Symbol:
Adam17
Name:
ADAM metallopeptidase domain 17
RGD ID:
620404
Description:
Predicted to enable several functions, including PDZ domain binding activity; metallopeptidase activity; and signaling receptor binding activity. Involved in several processes, including cellular response to mechanical stimulus; positive regulation of ERK1 and ERK2 cascade; and regulation of apoptotic process. Located in apical part of cell and cell surface. Biomarker of Alzheimer's disease; congestive heart failure; and thoracic aortic aneurysm. Human ortholog(s) of this gene implicated in Alzheimer's disease; inflammatory bowel disease; and type 2 diabetes mellitus. Orthologous to human ADAM17 (ADAM metallopeptidase domain 17); PARTICIPATES IN epidermal growth factor/neuregulin signaling pathway; interleukin-6 signaling pathway; Notch signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; 2-amino-2-deoxy-D-glucopyranose.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
a disintegrin and metallopeptidase domain 17; a disintegrin and metalloprotease domain 17; a disintegrin and metalloproteinase domain 17; a disintegrin and metalloproteinase domain 17 (tumor necrosis factor, alpha, converting enzyme); ADAM 17; disintegrin and metalloproteinase domain-containing protein 17; TACE; TNF-alpha convertase; TNF-alpha converting enzyme; TNF-alpha-converting enzyme
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 46,601,583 - 46,663,690 (-) NCBI GRCr8 mRatBN7.2 6 40,872,936 - 40,920,700 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 40,872,856 - 40,920,639 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 41,195,035 - 41,242,751 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 41,509,725 - 41,557,442 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 40,942,985 - 40,990,706 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 43,400,525 - 43,448,280 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 43,400,528 - 43,448,280 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 60,268,228 - 60,315,989 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 41,882,432 - 41,930,755 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 41,885,557 - 41,933,881 (-) NCBI Celera 6 40,160,004 - 40,207,760 (-) NCBI Celera Cytogenetic Map 6 q16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Adam17 Rat 1,2-dimethylhydrazine increases expression ISO Adam17 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ADAM17 mRNA CTD PMID:22206623 Adam17 Rat 17alpha-ethynylestradiol affects expression ISO Adam17 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of ADAM17 mRNA CTD PMID:17555576 Adam17 Rat 17alpha-ethynylestradiol multiple interactions ISO Adam17 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ADAM17 mRNA CTD PMID:17942748 Adam17 Rat 17alpha-ethynylestradiol increases expression ISO Adam17 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of ADAM17 mRNA CTD PMID:17942748 Adam17 Rat 17beta-estradiol multiple interactions ISO ADAM17 (Homo sapiens) 6480464 [Progesterone co-treated with Estradiol] results in decreased expression of ADAM17 mRNA CTD PMID:18692832 Adam17 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Adam17 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ADAM17 mRNA CTD PMID:17942748 Adam17 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ADAM17 mRNA CTD PMID:34747641 Adam17 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Adam17 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ADAM17 mRNA CTD PMID:21570461 Adam17 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Adam17 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ADAM17 mRNA CTD PMID:17942748 Adam17 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of ADAM17 mRNA CTD PMID:21346803 Adam17 Rat 2-amino-2-deoxy-D-glucopyranose multiple interactions EXP 6480464 Glucosamine inhibits the reaction [IL1B results in increased expression of ADAM17 mRNA] and IL1B affects the reaction [Glucosamine results in increased expression of ADAM17 mRNA] CTD PMID:17109745 Adam17 Rat 2-amino-2-deoxy-D-glucopyranose increases expression EXP 6480464 Glucosamine results in increased expression of ADAM17 mRNA CTD PMID:17109745 Adam17 Rat 2-hydroxypropanoic acid decreases expression ISO ADAM17 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of ADAM17 mRNA CTD PMID:30851411 Adam17 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Adam17 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Adam17 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of ADAM17 mRNA CTD PMID:20188158 Adam17 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO ADAM17 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ADAM17 mRNA CTD PMID:28628672 Adam17 Rat 4,4'-diaminodiphenylmethane increases expression ISO Adam17 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of ADAM17 mRNA CTD PMID:18648102 Adam17 Rat 4,4'-sulfonyldiphenol affects expression ISO Adam17 (Mus musculus) 6480464 bisphenol S affects the expression of ADAM17 mRNA CTD PMID:39298647 Adam17 Rat 4-nonylphenol affects response to substance ISO Adam17 (Mus musculus) 6480464 ADAM17 protein affects the susceptibility to 4-nonylphenol CTD PMID:28703301 Adam17 Rat 4-nonylphenol multiple interactions ISO Adam17 (Mus musculus) 6480464 [ADAM17 protein affects the susceptibility to 4-nonylphenol] which affects the secretion of BTC protein more ... CTD PMID:28703301 Adam17 Rat 4-phenylbutyric acid multiple interactions ISO ADAM17 (Homo sapiens) 6480464 4-phenylbutyric acid inhibits the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of ADAM17 protein] and 4-phenylbutyric acid inhibits the reaction [SFTPC protein mutant form results in increased expression of ADAM17 protein] CTD PMID:27638906 Adam17 Rat 7alpha-hydroxycholesterol decreases activity EXP 6480464 cholest-5-en-3 beta and 7 alpha-diol results in decreased activity of ADAM17 protein CTD PMID:15591071 Adam17 Rat aceclofenac increases response to substance ISO Adam17 (Mus musculus) 6480464 ADAM17 results in increased susceptibility to aceclofenac CTD PMID:12147693 Adam17 Rat acrolein multiple interactions ISO ADAM17 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of ADAM17 mRNA more ... CTD PMID:15531749 and PMID:32699268 Adam17 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of ADAM17 mRNA CTD PMID:28959563 Adam17 Rat aldehydo-D-glucosamine multiple interactions EXP 6480464 Glucosamine inhibits the reaction [IL1B results in increased expression of ADAM17 mRNA] and IL1B affects the reaction [Glucosamine results in increased expression of ADAM17 mRNA] CTD PMID:17109745 Adam17 Rat aldehydo-D-glucosamine increases expression EXP 6480464 Glucosamine results in increased expression of ADAM17 mRNA CTD PMID:17109745 Adam17 Rat aldehydo-D-glucose decreases expression ISO ADAM17 (Homo sapiens) 6480464 Glucose results in decreased expression of ADAM17 mRNA CTD PMID:31655124 Adam17 Rat all-trans-retinoic acid affects localization ISO ADAM17 (Homo sapiens) 6480464 Tretinoin affects the localization of