Symbol:
Plod3
Name:
procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3
RGD ID:
631339
Description:
Predicted to enable hexosyltransferase activity; iron ion binding activity; and procollagen-lysine 5-dioxygenase activity. Involved in cellular response to hormone stimulus. Predicted to be located in trans-Golgi network. Predicted to be active in several cellular components, including Golgi apparatus; collagen-containing extracellular matrix; and endoplasmic reticulum. Biomarker of hypothyroidism. Orthologous to human PLOD3 (procollagen-lysine,2-oxoglutarate 5-dioxygenase 3); PARTICIPATES IN lysine degradation pathway; O-linked glycan biosynthetic pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; aconitine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
bone protein I (BP-I); LH3; lysyl hydroxylase 3; MGC93055; multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3; procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PLOD3 (procollagen-lysine,2-oxoglutarate 5-dioxygenase 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Plod3 (procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Plod3 (procollagen-lysine,2-oxoglutarate 5-dioxygenase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PLOD3 (procollagen-lysine,2-oxoglutarate 5-dioxygenase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PLOD3 (procollagen-lysine,2-oxoglutarate 5-dioxygenase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Plod3 (procollagen-lysine,2-oxoglutarate 5-dioxygenase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PLOD3 (procollagen-lysine,2-oxoglutarate 5-dioxygenase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PLOD3 (procollagen-lysine,2-oxoglutarate 5-dioxygenase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Plod3 (procollagen-lysine,2-oxoglutarate 5-dioxygenase 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PLOD3 (procollagen-lysine,2-oxoglutarate 5-dioxygenase 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Plod3 (procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
plod3 (procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
let-268
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Drosophila melanogaster (fruit fly):
Plod
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
plod3
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 25,313,070 - 25,323,631 (-) NCBI GRCr8 mRatBN7.2 12 19,676,384 - 19,686,945 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 19,676,386 - 19,686,960 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 20,814,848 - 20,825,421 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 21,427,553 - 21,438,126 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 20,492,753 - 20,503,314 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 22,716,421 - 22,726,982 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 22,716,423 - 22,726,982 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 24,728,205 - 24,738,766 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 20,856,527 - 20,867,088 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 20,846,399 - 20,856,690 (+) NCBI Celera 12 21,452,299 - 21,462,860 (-) NCBI Celera Cytogenetic Map 12 q12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Plod3 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO PLOD3 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of PLOD3 mRNA CTD PMID:22079256 Plod3 Rat (-)-epigallocatechin 3-gallate increases expression ISO PLOD3 (Homo sapiens) 6480464 epigallocatechin gallate results in increased expression of PLOD3 mRNA CTD PMID:20706672 Plod3 Rat (S)-nicotine decreases expression ISO Plod3 (Mus musculus) 6480464 Nicotine results in decreased expression of PLOD3 mRNA CTD PMID:17997037 Plod3 Rat 1,10-phenanthroline increases expression ISO PLOD3 (Homo sapiens) 6480464 1 and 10-phenanthroline results in increased expression of PLOD3 mRNA CTD PMID:19502547 Plod3 Rat 1,2-dichloroethane decreases expression ISO Plod3 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of PLOD3 mRNA CTD PMID:28960355 Plod3 Rat 1,2-dimethylhydrazine increases expression ISO Plod3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PLOD3 mRNA CTD PMID:22206623 Plod3 Rat 1,4-dithiothreitol increases expression ISO PLOD3 (Homo sapiens) 6480464 Dithiothreitol results in increased expression of PLOD3 protein CTD PMID:21692457 Plod3 