Advanced Search (OLGA)

Gene: P3r3urf (PIK3R3 upstream open reading frame) Rattus norvegicus

Analyze

Symbol:

P3r3urf

Name:

PIK3R3 upstream open reading frame

RGD ID:

6491750

Description:

Predicted to be involved in cytokine-mediated signaling pathway. Orthologous to human P3R3URF (PIK3R3 upstream open reading frame).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC100911669; PIK3R3 upstream reading frame; uncharacterized LOC100911669; uncharacterized protein LOC100911669

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	134,893,003 - 134,909,941 (+)	NCBI		GRCr8
mRatBN7.2	5	129,656,654 - 129,673,140 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	129,656,833 - 129,672,848 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	132,273,082 - 132,274,052 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	134,027,670 - 134,028,640 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	134,050,106 - 134,051,076 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	135,029,480 - 135,046,282 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	135,029,955 - 135,030,801 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	138,813,697 - 138,829,793 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	5	128,184,729 - 128,201,535 (+)	NCBI		Celera
Cytogenetic Map	5	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cytokine-mediated signaling pathway (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

P3r3urf
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	134,893,003 - 134,909,941 (+)	NCBI		GRCr8
mRatBN7.2	5	129,656,654 - 129,673,140 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	129,656,833 - 129,672,848 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	132,273,082 - 132,274,052 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	134,027,670 - 134,028,640 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	134,050,106 - 134,051,076 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	135,029,480 - 135,046,282 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	135,029,955 - 135,030,801 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	138,813,697 - 138,829,793 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	5	128,184,729 - 128,201,535 (+)	NCBI		Celera
Cytogenetic Map	5	q35	NCBI

P3R3URF
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	46,175,486 - 46,176,488 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	46,175,486 - 46,176,488 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	46,641,158 - 46,642,160 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Cytogenetic Map	1	p34.1	NCBI
T2T-CHM13v2.0	1	46,052,681 - 46,053,683 (-)	NCBI		T2T-CHM13v2.0

P3r3urf
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	116,030,569 - 116,031,494 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	116,030,569 - 116,031,487 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	116,173,372 - 116,174,297 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	116,173,372 - 116,174,290 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	115,845,977 - 115,846,902 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	115,845,883 - 115,846,902 (+)	NCBI		MGSCv36	mm8
Celera	4	114,911,527 - 114,912,452 (+)	NCBI		Celera
Cytogenetic Map	4	D1	NCBI
cM Map	4	53.1	NCBI

P3R3URF
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	180,628,510 - 180,629,915 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	179,770,079 - 179,771,422 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	45,481,545 - 45,483,181 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	46,836,356 - 46,837,391 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	46,836,456 - 46,837,338 (-)	Ensembl	panpan1.1		panPan2

P3R3URF
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	14,197,285 - 14,198,026 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	14,197,316 - 14,198,024 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	14,319,201 - 14,319,937 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	14,349,659 - 14,350,395 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	14,349,685 - 14,350,393 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	14,150,714 - 14,151,450 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	14,219,199 - 14,219,935 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	14,288,825 - 14,289,561 (+)	NCBI		UU_Cfam_GSD_1.0

P3r3urf
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	61,391,964 - 61,392,906 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	27,216,835 - 27,217,647 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl

P3R3URF
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	86,609,459 - 86,610,800 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666033	30,375,884 - 30,377,456 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in P3r3urf
37 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	48
Count of miRNA genes:	42
Interacting mature miRNAs:	48
Transcripts:	ENSRNOT00000074860
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
1300122	Wbc1	White blood cell count QTL 1	2.75		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	5	125392826	139989768	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	94858972	143070159	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	129132447	151006154	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	97570330	136479578	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	87468046	132468046	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
7365049	Bp359	Blood pressure QTL 359			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128071929	134724733	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	129132428	143070159	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
1581505	Rf54	Renal function QTL 54			kidney physiology trait (VT:0002136)	kidney 20-HETE level (CMO:0001854)	5	128033842	133011550	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	120740824	143608494	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
7394710	Emca12	Estrogen-induced mammary cancer QTL 12			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	124160767	133749643	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
631527	Tls1	T-lymphoma susceptibility QTL 1	0	0.001	thymus integrity trait (VT:0010555)	post-insult time to onset of T-cell lymphoma (CMO:0001907)	5	90450144	135450144	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	87765973	132765973	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
7	11	20	49	40	39	21	9	21	6	89	45	35	8	31	18

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001399355	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006225466	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008763983	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008776045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000074860 ⟹ ENSRNOP00000067380

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	129,656,833 - 129,672,848 (+)	Ensembl
Rnor_6.0 Ensembl	5	135,029,955 - 135,030,801 (+)	Ensembl

RefSeq Acc Id:

NM_001399355 ⟹ NP_001386284

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	134,893,571 - 134,894,540 (+)	NCBI
mRatBN7.2	5	129,656,856 - 129,657,825 (+)	NCBI