ADAM17 protein CTD PMID:19476501 Adam17 Rat all-trans-retinoic acid increases expression ISO ADAM17 (Homo sapiens) 6480464 Tretinoin results in increased expression of ADAM17 mRNA CTD PMID:33167477 Adam17 Rat all-trans-retinoic acid affects localization ISO Adam17 (Mus musculus) 6480464 Tretinoin affects the localization of ADAM17 protein CTD PMID:19476501 Adam17 Rat alpha-pinene multiple interactions ISO ADAM17 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of ADAM17 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of ADAM17 mRNA CTD PMID:32699268 Adam17 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ADAM17 mRNA CTD PMID:16483693 Adam17 Rat androgen antagonist multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of ADAM17 mRNA CTD PMID:25607892 Adam17 Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions ISO ADAM17 (Homo sapiens) 6480464 pyrazolanthrone inhibits the reaction [hydroquinone results in increased expression of ADAM17 protein] and pyrazolanthrone inhibits the reaction [hydroquinone results in increased expression of and results in increased stability of ADAM17 mRNA] CTD PMID:23791922 Adam17 Rat antirheumatic drug decreases expression ISO ADAM17 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of ADAM17 mRNA CTD PMID:24449571 Adam17 Rat aristolochic acid A decreases expression ISO ADAM17 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of ADAM17 mRNA CTD PMID:33212167 Adam17 Rat arsane decreases expression ISO ADAM17 (Homo sapiens) 6480464 Arsenic results in decreased expression of ADAM17 mRNA CTD PMID:11134558 Adam17 Rat arsenic atom decreases expression ISO ADAM17 (Homo sapiens) 6480464 Arsenic results in decreased expression of ADAM17 mRNA CTD PMID:11134558 Adam17 Rat arsenous acid increases expression ISO Adam17 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of ADAM17 mRNA CTD PMID:35676786 Adam17 Rat atorvastatin calcium decreases expression ISO Adam17 (Mus musculus) 6480464 Atorvastatin results in decreased expression of ADAM17 protein CTD PMID:18360054 Adam17 Rat atrazine increases expression ISO ADAM17 (Homo sapiens) 6480464 Atrazine results in increased expression of ADAM17 mRNA CTD PMID:22378314 Adam17 Rat bellidifolin multiple interactions ISO Adam17 (Mus musculus) 6480464 bellidifolin inhibits the reaction [Isoproterenol results in increased expression of ADAM17 mRNA] CTD PMID:37528096 Adam17 Rat bellidifolin multiple interactions EXP 6480464 bellidifolin inhibits the reaction [Isoproterenol results in increased expression of ADAM17 mRNA] CTD PMID:37528096 Adam17 Rat benzo[a]pyrene affects methylation ISO ADAM17 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ADAM17 intron CTD PMID:30157460 Adam17 Rat benzo[a]pyrene diol epoxide I decreases expression ISO ADAM17 (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Adam17 Rat beta-D-glucosamine multiple interactions EXP 6480464 Glucosamine inhibits the reaction [IL1B results in increased expression of ADAM17 mRNA] and IL1B affects the reaction [Glucosamine results in increased expression of ADAM17 mRNA] CTD PMID:17109745 Adam17 Rat beta-D-glucosamine increases expression EXP 6480464 Glucosamine results in increased expression of ADAM17 mRNA CTD PMID:17109745 Adam17 Rat bisphenol A decreases expression ISO ADAM17 (Homo sapiens) 6480464 bisphenol A results in decreased expression of ADAM17 mRNA CTD PMID:20678512 Adam17 Rat bisphenol A increases expression ISO ADAM17 (Homo sapiens) 6480464 bisphenol A analog results in increased expression of ADAM17 mRNA CTD PMID:32387340 Adam17 Rat bisphenol A multiple interactions ISO ADAM17 (Homo sapiens) 6480464 [Selenium deficiency co-treated with bisphenol A] results in increased expression of ADAM17 protein and bisphenol A promotes the reaction [Selenium deficiency results in increased expression of ADAM17 mRNA] CTD PMID:37422542 Adam17 Rat bisphenol A affects expression ISO ADAM17 (Homo sapiens) 6480464 bisphenol A affects the expression of ADAM17 mRNA CTD PMID:30903817 Adam17 Rat bisphenol A decreases expression ISO Adam17 (Mus musculus) 6480464 bisphenol A results in decreased expression of ADAM17 mRNA CTD PMID:29161229 Adam17 Rat bisphenol A multiple interactions ISO Adam17 (Mus musculus) 6480464 [ADAM17 protein co-treated with ADAM10 protein] affects the reaction [bisphenol A results in increased secretion of TGFA protein] more ... CTD PMID:28703301 Adam17 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ADAM17 mRNA CTD PMID:25181051 Adam17 Rat bisphenol A increases expression ISO Adam17 (Mus musculus) 6480464 bisphenol A results in increased expression of ADAM17 mRNA CTD PMID:21932408 and PMID:26063408 Adam17 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of ADAM17 mRNA and [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben] results in increased expression of ADAM17 mRNA CTD PMID:25607892 Adam17 Rat bisphenol F multiple interactions ISO ADAM17 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ADAM17 mRNA CTD PMID:28628672 Adam17 Rat bleomycin A2 multiple interactions ISO Adam17 (Mus musculus) 6480464 Bleomycin results in increased expression of and results in increased activity of ADAM17 protein CTD PMID:22687607 Adam17 Rat Butylparaben multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of ADAM17 mRNA and [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben] results in increased expression of ADAM17 mRNA CTD PMID:25607892 Adam17 Rat butyric acid increases expression EXP 6480464 Butyric Acid results in increased expression of ADAM17 mRNA CTD PMID:12800193 Adam17 Rat calcium dichloride increases expression EXP 6480464 Calcium Chloride results in increased expression of ADAM17 mRNA and Calcium Chloride results in increased expression of ADAM17 protein CTD PMID:20621845 Adam17 Rat cobalt dichloride decreases expression ISO ADAM17 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of ADAM17 mRNA CTD PMID:19376846 Adam17 Rat copper atom multiple interactions ISO ADAM17 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of ADAM17 mRNA CTD PMID:20971185 Adam17 Rat copper(0) multiple interactions ISO ADAM17 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of ADAM17 mRNA CTD PMID:20971185 Adam17 Rat copper(II) sulfate decreases expression ISO ADAM17 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of ADAM17 mRNA CTD PMID:20599845 Adam17 Rat copper(II) sulfate increases expression ISO ADAM17 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of ADAM17 mRNA CTD PMID:19549813 Adam17 Rat cordycepin decreases expression ISO ADAM17 (Homo sapiens) 6480464 cordycepin results in decreased expression of ADAM17 protein CTD PMID:36558177 Adam17 Rat cordycepin multiple interactions ISO ADAM17 (Homo sapiens) 6480464 cordycepin inhibits the reaction [Cycloheximide results in decreased stability of ADAM17 protein] CTD PMID:36558177 Adam17 Rat curcumin multiple interactions ISO ADAM17 (Homo sapiens) 6480464 Curcumin inhibits the reaction [TNF protein results in increased expression of ADAM17 mRNA] CTD PMID:17666914 