Rat 17alpha-ethynylestradiol multiple interactions ISO Plod3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PLOD3 mRNA CTD PMID:17942748 Plod3 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO PLOD3 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Plod3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Plod3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PLOD3 mRNA and Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to PLOD3 promoter] CTD PMID:17942748 and PMID:19654925 Plod3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PLOD3 mRNA CTD PMID:33387578 Plod3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PLOD3 mRNA CTD PMID:34747641 Plod3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Plod3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PLOD3 mRNA CTD PMID:21570461 Plod3 Rat 2,4,6-tribromophenol increases expression ISO PLOD3 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Plod3 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of PLOD3 mRNA CTD PMID:21346803 Plod3 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO PLOD3 (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of PLOD3 protein CTD PMID:31675489 Plod3 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Plod3 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of PLOD3 mRNA CTD PMID:20188158 Plod3 Rat 4,4'-diaminodiphenylmethane increases expression ISO Plod3 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of PLOD3 mRNA CTD PMID:18648102 Plod3 Rat 4,4'-sulfonyldiphenol decreases expression ISO Plod3 (Mus musculus) 6480464 bisphenol S results in decreased expression of PLOD3 mRNA CTD PMID:39298647 Plod3 Rat 4,4'-sulfonyldiphenol increases expression ISO PLOD3 (Homo sapiens) 6480464 bisphenol S results in increased expression of PLOD3 protein CTD PMID:34186270 Plod3 Rat 4,4'-sulfonyldiphenol increases methylation ISO Plod3 (Mus musculus) 6480464 bisphenol S results in increased methylation of PLOD3 exon CTD PMID:33297965 Plod3 Rat 4-hydroxyphenyl retinamide decreases expression ISO Plod3 (Mus musculus) 6480464 Fenretinide results in decreased expression of PLOD3 mRNA CTD PMID:28973697 Plod3 Rat aconitine decreases expression EXP 6480464 Aconitine results in decreased expression of PLOD3 protein CTD PMID:33236894 Plod3 Rat acrylamide increases expression ISO PLOD3 (Homo sapiens) 6480464 Acrylamide results in increased expression of PLOD3 mRNA CTD PMID:32763439 Plod3 Rat allethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of PLOD3 protein CTD PMID:34896426 Plod3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PLOD3 mRNA CTD PMID:16483693 Plod3 Rat arsane affects methylation ISO PLOD3 (Homo sapiens) 6480464 Arsenic affects the methylation of PLOD3 gene CTD PMID:25304211 Plod3 Rat arsenic atom affects methylation ISO PLOD3 (Homo sapiens) 6480464 Arsenic affects the methylation of PLOD3 gene CTD PMID:25304211 Plod3 Rat benzo[a]pyrene multiple interactions ISO Plod3 (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to PLOD3 promoter] CTD PMID:19654925 Plod3 Rat benzo[a]pyrene increases methylation ISO Plod3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of PLOD3 exon and Benzo(a)pyrene results in increased methylation of PLOD3 intron CTD PMID:27901495 Plod3 Rat beta-lapachone increases expression ISO PLOD3 (Homo sapiens) 6480464 beta-lapachone results in increased expression of PLOD3 mRNA CTD PMID:38218311 Plod3 Rat bis(2-ethylhexyl) phthalate decreases expression ISO PLOD3 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of PLOD3 protein CTD PMID:31163220 Plod3 Rat bis(2-ethylhexyl) phthalate increases expression ISO Plod3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PLOD3 mRNA CTD PMID:34319233 Plod3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PLOD3 mRNA CTD PMID:25181051 Plod3 Rat bisphenol A increases expression ISO PLOD3 (Homo sapiens) 6480464 bisphenol A results in increased expression of PLOD3 protein CTD PMID:37567409 Plod3 Rat bisphenol A decreases expression ISO PLOD3 (Homo sapiens) 6480464 bisphenol A results in decreased expression of PLOD3 protein CTD PMID:31675489 and PMID:34186270 Plod3 Rat bisphenol A increases methylation ISO PLOD3 (Homo sapiens) 6480464 bisphenol A results in increased methylation of PLOD3 gene CTD PMID:31601247 Plod3 Rat bisphenol A multiple interactions ISO PLOD3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PLOD3 