Symbol:
Pcsk5
Name:
proprotein convertase subtilisin/kexin type 5
RGD ID:
620326
Description:
Predicted to enable peptide binding activity and serine-type endopeptidase activity. Involved in several processes, including cellular response to platelet-derived growth factor stimulus; positive regulation of integrin-mediated signaling pathway; and positive regulation of smooth muscle cell-matrix adhesion. Located in Golgi apparatus subcompartment; perikaryon; and proximal dendrite. Biomarker of sciatic neuropathy. Orthologous to human PCSK5 (proprotein convertase subtilisin/kexin type 5); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Pc5; PC6; proprotein convertase 5; proprotein convertase 6; proprotein convertase PC5; rPC5; subtilisin/kexin-like protease PC5
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 224,263,823 - 224,694,350 (-) NCBI GRCr8 mRatBN7.2 1 214,837,847 - 215,267,626 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 214,837,927 - 215,267,600 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 223,320,598 - 223,601,308 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 230,257,142 - 230,537,850 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 223,075,150 - 223,355,852 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 236,031,988 - 236,313,858 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 236,031,988 - 236,313,858 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 243,339,259 - 243,768,026 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 220,961,912 - 221,405,907 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 221,283,956 - 221,569,937 (-) NCBI Celera 1 212,298,555 - 212,578,355 (-) NCBI Celera Cytogenetic Map 1 q43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pcsk5 Rat 1,2-dichloroethane increases expression ISO RGD:1552230 6480464 ethylene dichloride results in increased expression of PCSK5 mRNA CTD PMID:28189721|PMID:28960355 Pcsk5 Rat 1,2-dimethylhydrazine affects expression ISO RGD:1552230 6480464 1,2-Dimethylhydrazine affects the expression of PCSK5 mRNA CTD PMID:22206623 Pcsk5 Rat 17beta-estradiol increases expression ISO RGD:1552230 6480464 Estradiol results in increased expression of PCSK5 mRNA CTD PMID:19484750 Pcsk5 Rat 17beta-estradiol multiple interactions ISO RGD:732125 6480464 [Estradiol co-treated with Progesterone] results in increased expression of PCSK5 mRNA CTD PMID:20660070 Pcsk5 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:732125 6480464 Tetrachlorodibenzodioxin results in decreased expression of PCSK5 mRNA CTD PMID:17101203|PMID:21296121 Pcsk5 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PCSK5 mRNA CTD PMID:32109520 Pcsk5 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:732125 6480464 Tetrachlorodibenzodioxin results in increased expression of PCSK5 mRNA CTD PMID:19692669|PMID:20106945|PMID:21632981|PMID:26238291 Pcsk5 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1552230 6480464 Tetrachlorodibenzodioxin results in decreased expression of PCSK5 mRNA CTD PMID:26290441 Pcsk5 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1552230 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in decreased expression more ... CTD PMID:25975270 Pcsk5 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PCSK5 mRNA CTD PMID:22298810|PMID:34747641 Pcsk5 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:732125 6480464 Tetrachlorodibenzodioxin affects the expression of PCSK5 mRNA CTD PMID:22298810 Pcsk5 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of PCSK5 mRNA CTD PMID:32109520 Pcsk5 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of PCSK5 mRNA CTD PMID:21346803 Pcsk5 Rat 2-hydroxypropanoic acid decreases expression ISO RGD:732125 6480464 Lactic Acid results in decreased expression of PCSK5 mRNA CTD PMID:30851411 Pcsk5 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO RGD:732125 6480464 3,4,5,3',4'-pentachlorobiphenyl results in increased expression of PCSK5 mRNA CTD PMID:19692669 Pcsk5 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1552230 6480464 bisphenol S results in increased expression of PCSK5 mRNA CTD PMID:30951980 Pcsk5 Rat 4,4'-sulfonyldiphenol decreases methylation ISO RGD:732125 6480464 bisphenol S results in decreased methylation of PCSK5 gene CTD PMID:31601247 Pcsk5 Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1552230 6480464 bisphenol S results in decreased expression of PCSK5 mRNA CTD PMID:39298647 Pcsk5 Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:1552230 6480464 Fenretinide results in increased expression of PCSK5 mRNA CTD PMID:28973697 Pcsk5 Rat 4-hydroxyphenyl retinamide decreases expression ISO RGD:1552230 6480464 Fenretinide results in decreased expression of PCSK5 