Adam17 Rat cycloheximide decreases stability ISO ADAM17 (Homo sapiens) 6480464 Cycloheximide results in decreased stability of ADAM17 protein CTD PMID:36558177 Adam17 Rat cycloheximide multiple interactions ISO ADAM17 (Homo sapiens) 6480464 cordycepin inhibits the reaction [Cycloheximide results in decreased stability of ADAM17 protein] more ... CTD PMID:36558177 Adam17 Rat cyclosporin A increases expression ISO ADAM17 (Homo sapiens) 6480464 Cyclosporine results in increased expression of ADAM17 mRNA CTD PMID:20106945 more ... Adam17 Rat cyclosporin A multiple interactions ISO Adam17 (Mus musculus) 6480464 polyethylene glycol-superoxide dismutase inhibits the reaction [Cyclosporine results in increased activity of ADAM17 protein] and polyethylene glycol-superoxide dismutase inhibits the reaction [Cyclosporine results in increased phosphorylation of ADAM17 protein] CTD PMID:32866465 Adam17 Rat cyclosporin A increases activity ISO Adam17 (Mus musculus) 6480464 Cyclosporine results in increased activity of ADAM17 protein CTD PMID:32866465 Adam17 Rat D-glucose decreases expression ISO ADAM17 (Homo sapiens) 6480464 Glucose results in decreased expression of ADAM17 mRNA CTD PMID:31655124 Adam17 Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of ADAM17 mRNA CTD PMID:14618091 Adam17 Rat dexamethasone multiple interactions ISO ADAM17 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ADAM17 mRNA CTD PMID:28628672 Adam17 Rat dextran sulfate multiple interactions ISO Adam17 (Mus musculus) 6480464 ADAM17 protein affects the reaction [Dextran Sulfate results in decreased expression of SIRT1 mRNA] more ... CTD PMID:24548422 Adam17 Rat dextran sulfate increases expression ISO Adam17 (Mus musculus) 6480464 Dextran Sulfate results in increased expression of ADAM17 mRNA CTD PMID:24548422 Adam17 Rat dextran sulfate affects response to substance ISO Adam17 (Mus musculus) 6480464 ADAM17 protein affects the susceptibility to Dextran Sulfate CTD PMID:24548422 Adam17 Rat diarsenic trioxide increases expression ISO Adam17 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of ADAM17 mRNA CTD PMID:35676786 Adam17 Rat diazinon affects expression EXP 6480464 Diazinon affects the expression of ADAM17 mRNA CTD PMID:22546817 Adam17 Rat Dibutyl phosphate affects expression ISO ADAM17 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ADAM17 mRNA CTD PMID:37042841 Adam17 Rat dicrotophos decreases expression ISO ADAM17 (Homo sapiens) 6480464 dicrotophos results in decreased expression of ADAM17 mRNA CTD PMID:28302478 Adam17 Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of ADAM17 mRNA CTD PMID:22546817 Adam17 Rat diosgenin multiple interactions EXP 6480464 Diosgenin inhibits the reaction [Streptozocin results in increased expression of ADAM17 mRNA] and Diosgenin inhibits the reaction [Streptozocin results in increased expression of ADAM17 protein] CTD PMID:35305976 Adam17 Rat elemental selenium multiple interactions ISO ADAM17 (Homo sapiens) 6480464 [Selenium deficiency co-treated with bisphenol A] results in increased expression of ADAM17 protein and bisphenol A promotes the reaction [Selenium deficiency results in increased expression of ADAM17 mRNA] CTD PMID:37422542 Adam17 Rat elemental selenium increases expression ISO ADAM17 (Homo sapiens) 6480464 Selenium deficiency results in increased expression of ADAM17 mRNA CTD PMID:37422542 Adam17 Rat enzacamene multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of ADAM17 mRNA and [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben] results in increased expression of ADAM17 mRNA CTD PMID:25607892 Adam17 Rat enzalutamide affects expression ISO ADAM17 (Homo sapiens) 6480464 enzalutamide affects the expression of ADAM17 mRNA CTD PMID:30940724 Adam17 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of ADAM17 mRNA CTD PMID:17920746 Adam17 Rat ethanol increases expression ISO Adam17 (Mus musculus) 6480464 Ethanol results in increased expression of ADAM17 mRNA CTD PMID:30319688 Adam17 Rat ethyl methanesulfonate increases expression ISO ADAM17 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of ADAM17 mRNA CTD PMID:23649840 Adam17 Rat fenamic acid increases response to substance ISO Adam17 (Mus musculus) 6480464 ADAM17 results in increased susceptibility to fenamic acid CTD PMID:12147693 Adam17 Rat flufenamic acid increases response to substance ISO Adam17 (Mus musculus) 6480464 ADAM17 results in increased susceptibility to Flufenamic Acid CTD PMID:12147693 Adam17 Rat FR900359 increases phosphorylation ISO ADAM17 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of ADAM17 protein CTD PMID:37730182 Adam17 Rat gemcitabine multiple interactions ISO ADAM17 (Homo sapiens) 6480464 ADAM17 protein promotes the reaction [Gemcitabine results in increased cleavage of AREG protein] CTD PMID:20726858 Adam17 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ADAM17 mRNA CTD PMID:22061828 Adam17 Rat glucose decreases expression ISO ADAM17 (Homo sapiens) 6480464 Glucose results in decreased expression of ADAM17 mRNA CTD PMID:31655124 Adam17 Rat glyphosate decreases expression ISO ADAM17 (Homo sapiens) 6480464 Glyphosate results in decreased expression of ADAM17 mRNA CTD PMID:31295307 Adam17 Rat hexadecanoic acid multiple interactions ISO ADAM17 (Homo sapiens) 6480464 [[Palmitic Acid co-treated with Oleic Acid] results in increased abundance of Fatty Acids more ... CTD PMID:36055749 Adam17 Rat hydroquinone increases expression ISO ADAM17 (Homo sapiens) 6480464 hydroquinone results in increased expression of ADAM17 protein CTD PMID:23791922 Adam17 Rat hydroquinone multiple interactions ISO ADAM17 (Homo sapiens) 6480464 4-(4-fluorophenyl)-2-(4-hydroxyphenyl)-5-(4-pyridyl)imidazole inhibits the reaction [hydroquinone results in increased expression of ADAM17 protein] more ... CTD PMID:23791922 Adam17 Rat indometacin multiple interactions ISO ADAM17 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of ADAM17 mRNA CTD PMID:28628672 Adam17 Rat isoprenaline multiple interactions EXP 6480464 bellidifolin inhibits the reaction [Isoproterenol results in increased expression of ADAM17 mRNA] CTD PMID:37528096 Adam17 Rat isoprenaline increases expression ISO Adam17 (Mus musculus) 6480464 Isoproterenol results in increased expression of ADAM17 mRNA CTD PMID:37528096 Adam17 Rat isoprenaline multiple interactions ISO Adam17 (Mus musculus) 6480464 bellidifolin inhibits the reaction [Isoproterenol results in increased expression of ADAM17 mRNA] CTD PMID:37528096 Adam17 Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of ADAM17 mRNA CTD PMID:37528096 Adam17 Rat lactucin multiple interactions ISO ADAM17 (Homo sapiens) 6480464 lactucin inhibits the reaction [[[Palmitic Acid co-treated with Oleic Acid] results in increased abundance of Fatty Acids more ... CTD PMID:36055749 Adam17 Rat lipopolysaccharide multiple interactions ISO Adam17 (Mus musculus) 6480464 4-hydroxyisoleucine inhibits the reaction [Lipopolysaccharides results in increased expression of ADAM17 