gene CTD PMID:31601247 Plod3 Rat bisphenol A increases expression ISO Plod3 (Mus musculus) 6480464 bisphenol A results in increased expression of PLOD3 mRNA CTD PMID:33221593 Plod3 Rat bisphenol A affects expression ISO PLOD3 (Homo sapiens) 6480464 bisphenol A affects the expression of PLOD3 mRNA CTD PMID:30903817 Plod3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PLOD3 mRNA CTD PMID:30816183 more ... Plod3 Rat bisphenol A decreases methylation ISO Plod3 (Mus musculus) 6480464 bisphenol A results in decreased methylation of PLOD3 promoter CTD PMID:27312807 Plod3 Rat bisphenol AF increases expression ISO PLOD3 (Homo sapiens) 6480464 bisphenol AF results in increased expression of PLOD3 protein CTD PMID:34186270 Plod3 Rat bisphenol F increases expression ISO PLOD3 (Homo sapiens) 6480464 bisphenol F results in increased expression of PLOD3 protein CTD PMID:34186270 Plod3 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of PLOD3 mRNA CTD PMID:21297351 Plod3 Rat cadmium dichloride increases expression ISO PLOD3 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PLOD3 mRNA CTD PMID:26472689 Plod3 Rat carbon nanotube increases expression ISO Plod3 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Plod3 Rat chlorogenic acid increases expression ISO PLOD3 (Homo sapiens) 6480464 Chlorogenic Acid results in increased expression of PLOD3 mRNA CTD PMID:20706672 Plod3 Rat chlorpyrifos increases expression ISO Plod3 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of PLOD3 mRNA CTD PMID:37019170 Plod3 Rat choline multiple interactions ISO Plod3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of PLOD3 gene more ... CTD PMID:20938992 and PMID:22915297 Plod3 Rat clobetasol increases expression ISO Plod3 (Mus musculus) 6480464 Clobetasol results in increased expression of PLOD3 mRNA CTD PMID:27462272 Plod3 Rat clofibrate multiple interactions ISO Plod3 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of PLOD3 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of PLOD3 mRNA] CTD PMID:17585979 Plod3 Rat clofibrate decreases expression ISO Plod3 (Mus musculus) 6480464 Clofibrate results in decreased expression of PLOD3 mRNA CTD PMID:17585979 Plod3 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of PLOD3 mRNA CTD PMID:26577399 Plod3 Rat cyclophosphamide multiple interactions ISO PLOD3 (Homo sapiens) 6480464 [Doxorubicin co-treated with Cyclophosphamide] affects the expression of PLOD3 mRNA CTD PMID:16322899 Plod3 Rat cyclosporin A increases expression ISO PLOD3 (Homo sapiens) 6480464 Cyclosporine results in increased expression of PLOD3 mRNA CTD PMID:20106945 and PMID:25562108 Plod3 Rat cyclosporin A decreases methylation ISO PLOD3 (Homo sapiens) 6480464 Cyclosporine results in decreased methylation of PLOD3 promoter CTD PMID:27989131 Plod3 Rat cyhalothrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of PLOD3 protein CTD PMID:34896426 Plod3 Rat cypermethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of PLOD3 protein CTD PMID:34896426 Plod3 Rat decabromodiphenyl ether increases expression ISO PLOD3 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of PLOD3 protein CTD PMID:31675489 Plod3 Rat Dibutyl phosphate affects expression ISO PLOD3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PLOD3 mRNA CTD PMID:37042841 Plod3 Rat dicrotophos increases expression ISO PLOD3 (Homo sapiens) 6480464 dicrotophos results in increased expression of PLOD3 mRNA CTD PMID:28302478 Plod3 Rat doxorubicin multiple interactions ISO PLOD3 (Homo sapiens) 6480464 [Doxorubicin co-treated with Cyclophosphamide] affects the expression of PLOD3 mRNA CTD PMID:16322899 Plod3 Rat doxorubicin decreases expression ISO PLOD3 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PLOD3 mRNA CTD PMID:29803840 Plod3 Rat ethanol affects expression ISO Plod3 (Mus musculus) 6480464 Ethanol affects the expression of PLOD3 mRNA CTD PMID:30319688 Plod3 Rat ethanol increases expression ISO Plod3 (Mus musculus) 6480464 Ethanol results in increased expression of PLOD3 mRNA CTD PMID:30319688 Plod3 Rat fenthion decreases expression ISO Plod3 (Mus musculus) 6480464 Fenthion results in decreased expression of PLOD3 mRNA CTD PMID:34813904 Plod3 Rat fenvalerate multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of PLOD3 protein CTD PMID:34896426 Plod3 Rat folic acid multiple