mRNA CTD PMID:28973697 Pcsk5 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PCSK5 mRNA CTD PMID:24780913 Pcsk5 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of PCSK5 mRNA CTD PMID:28959563 Pcsk5 Rat aflatoxin B1 increases expression ISO RGD:1552230 6480464 Aflatoxin B1 results in increased expression of PCSK5 mRNA CTD PMID:19770486 Pcsk5 Rat aflatoxin B1 affects methylation ISO RGD:732125 6480464 Aflatoxin B1 affects the methylation of PCSK5 intron CTD PMID:30157460 Pcsk5 Rat aflatoxin B1 decreases methylation ISO RGD:732125 6480464 Aflatoxin B1 results in decreased methylation of PCSK5 gene CTD PMID:27153756 Pcsk5 Rat Aflatoxin B2 alpha decreases methylation ISO RGD:732125 6480464 aflatoxin B2 results in decreased methylation of PCSK5 exon CTD PMID:30157460 Pcsk5 Rat all-trans-retinoic acid increases expression ISO RGD:732125 6480464 Tretinoin results in increased expression of PCSK5 mRNA CTD PMID:21934132 Pcsk5 Rat arsenous acid increases expression ISO RGD:732125 6480464 Arsenic Trioxide results in increased expression of PCSK5 mRNA CTD PMID:15761015 Pcsk5 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of PCSK5 gene CTD PMID:28931070 Pcsk5 Rat benzene decreases expression ISO RGD:732125 6480464 Benzene results in decreased expression of PCSK5 mRNA CTD PMID:19162166 Pcsk5 Rat benzo[a]pyrene increases mutagenesis ISO RGD:732125 6480464 Benzo(a)pyrene results in increased mutagenesis of PCSK5 gene CTD PMID:25435355 Pcsk5 Rat benzo[a]pyrene decreases expression ISO RGD:732125 6480464 Benzo(a)pyrene results in decreased expression of PCSK5 mRNA CTD PMID:32234424 Pcsk5 Rat benzo[a]pyrene affects methylation ISO RGD:732125 6480464 Benzo(a)pyrene affects the methylation of PCSK5 exon; Benzo(a)pyrene affects the methylation of PCSK5 intron CTD PMID:30157460 Pcsk5 Rat benzo[a]pyrene increases expression ISO RGD:732125 6480464 Benzo(a)pyrene results in increased expression of PCSK5 mRNA CTD PMID:22316170|PMID:26238291 Pcsk5 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of PCSK5 mRNA CTD PMID:21839799 Pcsk5 Rat benzo[a]pyrene decreases expression ISO RGD:1552230 6480464 Benzo(a)pyrene results in decreased expression of PCSK5 mRNA CTD PMID:19770486|PMID:21569818 Pcsk5 Rat benzo[e]pyrene increases methylation ISO RGD:732125 6480464 benzo(e)pyrene results in increased methylation of PCSK5 intron CTD PMID:30157460 Pcsk5 Rat Benzo[k]fluoranthene decreases expression ISO RGD:1552230 6480464 benzo(k)fluoranthene results in decreased expression of PCSK5 mRNA CTD PMID:26377693 Pcsk5 Rat beta-lapachone decreases expression ISO RGD:732125 6480464 beta-lapachone results in decreased expression of PCSK5 mRNA CTD PMID:38218311 Pcsk5 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:1552230 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Pcsk5 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PCSK5 mRNA CTD PMID:25181051|PMID:30816183|PMID:32528016|PMID:34947998 Pcsk5 Rat bisphenol A decreases expression ISO RGD:1552230 6480464 bisphenol A results in decreased expression of PCSK5 mRNA CTD PMID:29161229|PMID:37105096 Pcsk5 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PCSK5 gene CTD PMID:28505145 Pcsk5 Rat butanal decreases expression ISO RGD:732125 6480464 butyraldehyde results in decreased expression of PCSK5 mRNA CTD PMID:26079696 Pcsk5 Rat Butylbenzyl phthalate multiple interactions ISO RGD:1552230 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Pcsk5 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of PCSK5 mRNA CTD PMID:25993096 Pcsk5 Rat capsaicin decreases expression EXP 6480464 Capsaicin results in decreased expression of PCSK5 mRNA CTD PMID:16278290 Pcsk5 Rat carbon nanotube increases expression ISO RGD:1552230 6480464 Nanotubes, Carbon analog results in increased expression of PCSK5 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Pcsk5 Rat chloroprene decreases expression ISO RGD:1552230 6480464 Chloroprene results in decreased expression of PCSK5 mRNA CTD PMID:23125180 Pcsk5 Rat choline multiple interactions ISO RGD:1552230 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 Pcsk5 Rat clofibrate increases expression ISO RGD:1552230 6480464 Clofibrate results in increased expression of PCSK5 mRNA CTD PMID:17585979 Pcsk5 Rat clofibrate multiple interactions ISO RGD:1552230 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of PCSK5 mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Pcsk5 Rat copper(II) sulfate increases expression ISO RGD:732125 6480464 Copper Sulfate results in increased expression of PCSK5 mRNA CTD PMID:19549813 Pcsk5 Rat cyclosporin A increases expression ISO RGD:732125 6480464 Cyclosporine results in increased expression of PCSK5 mRNA CTD PMID:20106945|PMID:25562108 