mRNA] more ... CTD PMID:21874253 and PMID:33298044 Adam17 Rat lipopolysaccharide increases expression ISO Adam17 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of ADAM17 more ... CTD PMID:21874253 and PMID:33298044 Adam17 Rat melittin multiple interactions ISO ADAM17 (Homo sapiens) 6480464 Melitten results in increased cleavage of and results in increased activity of ADAM17 protein CTD PMID:22613720 Adam17 Rat methyl methanesulfonate increases expression ISO ADAM17 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of ADAM17 mRNA CTD PMID:23649840 Adam17 Rat Methylthiouracil multiple interactions ISO ADAM17 (Homo sapiens) 6480464 Methylthiouracil inhibits the reaction [lipopolysaccharide more ... CTD PMID:26298005 Adam17 Rat N(6),N(6)-dimethyladenosine decreases expression ISO ADAM17 (Homo sapiens) 6480464 N(6) and N(6)-dimethyladenosine results in decreased expression of ADAM17 protein CTD PMID:36558177 Adam17 Rat N(6),N(6)-dimethyladenosine multiple interactions ISO ADAM17 (Homo sapiens) 6480464 N(6) and N(6)-dimethyladenosine inhibits the reaction [Cycloheximide results in decreased stability of ADAM17 protein] CTD PMID:36558177 Adam17 Rat N-acetyl-L-cysteine multiple interactions ISO ADAM17 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [necrostatin-1 results in increased expression of ADAM17 mRNA] and Acetylcysteine inhibits the reaction [necrostatin-1 results in increased expression of ADAM17 protein] CTD PMID:37422542 Adam17 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO ADAM17 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of ADAM17 protein CTD PMID:27638906 Adam17 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO ADAM17 (Homo sapiens) 6480464 4-methylumbelliferone 8-carbaldehyde inhibits the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of ADAM17 protein] and 4-phenylbutyric acid inhibits the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of ADAM17 protein] CTD PMID:27638906 Adam17 Rat N-methyl-4-phenylpyridinium multiple interactions ISO ADAM17 (Homo sapiens) 6480464 U 0126 affects the reaction [1-Methyl-4-phenylpyridinium affects the expression of ADAM17 mRNA] CTD PMID:12710931 Adam17 Rat nickel dichloride affects expression EXP 6480464 nickel chloride affects the expression of ADAM17 mRNA CTD PMID:22546817 Adam17 Rat nicotinic acid increases expression EXP 6480464 Niacin results in increased expression of ADAM17 protein CTD PMID:19223914 Adam17 Rat oleic acid multiple interactions ISO ADAM17 (Homo sapiens) 6480464 [[Palmitic Acid co-treated with Oleic Acid] results in increased abundance of Fatty Acids more ... CTD PMID:36055749 Adam17 Rat oxycodone decreases expression EXP 6480464 Oxycodone results in decreased expression of ADAM17 mRNA CTD PMID:23439660 Adam17 Rat ozone multiple interactions ISO ADAM17 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of ADAM17 mRNA more ... CTD PMID:32699268 Adam17 Rat p-menthan-3-ol increases expression ISO ADAM17 (Homo sapiens) 6480464 Menthol results in increased expression of ADAM17 mRNA CTD PMID:26760959 Adam17 Rat paracetamol multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of ADAM17 mRNA CTD PMID:25607892 Adam17 Rat paracetamol decreases expression ISO ADAM17 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ADAM17 mRNA CTD PMID:26690555 Adam17 Rat paraquat increases expression ISO ADAM17 (Homo sapiens) 6480464 Paraquat results in increased expression of ADAM17 mRNA and Paraquat results in increased expression of ADAM17 protein CTD PMID:29495171 Adam17 Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of ADAM17 mRNA CTD PMID:19162173 Adam17 Rat phenobarbital affects expression ISO ADAM17 (Homo sapiens) 6480464 Phenobarbital affects the expression of ADAM17 mRNA CTD PMID:19159669 Adam17 Rat phenylephrine multiple interactions EXP 6480464 ADAM17 protein affects the reaction [Phenylephrine results in increased cleavage of and results in increased secretion of EGF protein] more ... CTD PMID:16760267 Adam17 Rat phorbol 13-acetate 12-myristate increases response to substance ISO Adam17 (Mus musculus) 6480464 ADAM17 results in increased susceptibility to Tetradecanoylphorbol Acetate CTD PMID:12147693 Adam17 Rat phorbol 13-acetate 12-myristate multiple interactions ISO Adam17 (Mus musculus) 6480464 ADAM17 protein affects the reaction [Tetradecanoylphorbol Acetate results in increased secretion of HBEGF protein] and ADAM17 protein affects the reaction [Tetradecanoylphorbol Acetate results in increased secretion of TGFA protein] CTD PMID:28703301 Adam17 Rat phorbol 13-acetate 12-myristate increases expression ISO ADAM17 (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased expression of ADAM17 protein CTD PMID:23774263 and PMID:26298005 Adam17 Rat phorbol 13-acetate 12-myristate multiple interactions ISO ADAM17 (Homo sapiens) 6480464 [Rosmarinic Acid inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of ADAM17 protein]] which affects the localization of PROCR protein more ... CTD PMID:23774263 more ... Adam17 Rat probenecid multiple interactions EXP 6480464 Probenecid inhibits the reaction [Testosterone results in increased activity of ADAM17 protein] CTD PMID:37352135 Adam17 Rat progesterone multiple interactions ISO ADAM17 (Homo sapiens) 6480464 [Progesterone co-treated with Estradiol] results in decreased expression of ADAM17 mRNA CTD PMID:18692832 Adam17 Rat progesterone decreases expression ISO ADAM17 (Homo sapiens) 6480464 Progesterone results in decreased expression of ADAM17 mRNA CTD PMID:18692832 Adam17 Rat propiconazole increases expression ISO Adam17 (Mus musculus) 6480464 propiconazole results in increased expression of ADAM17 mRNA CTD PMID:21278054 Adam17 Rat protein kinase inhibitor multiple interactions ISO ADAM17 (Homo sapiens) 6480464 Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in increased expression of ADAM17 mRNA] CTD PMID:28003376 Adam17 Rat rac-lactic acid decreases expression ISO ADAM17 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of ADAM17 mRNA CTD PMID:30851411 Adam17 Rat resveratrol multiple interactions ISO Adam17 (Mus musculus) 6480464 resveratrol inhibits the reaction [Dextran Sulfate results in increased expression of ADAM17 mRNA] CTD PMID:24548422 Adam17 Rat resveratrol multiple interactions ISO ADAM17 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of ADAM17 mRNA CTD PMID:23557933 Adam17 Rat rosmarinic acid decreases expression ISO ADAM17 (Homo sapiens) 6480464 Rosmarinic Acid results in decreased expression of ADAM17 protein CTD PMID:23774263 Adam17 Rat rosmarinic acid multiple interactions ISO ADAM17 (Homo sapiens) 6480464 [Rosmarinic Acid inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of ADAM17 protein]] which affects the localization of PROCR protein more ... CTD PMID:23774263 Adam17 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of ADAM17 mRNA CTD PMID:28374803 Adam17 Rat selenium atom increases expression ISO ADAM17 (Homo sapiens) 6480464 Selenium deficiency results in increased expression of ADAM17 mRNA