RefSeq Acc Id:

XM_008763983 ⟹ XP_008762205

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	134,893,003 - 134,909,941 (+)	NCBI
mRatBN7.2	5	129,656,654 - 129,673,140 (+)	NCBI
Rnor_6.0	5	135,029,480 - 135,046,282 (+)	NCBI

Sequence:

show sequence

GATTAAGGCCTGTGCTACTATACCCTGCTTTAGTATTTGTCAACTCAATGCTTAGGGTGATTCT
GTAAACTTCCAGCTGCTGGGAAGACTGAAAATTGACTTCTAGGAGTAAGAGTAATATTAGAACC
TCTGCATAGGTCTGTGGTGGGAATTTAATGAAGACATACTCAGCTTAGTGTCTGGCACACAGTA
GGTGCTTGATAAGCATTCTTAGTATTATTAATGTGGATAAATTTATAACAAAACAAGTGATTTG
TTTCTGCTTCTCAAAGCCCCTTTCACCAAGGGAGCACTCTGTGGTTGCTGGGCTCTTGGGCTAG
AGTTCATGAAGAGGATTGTGAGGAAGTCTGAGCTGTGTCTGGGTGGGGGATGGGACAAACCTGT
AACAAAGAGCACCACCCTTAGGCAGGCTTCGTATGTCATAGAGATCTCAGTTATCTTGGCCAGC
AGAGCCCCTCTGGAGCTCTCTGCAGTCATGGGGCCTTCTCAGCTTGTTCGAGCCCCTAGGCCTC
GGGGCATGAGCTCTCCCTACCGAAGGCCAGGTATGGGTGGACCCAGGCGCCGGTGTCCCAAGAT
GTTCAAGTGTAGCCGCAGGACATACCGGCAGAAACCCCGAGGCCCAACTGCCACTGATCCGTCT
TCTGTGGCCACAAACATCAGTGACACGGACACTACCACCAGTGTGTGGATCCTCTCACCTCAAG
AGGAAATCTTCACACCGAGATAGAGCAAGCAGTGAATTCTTCCTACTGTTTTTTTTTTTTAAAT
AAAAATGTAAGAAGACAGCATGCACGATGGTTTATAATCCCAGCACTTTGAAGACGGAGACAGG
AGGATTGCCAGAAATTTGAAGTCAGTGAGCCTCAAGTCATCCTGGGCTACAGAATGGGACCTTG
CCTCGAAACAAAATGAAAAACAGGGACTGGAGAGACTGCATAGTGGTTAAGAGCATCTGTTTTT
GCACAAGACCAGAGTTTGACTCCCAACACCCACATGGTGGTTCAGAACCAACCATCACTAGAGG
GGATCTATGGACAGGGCCTACACATAAATAAACACACACACACACACACACACACACACACACA
CACACACAAATAAAGAAGTAACTCTGCTTAAATGAAGCAAAATATTTACTGAAAATAAAAATAA
GTA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001386284	(Get FASTA)	NCBI Sequence Viewer
	XP_008762205	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000067380.1

RefSeq Acc Id:	XP_008762205 ⟸ XM_008763983
- Peptide Label:	isoform X1
- Sequence:	show sequence MKRIVRKSELCLGGGWDKPVTKSTTLRQASYVIEISVILASRAPLELSAVMGPSQLVRAPRPRG MSSPYRRPGMGGPRRRCPKMFKCSRRTYRQKPRGPTATDPSSVATNISDTDTTTSVWILSPQEE IFTPR hide sequence

Ensembl Acc Id:

ENSRNOP00000067380 ⟸ ENSRNOT00000074860

RefSeq Acc Id:	NP_001386284 ⟸ NM_001399355
- UniProtKB:	M0RCQ3 (UniProtKB/TrEMBL), A6JZ69 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-M0RCQ3-F1-model_v2	AlphaFold	M0RCQ3	1-90	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693942

Promoter ID:

EPDNEW_R4457

Type:

initiation region

Name:

1700042G07Rik_1

Description:

RIKEN cDNA 1700042G07 gene

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	135,029,945 - 135,030,005	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:6491750	AgrOrtholog
BioCyc Gene	G2FUF-40261	BioCyc
Ensembl Genes	ENSRNOG00000049874	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000074860.2	UniProtKB/TrEMBL
NCBI Gene	LOC100911669	ENTREZGENE
PhenoGen	P3r3urf	PhenoGen
RatGTEx	ENSRNOG00000049874	RatGTEx
UniProt	A6JZ69	ENTREZGENE, UniProtKB/TrEMBL
	M0RCQ3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-18	P3r3urf	PIK3R3 upstream open reading frame	P3r3urf	PIK3R3 upstream reading frame	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2018-12-10	P3r3urf	PIK3R3 upstream reading frame	LOC100911669	uncharacterized LOC100911669	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-05	LOC100911669	uncharacterized LOC100911669			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message