) NCBI
RefSeq Acc Id:
XM_054368795 ⟹ XP_054224770
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 11 13,369,378 - 13,480,010 (+) NCBI
RefSeq Acc Id:
XM_054368796 ⟹ XP_054224771
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 11 13,369,378 - 13,480,010 (+) NCBI
RefSeq Acc Id:
XM_054368797 ⟹ XP_054224772
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 11 13,369,378 - 13,480,010 (+) NCBI
RefSeq Acc Id:
XM_054368798 ⟹ XP_054224773
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
RefSeq Acc Id:
XM_054368799 ⟹ XP_054224774
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
RefSeq Acc Id:
XM_054368800 ⟹ XP_054224775
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
RefSeq Acc Id:
XM_054368801 ⟹ XP_054224776
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
RefSeq Acc Id:
XM_054368802 ⟹ XP_054224777
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
RefSeq Acc Id:
XM_054368803 ⟹ XP_054224778
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 11 13,370,517 - 13,480,010 (+) NCBI
RefSeq Acc Id:
XM_054368804 ⟹ XP_054224779
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 11 13,447,294 - 13,480,010 (+) NCBI
RefSeq Acc Id:
XM_054368805 ⟹ XP_054224780
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 11 13,369,378 - 13,471,166 (+) NCBI
RefSeq Acc Id:
XM_054368806 ⟹ XP_054224781
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 11 13,369,378 - 13,462,499 (+) NCBI
RefSeq Acc Id:
NP_001169 ⟸ NM_001178
- Peptide Label:
isoform a
- UniProtKB:
A0A140VKD3 (UniProtKB/TrEMBL), B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGA
hide sequence
RefSeq Acc Id:
NP_001025444 ⟸ NM_001030273
- Peptide Label:
isoform b
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILF
hide sequence
RefSeq Acc Id:
NP_001025443 ⟸ NM_001030272
- Peptide Label:
isoform a
- UniProtKB:
A0A140VKD3 (UniProtKB/TrEMBL), B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGA
hide sequence
RefSeq Acc Id:
NP_001284648 ⟸ NM_001297719
- Peptide Label:
isoform c
- UniProtKB:
Q99631 (UniProtKB/Swiss-Prot), Q8IUT4 (UniProtKB/Swiss-Prot), Q4G136 (UniProtKB/Swiss-Prot), O00317 (UniProtKB/Swiss-Prot), O00316 (UniProtKB/Swiss-Prot), O00315 (UniProtKB/Swiss-Prot), O00314 (UniProtKB/Swiss-Prot), O00313 (UniProtKB/Swiss-Prot), D3DQW6 (UniProtKB/Swiss-Prot), B7WPG7 (UniProtKB/Swiss-Prot), B5ME11 (UniProtKB/Swiss-Prot), A8K645 (UniProtKB/Swiss-Prot), A2I2N6 (UniProtKB/Swiss-Prot), Q99649 (UniProtKB/Swiss-Prot), O00327 (UniProtKB/Swiss-Prot), B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGA
hide sequence
RefSeq Acc Id:
NP_001284653 ⟸ NM_001297724
- Peptide Label:
isoform d
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILF
hide sequence
RefSeq Acc Id:
NP_001284651 ⟸ NM_001297722
- Peptide Label:
isoform c
- UniProtKB:
Q99631 (UniProtKB/Swiss-Prot), Q8IUT4 (UniProtKB/Swiss-Prot), Q4G136 (UniProtKB/Swiss-Prot), O00317 (UniProtKB/Swiss-Prot), O00316 (UniProtKB/Swiss-Prot), O00315 (UniProtKB/Swiss-Prot), O00314 (UniProtKB/Swiss-Prot), O00313 (UniProtKB/Swiss-Prot), D3DQW6 (UniProtKB/Swiss-Prot), B7WPG7 (UniProtKB/Swiss-Prot), B5ME11 (UniProtKB/Swiss-Prot), A8K645 (UniProtKB/Swiss-Prot), A2I2N6 (UniProtKB/Swiss-Prot), Q99649 (UniProtKB/Swiss-Prot), O00327 (UniProtKB/Swiss-Prot), B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGA
hide sequence
RefSeq Acc Id:
XP_011518411 ⟸ XM_011520109
- Peptide Label:
isoform X5
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGA
hide sequence
RefSeq Acc Id:
XP_011518407 ⟸ XM_011520105
- Peptide Label:
isoform X2
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MTAPVGHLEVMMNAKNVVLARVYTFGPKLNFSNVESWAFIDHPMADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRR
hide sequence
RefSeq Acc Id:
XP_011518409 ⟸ XM_011520107
- Peptide Label:
isoform X4
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MTAPVGHLEVMMNAKNVVLARVYTFGPKLNFSNVESWAFIDHPMADQRMDISSTISDFMSPGPT
hide sequence
RefSeq Acc Id:
XP_016873227 ⟸ XM_017017738
- Peptide Label:
isoform X1
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MTAPVGHLEVMMNAKNVVLARVYTFGPKLNFSNVESWAFIDHPMADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRR
hide sequence
RefSeq Acc Id:
XP_016873228 ⟸ XM_017017739
- Peptide Label:
isoform X3