interactions ISO Plod3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of PLOD3 gene CTD PMID:20938992 Plod3 Rat fulvestrant multiple interactions ISO PLOD3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PLOD3 gene CTD PMID:31601247 Plod3 Rat genistein increases expression ISO PLOD3 (Homo sapiens) 6480464 Genistein results in increased expression of PLOD3 mRNA CTD PMID:20706672 Plod3 Rat ivermectin decreases expression ISO PLOD3 (Homo sapiens) 6480464 Ivermectin results in decreased expression of PLOD3 protein CTD PMID:32959892 Plod3 Rat kainic acid decreases expression ISO Plod3 (Mus musculus) 6480464 Kainic Acid results in decreased expression of PLOD3 mRNA CTD PMID:17997037 Plod3 Rat L-1,4-dithiothreitol increases expression ISO PLOD3 (Homo sapiens) 6480464 Dithiothreitol results in increased expression of PLOD3 protein CTD PMID:21692457 Plod3 Rat L-methionine multiple interactions ISO Plod3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of PLOD3 gene more ... CTD PMID:20938992 and PMID:22915297 Plod3 Rat miconazole increases expression ISO Plod3 (Mus musculus) 6480464 Miconazole results in increased expression of PLOD3 mRNA CTD PMID:27462272 Plod3 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal decreases expression ISO PLOD3 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of PLOD3 protein CTD PMID:21692457 Plod3 Rat N-nitrosodiethylamine multiple interactions ISO Plod3 (Mus musculus) 6480464 [Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of PLOD3 gene CTD PMID:23968726 Plod3 Rat nicotine decreases expression ISO Plod3 (Mus musculus) 6480464 Nicotine results in decreased expression of PLOD3 mRNA CTD PMID:17997037 Plod3 Rat Osajin increases expression ISO PLOD3 (Homo sapiens) 6480464 osajin results in increased expression of PLOD3 mRNA CTD PMID:20706672 Plod3 Rat paracetamol multiple interactions ISO Plod3 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of PLOD3 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of PLOD3 mRNA] CTD PMID:17585979 Plod3 Rat paracetamol affects response to substance ISO PLOD3 (Homo sapiens) 6480464 PLOD3 gene polymorphism affects the susceptibility to Acetaminophen CTD PMID:26104854 Plod3 Rat paracetamol decreases expression ISO PLOD3 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PLOD3 mRNA CTD PMID:21420995 Plod3 Rat paracetamol affects expression ISO Plod3 (Mus musculus) 6480464 Acetaminophen affects the expression of PLOD3 mRNA CTD PMID:17562736 Plod3 Rat piperonyl butoxide multiple interactions ISO Plod3 (Mus musculus) 6480464 [Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of PLOD3 gene CTD PMID:23968726 Plod3 Rat Pomiferin increases expression ISO PLOD3 (Homo sapiens) 6480464 pomiferin results in increased expression of PLOD3 mRNA CTD PMID:20706672 Plod3 Rat potassium chromate increases expression ISO PLOD3 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of PLOD3 mRNA CTD PMID:22079256 Plod3 Rat potassium chromate multiple interactions ISO PLOD3 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of PLOD3 mRNA CTD PMID:22079256 Plod3 Rat puerarin increases expression ISO PLOD3 (Homo sapiens) 6480464 puerarin results in increased expression of PLOD3 mRNA CTD PMID:20706672 Plod3 Rat pyrethrins decreases expression EXP 6480464 Pyrethrins results in decreased expression of PLOD3 protein CTD PMID:34896426 Plod3 Rat quercetin multiple interactions ISO Plod3 (Mus musculus) 6480464 Quercetin inhibits the reaction [[Methionine deficiency co-treated with Choline deficiency] results in increased expression of PLOD3 mRNA] CTD PMID:22915297 Plod3 Rat resveratrol increases expression ISO PLOD3 (Homo sapiens) 6480464 resveratrol results in increased expression of PLOD3 mRNA CTD PMID:20706672 Plod3 Rat Rosavin increases expression ISO PLOD3 (Homo sapiens) 6480464 rosavin results in increased expression of PLOD3 mRNA CTD PMID:20706672 Plod3 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of PLOD3 protein CTD PMID:35544339 Plod3 Rat simvastatin decreases expression EXP 6480464 Simvastatin results in decreased expression of PLOD3 mRNA CTD PMID:16414398 Plod3 Rat Soman increases expression EXP 6480464 Soman results in increased expression of PLOD3 mRNA CTD PMID:19281266 Plod3 Rat thapsigargin decreases expression ISO PLOD3 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of PLOD3 protein CTD PMID:21692457 Plod3 Rat titanium dioxide decreases methylation ISO Plod3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PLOD3 gene and titanium dioxide results in decreased methylation of PLOD3 promoter CTD PMID:35295148 Plod3 Rat trichostatin A increases expression ISO PLOD3 (Homo sapiens) 6480464 trichostatin A results in increased expression of PLOD3 mRNA CTD PMID:24935251 Plod3 Rat valproic acid increases methylation ISO PLOD3 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PLOD3 gene CTD PMID:29154799