CTD PMID:37422542 Adam17 Rat selenium atom multiple interactions ISO ADAM17 (Homo sapiens) 6480464 [Selenium deficiency co-treated with bisphenol A] results in increased expression of ADAM17 protein and bisphenol A promotes the reaction [Selenium deficiency results in increased expression of ADAM17 mRNA] CTD PMID:37422542 Adam17 Rat sodium arsenate increases expression ISO Adam17 (Mus musculus) 6480464 sodium arsenate results in increased expression of ADAM17 mRNA CTD PMID:21795629 Adam17 Rat sodium arsenite decreases expression ISO ADAM17 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ADAM17 mRNA CTD PMID:28595984 and PMID:34032870 Adam17 Rat sodium arsenite increases expression ISO ADAM17 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ADAM17 mRNA CTD PMID:38568856 Adam17 Rat streptozocin multiple interactions EXP 6480464 Diosgenin inhibits the reaction [Streptozocin results in increased expression of ADAM17 mRNA] and Diosgenin inhibits the reaction [Streptozocin results in increased expression of ADAM17 protein] CTD PMID:35305976 Adam17 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of ADAM17 mRNA and Streptozocin results in increased expression of ADAM17 protein CTD PMID:35305976 Adam17 Rat sulforaphane increases expression ISO ADAM17 (Homo sapiens) 6480464 sulforaphane results in increased expression of ADAM17 mRNA CTD PMID:31838189 Adam17 Rat tamoxifen affects expression ISO Adam17 (Mus musculus) 6480464 Tamoxifen affects the expression of ADAM17 mRNA CTD PMID:17555576 Adam17 Rat testosterone multiple interactions EXP 6480464 Probenecid inhibits the reaction [Testosterone results in increased activity of ADAM17 protein] CTD PMID:37352135 Adam17 Rat testosterone increases activity EXP 6480464 Testosterone results in increased activity of ADAM17 protein CTD PMID:37352135 Adam17 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ADAM17 mRNA CTD PMID:23411599 Adam17 Rat thymoquinone decreases expression ISO ADAM17 (Homo sapiens) 6480464 thymoquinone results in decreased expression of ADAM17 protein CTD PMID:36558177 Adam17 Rat valproic acid increases expression ISO ADAM17 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ADAM17 mRNA CTD PMID:29154799 Adam17 Rat valproic acid decreases expression ISO ADAM17 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of ADAM17 mRNA CTD PMID:23179753 Adam17 Rat vanadium atom increases expression ISO ADAM17 (Homo sapiens) 6480464 Vanadium results in increased expression of ADAM17 mRNA CTD PMID:19000753 Adam17 Rat vanadium(0) increases expression ISO ADAM17 (Homo sapiens) 6480464 Vanadium results in increased expression of ADAM17 mRNA CTD PMID:19000753 Adam17 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of ADAM17 mRNA CTD PMID:19015723 Adam17 Rat vitamin E decreases expression ISO ADAM17 (Homo sapiens) 6480464 Vitamin E results in decreased expression of ADAM17 mRNA CTD PMID:19244175 Adam17 Rat withaferin A multiple interactions ISO ADAM17 (Homo sapiens) 6480464 withaferin A inhibits the reaction [IL1B protein promotes the reaction [ADAM17 protein results in increased cleavage of PROCR protein]] more ... CTD PMID:24632454 Adam17 Rat zoledronic acid multiple interactions ISO ADAM17 (Homo sapiens) 6480464 ADAM17 protein promotes the reaction [zoledronic acid results in decreased expression of TNFSF11 protein] CTD PMID:14753746 Adam17 Rat zoledronic acid decreases activity ISO ADAM17 (Homo sapiens) 6480464 zoledronic acid results in decreased activity of ADAM17 protein CTD PMID:14753746 Adam17 Rat zoledronic acid increases expression ISO ADAM17 (Homo sapiens) 6480464 zoledronic acid results in increased expression of ADAM17 protein CTD PMID:14753746
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (EXP) 2-amino-2-deoxy-D-glucopyranose (EXP) 2-hydroxypropanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-nonylphenol (ISO) 4-phenylbutyric acid (ISO) 7alpha-hydroxycholesterol (EXP) aceclofenac (ISO) acrolein (ISO) acrylamide (EXP) aldehydo-D-glucosamine (EXP) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) ammonium chloride (EXP) androgen antagonist (EXP) anthra[1,9-cd]pyrazol-6(2H)-one (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atorvastatin calcium (ISO) atrazine (ISO) bellidifolin (EXP,ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-D-glucosamine (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) bleomycin A2 (ISO) Butylparaben (EXP) butyric acid (EXP) calcium dichloride (EXP) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) cordycepin (ISO) curcumin (ISO) cycloheximide (ISO) cyclosporin A (ISO) D-glucose (ISO) dexamethasone (EXP,ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) diazinon (EXP) Dibutyl phosphate (ISO) dicrotophos (ISO) dieldrin (EXP) diosgenin (EXP) elemental selenium (ISO) enzacamene (EXP) enzalutamide (ISO) ethanol (EXP,ISO) ethyl methanesulfonate (ISO) fenamic acid (ISO) flufenamic acid (ISO) FR900359 (ISO) gemcitabine (ISO) gentamycin (EXP) glucose (ISO) glyphosate (ISO) hexadecanoic acid (ISO) hydroquinone (ISO) indometacin (ISO) isoprenaline (EXP,ISO) lactucin (ISO) lipopolysaccharide (ISO) melittin (ISO) methyl methanesulfonate (ISO) Methylthiouracil (ISO) N(6),N(6)-dimethyladenosine (ISO) N-acetyl-L-cysteine (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-methyl-4-phenylpyridinium (ISO) nickel dichloride (EXP) nicotinic acid (EXP) oleic acid (ISO) oxycodone (EXP) ozone (ISO) p-menthan-3-ol (ISO) paracetamol (EXP,ISO) paraquat (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) phenylephrine (EXP) phorbol 13-acetate 12-myristate (ISO) probenecid (EXP) progesterone (ISO) propiconazole (ISO) protein kinase inhibitor (ISO) rac-lactic acid (ISO) resveratrol (ISO) rosmarinic acid (ISO) rotenone (EXP) selenium atom (ISO) sodium arsenate (ISO) sodium arsenite (ISO) streptozocin (EXP) sulforaphane (ISO) tamoxifen (ISO) testosterone (EXP) thioacetamide (EXP) thymoquinone (ISO) valproic acid (ISO) vanadium atom (ISO) vanadium(0) (ISO) vinclozolin (EXP) vitamin E (ISO) withaferin A (ISO) zoledronic acid (ISO)
Biological Process