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MTAPVGHLEVMMNAKNVVLARVYTFGPKLNFSNVESWAFIDHPMADQRMDISSTISDFMSPGPT
hide sequence
RefSeq Acc Id:
XP_016873230 ⟸ XM_017017741
- Peptide Label:
isoform X6
- UniProtKB:
A0A669KBF4 (UniProtKB/TrEMBL), B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGA
hide sequence
RefSeq Acc Id:
NP_001338733 ⟸ NM_001351804
- Peptide Label:
isoform a
- UniProtKB:
A0A140VKD3 (UniProtKB/TrEMBL), B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGA
hide sequence
RefSeq Acc Id:
NP_001338741 ⟸ NM_001351812
- Peptide Label:
isoform i
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MSFLLKFTGRIWGAQWLEVRCPLGDAMINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDD
hide sequence
RefSeq Acc Id:
NP_001338752 ⟸ NM_001351823
- Peptide Label:
isoform n
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILF
hide sequence
RefSeq Acc Id:
NP_001338737 ⟸ NM_001351808
- Peptide Label:
isoform d
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILF
hide sequence
RefSeq Acc Id:
NP_001338747 ⟸ NM_001351818
- Peptide Label:
isoform b
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILF
hide sequence
RefSeq Acc Id:
NP_001338749 ⟸ NM_001351820
- Peptide Label:
isoform d
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILF
hide sequence
RefSeq Acc Id:
NP_001338743 ⟸ NM_001351814
- Peptide Label:
isoform e
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGA
hide sequence
RefSeq Acc Id:
NP_001338750 ⟸ NM_001351821
- Peptide Label:
isoform d
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILF
hide sequence
RefSeq Acc Id:
NP_001338738 ⟸ NM_001351809
- Peptide Label:
isoform i
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MSFLLKFTGRIWGAQWLEVRCPLGDAMINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDD
hide sequence
RefSeq Acc Id:
NP_001338745 ⟸ NM_001351816
- Peptide Label:
isoform d
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILF
hide sequence
RefSeq Acc Id:
NP_001338742 ⟸ NM_001351813
- Peptide Label:
isoform j
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILF
hide sequence
RefSeq Acc Id:
NP_001338740 ⟸ NM_001351811
- Peptide Label:
isoform m
- Sequence:
MKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDEDNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFVFVDQRATAILAYLPQELLGTSCYEYFH
hide sequence
RefSeq Acc Id:
NP_001338736 ⟸ NM_001351807
- Peptide Label:
isoform e
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGA
hide sequence
RefSeq Acc Id:
NP_001338748 ⟸ NM_001351819
- Peptide Label:
isoform f
- UniProtKB:
A0A669KBF4 (UniProtKB/TrEMBL), B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGA
hide sequence
RefSeq Acc Id:
NP_001338739 ⟸ NM_001351810
- Peptide Label:
isoform k
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGA
hide sequence
RefSeq Acc Id:
NP_001338734 ⟸ NM_001351805
- Peptide Label:
isoform g
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTF
hide sequence
RefSeq Acc Id:
NP_001338735 ⟸ NM_001351806
- Peptide Label:
isoform h
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTF
hide sequence
RefSeq Acc Id:
NP_001338751 ⟸ NM_001351822
- Peptide Label:
isoform d
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILF
hide sequence
RefSeq Acc Id:
NP_001338753 ⟸ NM_001351824
- Peptide Label:
isoform c
- UniProtKB:
Q99631 (UniProtKB/Swiss-Prot), Q8IUT4 (UniProtKB/Swiss-Prot), Q4G136 (UniProtKB/Swiss-Prot), O00327 (UniProtKB/Swiss-Prot), O00317 (UniProtKB/Swiss-Prot), O00316 (UniProtKB/Swiss-Prot), O00315 (UniProtKB/Swiss-Prot), O00314 (UniProtKB/Swiss-Prot), O00313 (UniProtKB/Swiss-Prot), D3DQW6 (UniProtKB/Swiss-Prot), B7WPG7 (UniProtKB/Swiss-Prot), B5ME11 (UniProtKB/Swiss-Prot), A8K645 (UniProtKB/Swiss-Prot), A2I2N6 (UniProtKB/Swiss-Prot), Q99649 (UniProtKB/Swiss-Prot), B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGA
hide sequence
RefSeq Acc Id:
NP_001338744 ⟸ NM_001351815
- Peptide Label:
isoform a
- UniProtKB:
A0A140VKD3 (UniProtKB/TrEMBL), B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGA
hide sequence
RefSeq Acc Id:
NP_001338746 ⟸ NM_001351817
- Peptide Label:
isoform k
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGA
hide sequence
RefSeq Acc Id:
XP_024304290 ⟸ XM_024448522
- Peptide Label:
isoform X7
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
- Sequence:
MSFLLKFTGRIWGAQWLEVRCPLGDAMINIESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATNPYTEANYKPTFLSDD
hide sequence
Ensembl Acc Id:
ENSP00000500988 ⟸ ENST00000673626
Ensembl Acc Id:
ENSP00000501212 ⟸ ENST00000673817
Ensembl Acc Id:
ENSP00000500983 ⟸ ENST00000673834
Ensembl Acc Id:
ENSP00000501106 ⟸ ENST00000673892
Ensembl Acc Id:
ENSP00000501059 ⟸ ENST00000673888
Ensembl Acc Id:
ENSP00000500968 ⟸ ENST00000673868
Ensembl Acc Id:
ENSP00000501035 ⟸ ENST00000674108
Ensembl Acc Id:
ENSP00000436313 ⟸ ENST00000530357
Ensembl Acc Id:
ENSP00000434781 ⟸ ENST00000531665
Ensembl Acc Id:
ENSP00000374357 ⟸ ENST00000389707
Ensembl Acc Id:
ENSP00000385915 ⟸ ENST00000401424
Ensembl Acc Id:
ENSP00000431488 ⟸ ENST00000533520
Ensembl Acc Id:
ENSP00000431566 ⟸ ENST00000534544
Ensembl Acc Id:
ENSP00000385897 ⟸ ENST00000403482
Ensembl Acc Id:
ENSP00000385581 ⟸ ENST00000403510
Ensembl Acc Id:
ENSP00000384517 ⟸ ENST00000403290
Ensembl Acc Id:
ENSP00000436721 ⟸ ENST00000482049
Ensembl Acc Id:
ENSP00000436442 ⟸ ENST00000524392
Ensembl Acc Id:
ENSP00000433540 ⟸ ENST00000527998
Ensembl Acc Id:
ENSP00000433571 ⟸ ENST00000529388
Ensembl Acc Id:
ENSP00000434263 ⟸ ENST00000529825
Ensembl Acc Id:
ENSP00000434044 ⟸ ENST00000529050
RefSeq Acc Id:
XP_047282913 ⟸ XM_047426957
- Peptide Label:
isoform X8
RefSeq Acc Id:
XP_047282914 ⟸ XM_047426958
- Peptide Label:
isoform X9
RefSeq Acc Id:
XP_047282909 ⟸ XM_047426953
- Peptide Label:
isoform X5
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047282908 ⟸ XM_047426952
- Peptide Label:
isoform X5
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047282911 ⟸ XM_047426955
- Peptide Label:
isoform X5
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047282910 ⟸ XM_047426954
- Peptide Label:
isoform X5
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047282912 ⟸ XM_047426956
- Peptide Label:
isoform X5
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054224769 ⟸ XM_054368794
- Peptide Label:
isoform X1
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054224771 ⟸ XM_054368796
- Peptide Label:
isoform X3
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054224770 ⟸ XM_054368795
- Peptide Label:
isoform X2
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054224772 ⟸ XM_054368797
- Peptide Label:
isoform X4
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054224780 ⟸ XM_054368805
- Peptide Label:
isoform X8
RefSeq Acc Id:
XP_054224781 ⟸ XM_054368806
- Peptide Label:
isoform X9
RefSeq Acc Id:
XP_054224775 ⟸ XM_054368800
- Peptide Label:
isoform X5
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054224774 ⟸ XM_054368799
- Peptide Label:
isoform X5
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054224777 ⟸ XM_054368802
- Peptide Label:
isoform X5
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054224776 ⟸ XM_054368801
- Peptide Label:
isoform X5
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054224773 ⟸ XM_054368798
- Peptide Label:
isoform X5
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054224778 ⟸ XM_054368803
- Peptide Label:
isoform X6
- UniProtKB:
A0A669KBF4 (UniProtKB/TrEMBL), B2RCL8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054224779 ⟸ XM_054368804
- Peptide Label:
isoform X7
- UniProtKB:
B2RCL8 (UniProtKB/TrEMBL)
RGD ID: 6789136 Promoter ID: HG_KWN:12357 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, K562, Lymphoblastoid Transcripts: ENST00000361003, ENST00000389708, ENST00000396441, NM_001030272, NM_001030273, OTTHUMT00000319170, OTTHUMT00000319177, OTTHUMT00000319178, OTTHUMT00000319179, UC001MKR.1, UC001MKS.1, UC001MKT.1, UC001MKU.1 Position: Human Assembly Chr Position (strand) Source Build 36 11 13,255,456 - 13,256,152 (+) MPROMDB
RGD ID: 7219695 Promoter ID: EPDNEW_H15594 Type: initiation region Name: ARNTL_1 Description: aryl hydrocarbon receptor nuclear translocator like SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 11 13,277,790 - 13,277,850 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2022-07-25
BMAL1
basic helix-loop-helix ARNT like 1
ARNTL
aryl hydrocarbon receptor nuclear translocator like
Symbol and/or name change
19259463 PROVISIONAL
2015-12-01
ARNTL
aryl hydrocarbon receptor nuclear translocator like
ARNTL
aryl hydrocarbon receptor nuclear translocator-like
Symbol and/or name change
5135510 APPROVED