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) (S)-nicotine (ISO) 1,10-phenanthroline (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1,4-dithiothreitol (ISO) 17alpha-ethynylestradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,6-dinitrotoluene (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) aconitine (EXP) acrylamide (ISO) allethrin (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) cadmium dichloride (EXP,ISO) carbon nanotube (ISO) chlorogenic acid (ISO) chlorpyrifos (ISO) choline (ISO) clobetasol (ISO) clofibrate (ISO) Cuprizon (EXP) cyclophosphamide (ISO) cyclosporin A (ISO) cyhalothrin (EXP) cypermethrin (EXP) decabromodiphenyl ether (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) doxorubicin (ISO) ethanol (ISO) fenthion (ISO) fenvalerate (EXP) folic acid (ISO) fulvestrant (ISO) genistein (ISO) ivermectin (ISO) kainic acid (ISO) L-1,4-dithiothreitol (ISO) L-methionine (ISO) miconazole (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-nitrosodiethylamine (ISO) nicotine (ISO) Osajin (ISO) paracetamol (ISO) piperonyl butoxide (ISO) Pomiferin (ISO) potassium chromate (ISO) puerarin (ISO) pyrethrins (EXP) quercetin (ISO) resveratrol (ISO) Rosavin (ISO) rotenone (EXP) simvastatin (EXP) Soman (EXP) thapsigargin (ISO) titanium dioxide (ISO) trichostatin A (ISO) valproic acid (ISO)
Biological Process
basement membrane assembly (IEA,ISO) cellular response to hormone stimulus (IEP) collagen fibril organization (IBA,IEA,ISO) collagen metabolic process (IEA,ISO) endothelial cell morphogenesis (IEA,ISO) epidermis morphogenesis (IEA,ISO) hydroxylysine biosynthetic process (IEA,ISO) in utero embryonic development (IEA,ISO) lung morphogenesis (IEA,ISO) neural tube development (IEA,ISO) peptidyl-lysine hydroxylation (ISO,ISS) protein localization (IEA,ISO) protein O-linked glycosylation (IEA,ISO) vasodilation (IEA,ISO)
Cellular Component
collagen-containing extracellular matrix (IBA,ISO) endoplasmic reticulum (IBA,IEA,ISO,ISS) endoplasmic reticulum lumen (IEA) endoplasmic reticulum membrane (IEA) extracellular region (IEA) extracellular space (IBA,IEA,ISO,ISS) Golgi apparatus (IBA,IEA,ISO) membrane (IEA) rough endoplasmic reticulum (IEA) trans-Golgi network (IEA,ISO)
Molecular Function
catalytic activity (IEA) dioxygenase activity (IEA) glycosyltransferase activity (IEA) iron ion binding (IEA,ISO) L-ascorbic acid binding (IEA) metal ion binding (IEA,ISO) oxidoreductase activity (IEA) oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (IEA) procollagen galactosyltransferase activity (IEA,ISO,ISS) procollagen glucosyltransferase activity (IBA,IEA,ISO,ISS) procollagen-lysine 5-dioxygenase activity (IBA,IEA,ISO,ISS) protein binding (ISO) small molecule binding (ISO) transferase activity (IEA)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Identification, expression, and tissue distribution of the three rat lysyl hydroxylase isoforms.
Mercer DK, etal., Biochem Biophys Res Commun 2003 Aug 8;307(4):803-9.
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
5.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
6.
GOA pipeline
RGD automated data pipeline
7.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Comprehensive gene review and curation
RGD comprehensive gene curation
10.
Differential expression of procollagen lysine 2-oxoglutarate 5-deoxygenase and matrix metalloproteinase isoforms in hypothyroid rat ovary and disintegration of extracellular matrix.
Saha SK, etal., Endocrinology. 2005 Jul;146(7):2963-75. Epub 2005 Apr 7.
11.
Barrier to autointegration factor 1, procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3, and splicing factor 3b subunit 4 as early-stage cancer decision markers and drivers of hepatocellular carcinoma.
Shen Q, etal., Hepatology. 2018 Apr;67(4):1360-1377. doi: 10.1002/hep.29606. Epub 2018 Feb 20.