amyloid precursor protein catabolic process (IEA,ISO) B cell differentiation (IEA,ISO) cell adhesion (IEA,ISO) cell adhesion mediated by integrin (IEA,ISO) cell motility (IEA,ISO) cellular response to high density lipoprotein particle stimulus (IEA,ISO) cellular response to mechanical stimulus (IEP) commissural neuron axon guidance (IEA,ISO) cytokine precursor processing (ISO) defense response to Gram-positive bacterium (IEA,ISO) epidermal growth factor receptor signaling pathway (IEA,ISO) ERBB2-EGFR signaling pathway (ISO) germinal center formation (IEA,ISO) membrane protein ectodomain proteolysis (IBA,IEA,IMP,ISO,ISS,TAS) negative regulation of apoptotic process (IDA) negative regulation of cold-induced thermogenesis (IEA,ISO,ISS) negative regulation of neuron projection development (IEA,ISO) negative regulation of transforming growth factor beta receptor signaling pathway (IEA,ISO) Notch receptor processing (IEA,ISO,ISS) Notch signaling pathway (IBA,IEA) phosphatidylinositol 3-kinase/protein kinase B signal transduction (IEA,ISO) positive regulation of apoptotic process (IMP) positive regulation of blood vessel endothelial cell migration (IEA,ISO) positive regulation of cell growth (IEA,ISO) positive regulation of cell migration (IEA,ISO) positive regulation of cell population proliferation (IEA,ISO) positive regulation of chemokine production (IEA,ISO) positive regulation of epidermal growth factor receptor signaling pathway (IEA,ISO) positive regulation of epidermal growth factor-activated receptor activity (ISO) positive regulation of ERK1 and ERK2 cascade (IMP,ISO) positive regulation of G1/S transition of mitotic cell cycle (IEA,ISO) positive regulation of neuron projection development (IMP) positive regulation of T cell chemotaxis (IEA,ISO) positive regulation of tumor necrosis factor production (IEA,ISO) positive regulation of tumor necrosis factor-mediated signaling pathway (IEA,ISO) positive regulation of vascular endothelial cell proliferation (IEA,ISO) production of molecular mediator involved in inflammatory response (IEA,ISO) protein processing (IEA,ISO) proteolysis (IEA,ISO,ISS,TAS) receptor transactivation (IMP) regulation of axon regeneration (IEA,ISO) regulation of cellular component organization (IEA) regulation of mast cell apoptotic process (IEA,ISO) regulation of neuron migration (IEA,ISO) response to antineoplastic agent (IEP) response to hypobaric hypoxia (IEP) response to hypoxia (IEA,ISO) response to lipopolysaccharide (IEA,ISO) response to muscle activity (IEP) response to nutrient levels (IEP) response to xenobiotic stimulus (IEA,ISO) signal release (IEA,ISO) signaling receptor ligand precursor processing (IEA,ISO) spermatogenesis (IEP) spleen development (IEA,ISO) T cell differentiation in thymus (IEA,ISO) tumor necrosis factor-mediated signaling pathway (ISO) wound healing, spreading of epidermal cells (IEA,ISO)
Cellular Component
actin cytoskeleton (IEA,ISO) apical part of cell (IDA) apical plasma membrane (IEA,ISO) cell surface (IDA,IEA,ISO) cell-cell junction (IEA,ISO) cytoplasm (IEA,ISO) cytosol (IEA,ISO) focal adhesion (IEA,ISO) membrane (IEA,ISO) membrane raft (IEA,ISO) plasma membrane (IBA,IEA,ISO) ruffle membrane (IEA,ISO)
Molecular Function
cytokine binding (IEA,ISO) endopeptidase activity (IEA,ISO,ISS) hydrolase activity (IEA) integrin binding (IEA,ISO) interleukin-6 receptor binding (IEA,ISO) metal ion binding (IEA) metallodipeptidase activity (IEA,ISO) metalloendopeptidase activity (IBA,IEA,ISO,ISS) metalloendopeptidase activity involved in amyloid precursor protein catabolic process (IEA,ISO) metallopeptidase activity (IEA,ISO) Notch binding (IEA,ISO,ISS) PDZ domain binding (IEA,ISO) peptidase activity (IEA) protein binding (ISO) SH3 domain binding (IEA) tumor necrosis factor binding (IEA,ISO)
1.
Integrin alpha5beta1 and ADAM-17 interact in vitro and co-localize in migrating HeLa cells.
Bax DV, etal., J Biol Chem. 2004 May 21;279(21):22377-86. Epub 2004 Feb 16.
2.
ADAMs: key components in EGFR signalling and development.
Blobel CP Nat Rev Mol Cell Biol. 2005 Jan;6(1):32-43.
3.
TIMP3 is reduced in atherosclerotic plaques from subjects with type 2 diabetes and increased by SirT1.
Cardellini M, etal., Diabetes. 2009 Jul 6.
4.
The soluble Interleukin 6 receptor: generation and role in inflammation and cancer.
Chalaris A, etal., Eur J Cell Biol. 2011 Jun-Jul;90(6-7):484-94. Epub 2010 Dec 8.
5.
Implication of TNF-alpha convertase (TACE/ADAM17) in inducible nitric oxide synthase expression and inflammation in an experimental model of colitis.
Colon AL, etal., Cytokine 2001 Dec 21;16(6):220-6.
6.
ADAM17 silencing by adenovirus encoding miRNA-embedded siRNA revealed essential signal transduction by angiotensin II in vascular smooth muscle cells.
Elliott KJ, etal., J Mol Cell Cardiol. 2013 Sep;62:1-7. doi: 10.1016/j.yjmcc.2013.05.005. Epub 2013 May 17.
7.
Exercise training and return to a well-balanced diet activate the neuregulin 1/ErbB pathway in skeletal muscle of obese rats.
Ennequin G, etal., J Physiol. 2015 Jun 15;593(12):2665-77. doi: 10.1113/JP270026. Epub 2015 May 14.
8.
Cell and molecular biology of Notch.
Fiuza UM and Arias AM, J Endocrinol. 2007 Sep;194(3):459-74.
9.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
10.
Deficiency of TNFalpha converting enzyme (TACE/ADAM17) causes a lean, hypermetabolic phenotype in mice.
Gelling RW, etal., Endocrinology. 2008 Dec;149(12):6053-64. doi: 10.1210/en.2008-0775. Epub 2008 Aug 7.
11.
Elevation of ADAM10, ADAM17, MMP-2 and MMP-9 expression with media degeneration features CaCl2-induced thoracic aortic aneurysm in a rat model.
Geng L, etal., Exp Mol Pathol. 2010 Aug;89(1):72-81. Epub 2010 May 26.
12.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
13.
A rare loss-of-function variant of ADAM17 is associated with late-onset familial Alzheimer disease.
Hartl D, etal., Mol Psychiatry. 2018 Jul 9. pii: 10.1038/s41380-018-0091-8. doi: 10.1038/s41380-018-0091-8.
14.
TACE/ADAM17-TNF-alpha pathway in rat cortical cultures after exposure to oxygen-glucose deprivation or glutamate.
Hurtado O, etal., J Cereb Blood Flow Metab 2002 May;22(5):576-85.
15.
Role of ADAM-17, p38 MAPK, cathepsins, and the proteasome pathway in the synthesis and shedding of fractalkine/CX3 CL1 in rheumatoid arthritis.
Jones BA, etal., Arthritis Rheum. 2013 Nov;65(11):2814-25. doi: 10.1002/art.38095.
16.
Matrix metalloproteinase inhibition lowers mortality and brain injury in experimental pneumococcal meningitis.
Liechti FD, etal., Infect Immun. 2014 Apr;82(4):1710-8. doi: 10.1128/IAI.00073-14. Epub 2014 Feb 3.
17.
Involvement of TACE/ADAM17 and ADAM10 in etoposide-induced apoptosis of germ cells in rat spermatogenesis.
Lizama C, etal., J Cell Physiol. 2012 Feb;227(2):829-38. doi: 10.1002/jcp.22795.
18.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
19.
IL-6/IL-6 receptor system and its role in physiological and pathological conditions.
Mihara M, etal., Clin Sci (Lond). 2012 Feb;122(4):143-59. doi: 10.1042/CS20110340.
20.
Impaired regulation of the TNF-alpha converting enzyme/tissue inhibitor of metalloproteinase 3 proteolytic system in skeletal muscle of obese type 2 diabetic patients: a new mechanism of insulin resistance in humans.
Monroy A, etal., Diabetologia. 2009 Jul 25.
21.
ADAM17 up-regulation in renal transplant dysfunction and non-transplant-related renal fibrosis.
Mulder GM, etal., Nephrol Dial Transplant. 2012 May;27(5):2114-22. doi: 10.1093/ndt/gfr583. Epub 2011 Oct 19.
22.
Metalloprotease disintegrin-mediated ectodomain shedding of EGFR ligands promotes intestinal epithelial restitution.
Myhre GM, etal., Am J Physiol Gastrointest Liver Physiol. 2004 Dec;287(6):G1213-9. Epub 2004 Jul 29.
23.
Reverse right ventricular structural and extracellular matrix remodeling by estrogen in severe pulmonary hypertension.
Nadadur RD, etal., J Appl Physiol (1985). 2012 Jul;113(1):149-58. doi: 10.1152/japplphysiol.01349.2011. Epub 2012 May 24.
24.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
25.
TACE cleaves neogenin to desensitize cortical neurons to the repulsive guidance molecule.
Okamura Y, etal., Neurosci Res. 2011 Sep;71(1):63-70. doi: 10.1016/j.neures.2011.05.012. Epub 2011 May 27.
26.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
27.
An essential role for ectodomain shedding in mammalian development.
Peschon JJ, etal., Science 1998 Nov 13;282(5392):1281-4.
28.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
29.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
30.
ADAM-17 and TIMP3 protein and mRNA expression in spinal cord white matter of rats with acute experimental autoimmune encephalomyelitis.
Plumb J, etal., J Neuroimmunol. 2005 Jul;164(1-2):1-9.
31.
A1 adenosine receptor-stimulated exocytosis in bladder umbrella cells requires phosphorylation of ADAM17 Ser-811 and EGF receptor transactivation.
Prakasam HS, etal., Mol Biol Cell. 2014 Nov 15;25(23):3798-812. doi: 10.1091/mbc.E14-03-0818. Epub 2014 Sep 17.
32.
Canonical transforming growth factor-ß signaling regulates disintegrin metalloprotease expression in experimental renal fibrosis via miR-29.
Ramdas V, etal., Am J Pathol. 2013 Dec;183(6):1885-1896. doi: 10.1016/j.ajpath.2013.08.027. Epub 2013 Oct 6.
33.
GOA pipeline
RGD automated data pipeline
34.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
35.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
36.
Differential expression of ADAM15 and ADAM17 metalloproteases in the rat brain after severe hypobaric hypoxia and hypoxic preconditioning.
Rybnikova E, etal., Neurosci Res. 2012 Apr;72(4):364-73. doi: 10.1016/j.neures.2011.12.010. Epub 2012 Jan 2.
37.
Differential expression and localization of ADAM10 and ADAM17 during rat spermatogenesis suggest a role in germ cell differentiation.
Urriola-Muñoz P, etal., Biol Res. 2014 Jul 4;47:31. doi: 10.1186/0717-6287-47-31.
38.
Tumor necrosis factor signaling.
Wajant H, etal., Cell Death Differ. 2003 Jan;10(1):45-65.
39.
Effects of aluminium on ß-amyloid (1-42) and secretases (APP-cleaving enzymes) in rat brain.
Wang L, etal., Neurochem Res. 2014 Jul;39(7):1338-45. doi: 10.1007/s11064-014-1317-z. Epub 2014 May 3.
40.
Upregulation of Nox4 promotes angiotensin II-induced epidermal growth factor receptor activation and subsequent cardiac hypertrophy by increasing ADAM17 expression.
Zeng SY, etal., Can J Cardiol. 2013 Oct;29(10):1310-9. doi: 10.1016/j.cjca.2013.04.026. Epub 2013 Jul 11.
Adam17 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 46,601,583 - 46,663,690 (-) NCBI GRCr8 mRatBN7.2 6 40,872,936 - 40,920,700 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 40,872,856 - 40,920,639 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 41,195,035 - 41,242,751 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 41,509,725 - 41,557,442 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 40,942,985 - 40,990,706 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 43,400,525 - 43,448,280 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 43,400,528 - 43,448,280 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 60,268,228 - 60,315,989 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 41,882,432 - 41,930,755 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 41,885,557 - 41,933,881 (-) NCBI Celera 6 40,160,004 - 40,207,760 (-) NCBI Celera Cytogenetic Map 6 q16 NCBI
ADAM17 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 9,488,486 - 9,555,830 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 9,488,486 - 9,556,732 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 9,628,615 - 9,695,959 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 9,546,843 - 9,613,368 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 9,580,010 - 9,646,496 NCBI Celera 2 9,541,264 - 9,607,791 (-) NCBI Celera Cytogenetic Map 2 p25.1 NCBI HuRef 2 9,474,897 - 9,541,735 (-) NCBI HuRef CHM1_1 2 9,558,781 - 9,625,197 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 9,513,510 - 9,580,869 (-) NCBI T2T-CHM13v2.0
Adam17 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 21,373,510 - 21,423,633 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 21,373,510 - 21,423,633 (-) Ensembl GRCm39 Ensembl GRCm38 12 21,323,509 - 21,373,632 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 21,323,509 - 21,373,632 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 21,329,370 - 21,379,452 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 21,570,005 - 21,620,083 (-) NCBI MGSCv36 mm8 Celera 12 19,527,967 - 19,579,463 (+) NCBI Celera Cytogenetic Map 12 A1.3 NCBI cM Map 12 8.3 NCBI
Adam17 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955487 5,180,252 - 5,218,216 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955487 5,180,241 - 5,218,298 (-) NCBI ChiLan1.0 ChiLan1.0
ADAM17 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 116,969,633 - 117,037,769 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 116,974,220 - 117,041,742 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 9,478,080 - 9,545,363 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 9,641,194 - 9,708,091 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 9,641,201 - 9,708,054 (-) Ensembl panpan1.1 panPan2
ADAM17 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 6,589,874 - 6,638,788 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 6,589,878 - 6,638,731 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 6,517,667 - 6,566,403 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 6,687,702 - 6,737,271 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 6,687,697 - 6,737,197 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 6,580,977 - 6,629,669 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 6,583,178 - 6,631,850 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 6,597,002 - 6,645,753 (-) NCBI UU_Cfam_GSD_1.0
Adam17 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 51,109,736 - 51,148,960 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936532 5,864,867 - 5,904,003 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936532 5,864,851 - 5,904,005 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ADAM17 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 126,795,426 - 126,853,995 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 126,795,513 - 126,853,995 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 135,176,533 - 135,222,632 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ADAM17 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 98,092,093 - 98,157,657 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 98,092,044 - 98,157,217 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 14,163,022 - 14,230,392 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Adam17
.