Plod3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 25,313,070 - 25,323,631 (-) NCBI GRCr8 mRatBN7.2 12 19,676,384 - 19,686,945 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 19,676,386 - 19,686,960 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 20,814,848 - 20,825,421 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 21,427,553 - 21,438,126 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 20,492,753 - 20,503,314 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 22,716,421 - 22,726,982 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 22,716,423 - 22,726,982 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 24,728,205 - 24,738,766 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 20,856,527 - 20,867,088 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 20,846,399 - 20,856,690 (+) NCBI Celera 12 21,452,299 - 21,462,860 (-) NCBI Celera Cytogenetic Map 12 q12 NCBI
PLOD3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 101,205,984 - 101,217,581 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 101,205,977 - 101,218,420 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 100,849,265 - 100,860,862 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 100,635,978 - 100,647,731 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 100,442,700 - 100,454,303 NCBI Celera 7 95,858,417 - 95,870,169 (-) NCBI Celera Cytogenetic Map 7 q22.1 NCBI HuRef 7 95,442,117 - 95,454,228 (-) NCBI HuRef CHM1_1 7 100,779,662 - 100,791,414 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 102,529,447 - 102,541,882 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 100,207,645 - 100,219,398 (-) NCBI
Plod3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 137,015,873 - 137,025,500 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 137,015,873 - 137,025,502 (+) Ensembl GRCm39 Ensembl GRCm38 5 136,987,019 - 136,996,646 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 136,987,019 - 136,996,648 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 137,462,889 - 137,472,516 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 137,271,649 - 137,281,166 (+) NCBI MGSCv36 mm8 Celera 5 134,003,006 - 134,012,645 (+) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 76.09 NCBI
Plod3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955456 16,082,437 - 16,093,389 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955456 16,082,424 - 16,090,773 (+) NCBI ChiLan1.0 ChiLan1.0
PLOD3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 119,219,216 - 119,230,857 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 167,483,838 - 167,495,393 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 93,347,335 - 93,358,921 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 106,587,858 - 106,599,605 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 106,587,858 - 106,599,605 (-) Ensembl panpan1.1 panPan2
PLOD3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 8,664,135 - 8,671,637 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 8,664,358 - 8,671,620 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 10,361,502 - 10,368,957 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 8,483,656 - 8,491,120 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 8,483,333 - 8,491,117 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 8,443,884 - 8,451,311 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 8,414,481 - 8,421,939 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 8,579,093 - 8,586,540 (+) NCBI UU_Cfam_GSD_1.0
Plod3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 132,939,235 - 132,946,261 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936543 1,090,253 - 1,097,301 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936543 1,090,268 - 1,097,170 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PLOD3
PLOD3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 28 11,962,394 - 11,974,206 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 28 11,962,286 - 11,975,228 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666070 4,378,287 - 4,390,520 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Plod3
.
Predicted Target Of
Count of predictions: 47 Count of miRNA genes: 40 Interacting mature miRNAs: 46 Transcripts: ENSRNOT00000001921 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631560 Apr1 Acute phase response QTL 1 6.1 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 19144362 46669029 Rat 61443 Btemp2 Thermal response to stress QTL 2 3.3 0.000094 body temperature trait (VT:0005535) core body temperature (CMO:0001036) 12 15025183 20794014 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 61324 Eae5 Experimental allergic encephalomyelitis QTL 5 14 nervous system integrity trait (VT:0010566) percentage of study population developing relapsing-remitting experimental autoimmune encephalomyelitis during a period of time (CMO:0001402) 12 19610870 46669029 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 1549829 Scl48 Serum cholesterol level QTL 48 5 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 12 9603277 46669029 Rat 61331 Eau2 Experimental allergic uveoretinitis QTL 2 0.0005 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 12 8525423 28064601 Rat 737822 Alc10 Alcohol consumption QTL 10 2.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 12 19610870 40218516 Rat 2293684 Bmd26 Bone mineral density QTL 26 4.4 0.0002 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 12 15872653 32974238 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 1331761 Bp218 Blood pressure QTL 218 2.973 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 45055165 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 1300157 Rf21 Renal function QTL 21 4.4 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 12 9318216 32103380 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 1298081 Cia25 Collagen induced arthritis QTL 25 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610889 35682913 Rat 2300186 Bmd59 Bone mineral density QTL 59 7.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 12 10474137 46669029 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 1331755 Bp219 Blood pressure QTL 219 3.041 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 12 11073825 28064557 Rat 2306789 Ean6 Experimental allergic neuritis QTL 6 4.9 nervous system integrity trait (VT:0010566) experimental autoimmune neuritis severity score (CMO:0001528) 12 19610870 24139202 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 5684888 Pia42 Pristane induced arthritis QTL 42 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 19610870 42828880 Rat 1549912 Bp268 Blood pressure QTL 268 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 13182736 46669029 Rat 2302060 Pia37 Pristane induced arthritis QTL 37 6.1 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 13198157 46669029 Rat 1641928 Alcrsp5 Alcohol response QTL 5 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 12 12812385 46669029 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 1549902 Bp269 Blood pressure QTL 269 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 13182736 46669029 Rat 61404 Bw120 Body weight QTL 120 5.1 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 12 12351619 46669029 Rat 1331786 Kidm11 Kidney mass QTL 11 3.571 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 12 11073825 24234895 Rat 2293699 Bss49 Bone structure and strength QTL 49 5.61 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 12 10474137 46669029 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 61416 Pia4 Pristane induced arthritis QTL 4 8.4 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 12 13635523 30827399 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 61421 Cia12 Collagen induced arthritis QTL 12 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 13635523 35682913 Rat 2303569 Gluco44 Glucose level QTL 44 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 12812385 46669029 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2293086 Iddm30 Insulin dependent diabetes mellitus QTL 30 3.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 8449490 28302290 Rat 631543 Bp83 Blood pressure QTL 83 5.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 15550826 38478808 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001921 ⟹ ENSRNOP00000001921
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 19,676,386 - 19,686,960 (-) Ensembl Rnor_6.0 Ensembl 12 22,716,423 - 22,726,982 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000111361 ⟹ ENSRNOP00000088013
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 19,676,386 - 19,686,960 (-) Ensembl
RefSeq Acc Id:
NM_178101 ⟹ NP_835202
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 25,313,070 - 25,323,631 (-) NCBI mRatBN7.2 12 19,676,384 - 19,686,945 (-) NCBI Rnor_6.0 12 22,716,421 - 22,726,982 (-) NCBI Rnor_5.0 12 24,728,205 - 24,738,766 (-) NCBI RGSC_v3.4 12 20,856,527 - 20,867,088 (+) RGD Celera 12 21,452,299 - 21,462,860 (-) RGD
Sequence:
CGGTTCCTCAGGCGTGAGTCGGGCTGTGTCGGGGACCAGACCCTCGGCTCCTCCCCACCCTCCAGCCCGCGCCCGCGCGACAATCCTTGCCTTGTCTCGCCGTCTGCATCTCGGGTTTTAGGTGGCCT
hide sequence
RefSeq Acc Id:
XM_063271149 ⟹ XP_063127219
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 25,318,656 - 25,323,363 (-) NCBI
RefSeq Acc Id:
NP_835202 ⟸ NM_178101
- Peptide Label:
precursor
- UniProtKB:
Q811A5 (UniProtKB/Swiss-Prot), Q5U367 (UniProtKB/Swiss-Prot), A6J056 (UniProtKB/TrEMBL), A0A8I6A8W8 (UniProtKB/TrEMBL)
- Sequence:
MAASVPEPRLLLLLLLLLPPLPPVTSASDRPRGANPVNPDKLLVITVATAETEGYRRFLQSAEFFNYTVRTLGLGQEWRGGDVARTVGGGQKVRWLKKEMEKYASQEDMIIMFVDSYDVILASSPTEL
hide sequence
Ensembl Acc Id:
ENSRNOP00000001921 ⟸ ENSRNOT00000001921
Ensembl Acc Id:
ENSRNOP00000088013 ⟸ ENSRNOT00000111361
RefSeq Acc Id:
XP_063127219 ⟸ XM_063271149
- Peptide Label:
isoform X1
RGD ID: 13698528 Promoter ID: EPDNEW_R9052 Type: initiation region Name: Plod3_1 Description: procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R9053 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 22,726,780 - 22,726,840 EPDNEW
RGD ID: 13698529 Promoter ID: EPDNEW_R9053 Type: initiation region Name: Plod3_2 Description: procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R9052 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 22,726,985 - 22,727,045 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-02-11
Plod3
procollagen-lysine, 2-oxoglutarate 5-dioxygenase 3
Symbol and Name status set to approved
625702 APPROVED
Note Type
Note
Reference
gene_expression
ubiquitously expressed
633907