Predicted Target Of
Count of predictions: 395 Count of miRNA genes: 223 Interacting mature miRNAs: 266 Transcripts: ENSRNOT00000010648 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
8552962 Pigfal16 Plasma insulin-like growth factor 1 level QTL 16 9.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 6 1 41223769 Rat 9590290 Uminl2 Urine mineral level QTL 2 3.96 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 6 38783989 83783989 Rat 8693632 Alc27 Alcohol consumption QTL 27 2.2 0.791 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 6 34323357 51121479 Rat 634318 Bw118 Body weight QTL 118 3.55 abdominal fat pad mass (VT:1000711) abdominal fat pad weight (CMO:0000088) 6 33309549 57730294 Rat 10401812 Kidm54 Kidney mass QTL 54 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 6 14368788 59368788 Rat 634307 Bp141 Blood pressure QTL 141 4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 35230417 80230417 Rat 2292589 Emca10 Estrogen-induced mammary cancer QTL 10 0.048 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 6 16536140 61536140 Rat 10401800 Kidm49 Kidney mass QTL 49 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 6 14368788 59368788 Rat 1300164 Rf15 Renal function QTL 15 3.12 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 5074497 54641141 Rat 1331779 Rf38 Renal function QTL 38 2.876 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 6 32074428 72227641 Rat 9589129 Insul24 Insulin level QTL 24 19.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 6 1 41223769 Rat 1354632 Scl29 Serum cholesterol level QTL 29 3.74 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 6 35098709 71636405 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 7411603 Foco13 Food consumption QTL 13 5.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 6 1 41223769 Rat 738024 Sach5 Saccharine consumption QTL 5 3.9 0.00039 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 6 1 43394190 Rat 7411542 Bw127 Body weight QTL 127 5.5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 1 41223769 Rat 9589048 Scfw3 Subcutaneous fat weight QTL 3 4.57 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 6 1 41223769 Rat 2293839 Kiddil2 Kidney dilation QTL 2 4.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 9590140 Scort4 Serum corticosterone level QTL 4 14.49 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 38783989 83783989 Rat 2293709 Bss23 Bone structure and strength QTL 23 5.18 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 6 1 42487980 Rat 2293650 Bss31 Bone structure and strength QTL 31 5.05 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 6 1 42487980 Rat 9590306 Scort18 Serum corticosterone level QTL 18 2.88 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 38783989 83783989 Rat 7411584 Foco4 Food consumption QTL 4 4.3 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 6 1 42838846 Rat 1578665 Bss16 Bone structure and strength QTL 16 4.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 6 11735669 72593685 Rat 2293841 Kiddil4 Kidney dilation QTL 4 4.4 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 20866422 81133036 Rat 1641898 Colcr4 Colorectal carcinoma resistance QTL4 3.71 0.0007 intestine integrity trait (VT:0010554) well differentiated malignant colorectal tumor surface area measurement (CMO:0002077) 6 20338777 62613667 Rat 1578668 Bmd14 Bone mineral density QTL 14 3.8 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 6 11735669 72593685 Rat 6893340 Cm77 Cardiac mass QTL 77 0.26 0.57 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 33309549 81132889 Rat 70199 Coreg1 Compensatory renal growth QTL 1 11.8 kidney mass (VT:0002707) compensatory renal growth score (CMO:0001894) 6 35691618 57730540 Rat 2301972 Bp325 Blood pressure QTL 325 4.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 1 72227641 Rat 2293656 Bss28 Bone structure and strength QTL 28 6.79 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 6 1 42487980 Rat 1354664 Slep2 Serum leptin concentration QTL 2 4.49 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 6 16536140 71636405 Rat 1300143 Rf14 Renal function QTL 14 2.92 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 6 34434137 77102317 Rat
RH128637
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 40,872,490 - 40,872,671 (+) MAPPER mRatBN7.2 Rnor_6.0 6 43,400,074 - 43,400,254 NCBI Rnor6.0 Rnor_5.0 6 60,267,783 - 60,267,963 UniSTS Rnor5.0 RGSC_v3.4 6 41,881,981 - 41,882,161 UniSTS RGSC3.4 Celera 6 40,159,553 - 40,159,733 UniSTS RH 3.4 Map 6 226.2 UniSTS Cytogenetic Map 6 q16 UniSTS
RH70698
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 40,874,062 - 40,874,213 (+) MAPPER mRatBN7.2 Rnor_6.0 6 43,401,646 - 43,401,796 NCBI Rnor6.0 Rnor_5.0 6 60,269,355 - 60,269,505 UniSTS Rnor5.0 RGSC_v3.4 6 41,883,553 - 41,883,703 UniSTS RGSC3.4 Celera 6 40,161,125 - 40,161,275 UniSTS Cytogenetic Map 6 q16 UniSTS
RH141932
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 40,872,997 - 40,873,209 (+) MAPPER mRatBN7.2 Rnor_6.0 6 43,400,581 - 43,400,792 NCBI Rnor6.0 Rnor_5.0 6 60,268,290 - 60,268,501 UniSTS Rnor5.0 RGSC_v3.4 6 41,882,488 - 41,882,699 UniSTS RGSC3.4 Celera 6 40,160,060 - 40,160,271 UniSTS RH 3.4 Map 6 227.5 UniSTS Cytogenetic Map 6 q16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000081110 ⟹ ENSRNOP00000073012
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 40,873,110 - 40,901,932 (-) Ensembl Rnor_6.0 Ensembl 6 43,400,528 - 43,448,280 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000105140 ⟹ ENSRNOP00000089788
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 40,872,856 - 40,920,639 (-) Ensembl
RefSeq Acc Id:
NM_020306 ⟹ NP_064702
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 46,601,583 - 46,649,344 (-) NCBI mRatBN7.2 6 40,872,936 - 40,920,700 (-) NCBI Rnor_6.0 6 43,400,525 - 43,448,280 (-) NCBI Rnor_5.0 6 60,268,228 - 60,315,989 (-) NCBI RGSC_v3.4 6 41,882,432 - 41,930,755 (-) RGD Celera 6 40,160,004 - 40,207,760 (-) RGD
Sequence:
TTCCGGCTGTGGGCAGCAGGGTGGTCCGCGACTGCGGCCGGAAGCAGGCTGAGCGGCTCTCGGCGAGCGCCGCCTGTACTTCCGGGGACTTCAGCCTAGCTCTTGAGTTTTCCCTGTAGGCGGCGCGG
hide sequence
RefSeq Acc Id:
XM_039112795 ⟹ XP_038968723
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 46,601,583 - 46,621,980 (-) NCBI mRatBN7.2 6 40,872,936 - 40,893,345 (-) NCBI
RefSeq Acc Id:
XM_063262376 ⟹ XP_063118446
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 46,601,583 - 46,663,690 (-) NCBI
RefSeq Acc Id:
NP_064702 ⟸ NM_020306
- Peptide Label:
precursor
- UniProtKB:
Q9Z1K9 (UniProtKB/Swiss-Prot), A6HAW7 (UniProtKB/TrEMBL)
- Sequence:
MRQRLLFLTTLVPFVLAPRPPEEPGSGSHLRLEKLDSLLSDYDILSLSNIQQHSIRKRDLQSATHLETLLTFSALKRHFKLYLTSSTERFSQNLRVVVVDGKEESEYSVKWQDFFSGHVVGEPDSRVL
hide sequence
Ensembl Acc Id:
ENSRNOP00000073012 ⟸ ENSRNOT00000081110
RefSeq Acc Id:
XP_038968723 ⟸ XM_039112795
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSRNOP00000089788 ⟸ ENSRNOT00000105140
RefSeq Acc Id:
XP_063118446 ⟸ XM_063262376
- Peptide Label:
isoform X1
- UniProtKB:
Q9Z1K9 (UniProtKB/Swiss-Prot), A6HAW7 (UniProtKB/TrEMBL)
RGD ID: 13694517 Promoter ID: EPDNEW_R5040 Type: initiation region Name: Adam17_1 Description: ADAM metallopeptidase domain 17 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 43,448,175 - 43,448,235 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-09-18
Adam17
ADAM metallopeptidase domain 17
Adam17
a disintegrin and metallopeptidase domain 17
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-25
Adam17
a disintegrin and metallopeptidase domain 17
Adam17
a disintegrin and metalloproteinase domain 17 (tumor necrosis factor, alpha, converting enzyme)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Adam17
a disintegrin and metalloproteinase domain 17 (tumor necrosis factor, alpha, converting enzyme)
a disintegrin and metalloproteinase domain 17
Name updated
1299863 APPROVED
2002-08-07
Adam17
a disintegrin and metalloproteinase domain 17
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_mutations_overexpression
increased expression induced by oxygen-glucose deprivation induces release of TNF-alpha, which inhibits apoptosis via activation of NFkappaB
632021
gene_process
release of TNF-alpha promotes apoptosis inhibition
632021
gene_regulation
upregulated in response to oxygen glucose deprivation
632021