Pcsk5 Rat cytarabine decreases expression ISO RGD:732125 6480464 Cytarabine results in decreased expression of PCSK5 mRNA CTD PMID:21198554 Pcsk5 Rat decabromodiphenyl ether multiple interactions EXP 6480464 [Flame Retardants co-treated with pentabromodiphenyl ether co-treated with decabromobiphenyl ether co-treated with hexabromocyclododecane] results in more ... CTD PMID:32207525 Pcsk5 Rat diarsenic trioxide increases expression ISO RGD:732125 6480464 Arsenic Trioxide results in increased expression of PCSK5 mRNA CTD PMID:15761015 Pcsk5 Rat diazinon increases methylation ISO RGD:732125 6480464 Diazinon results in increased methylation of PCSK5 gene CTD PMID:22964155 Pcsk5 Rat Dibutyl phosphate affects expression ISO RGD:732125 6480464 di-n-butylphosphoric acid affects the expression of PCSK5 mRNA CTD PMID:37042841 Pcsk5 Rat dibutyl phthalate increases expression ISO RGD:1552230 6480464 Dibutyl Phthalate results in increased expression of PCSK5 mRNA CTD PMID:17361019|PMID:21266533 Pcsk5 Rat dibutyl phthalate multiple interactions ISO RGD:1552230 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Pcsk5 Rat diethyl phthalate multiple interactions ISO RGD:1552230 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Pcsk5 Rat diisobutyl phthalate multiple interactions ISO RGD:1552230 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Pcsk5 Rat diisononyl phthalate multiple interactions ISO RGD:1552230 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Pcsk5 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of PCSK5 mRNA CTD PMID:25152437 Pcsk5 Rat dorsomorphin multiple interactions ISO RGD:732125 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Pcsk5 Rat elemental selenium decreases expression ISO RGD:732125 6480464 Selenium results in decreased expression of PCSK5 mRNA CTD PMID:19244175 Pcsk5 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of PCSK5 mRNA CTD PMID:29391264 Pcsk5 Rat entinostat decreases expression ISO RGD:732125 6480464 entinostat results in decreased expression of PCSK5 mRNA CTD PMID:26272509 Pcsk5 Rat entinostat multiple interactions ISO RGD:732125 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Pcsk5 Rat ethanol affects expression ISO RGD:1552230 6480464 Ethanol affects the expression of PCSK5 mRNA CTD PMID:30319688 Pcsk5 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of PCSK5 mRNA CTD PMID:30307764 Pcsk5 Rat ferric oxide decreases expression EXP 6480464 ferric oxide analog results in decreased expression of PCSK5 mRNA CTD PMID:38615722 Pcsk5 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of PCSK5 mRNA CTD PMID:18035473 Pcsk5 Rat folic acid multiple interactions ISO RGD:1552230 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 Pcsk5 Rat folic acid decreases expression ISO RGD:1552230 6480464 Folic Acid results in decreased expression of PCSK5 mRNA CTD PMID:25629700 Pcsk5 Rat genistein affects expression ISO RGD:1552230 6480464 Genistein affects the expression of PCSK5 mRNA CTD PMID:32186404 Pcsk5 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PCSK5 mRNA CTD PMID:33387578 Pcsk5 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of PCSK5 mRNA CTD PMID:21396975 Pcsk5 Rat ketoconazole increases expression ISO RGD:732125 6480464 Ketoconazole results in increased expression of PCSK5 mRNA CTD PMID:36621641 Pcsk5 Rat L-methionine multiple interactions ISO RGD:1552230 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased expression more ... CTD PMID:20938992 Pcsk5 Rat methapyrilene increases methylation ISO RGD:732125 6480464 Methapyrilene results in increased methylation of PCSK5 intron CTD PMID:30157460 Pcsk5 Rat methylmercury chloride decreases expression ISO RGD:732125 6480464 methylmercuric chloride results in decreased expression of PCSK5 mRNA CTD PMID:28001369 Pcsk5 Rat N-ethyl-N-nitrosourea increases mutagenesis ISO RGD:1552230 6480464 Ethylnitrosourea results in increased mutagenesis of PCSK5 gene CTD PMID:18519639 Pcsk5 Rat okadaic acid increases expression ISO RGD:732125 6480464 Okadaic Acid results in increased expression of PCSK5 mRNA CTD PMID:38832940 Pcsk5 Rat ozone multiple interactions ISO RGD:1552230 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of PCSK5 more ... CTD PMID:27106289 Pcsk5 Rat ozone multiple interactions ISO RGD:732125 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of PCSK5 mRNA CTD PMID:35430440 Pcsk5 Rat paracetamol multiple interactions ISO RGD:1552230 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of PCSK5 mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Pcsk5 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PCSK5 mRNA CTD PMID:33387578 Pcsk5 Rat paracetamol increases expression ISO RGD:732125 6480464 Acetaminophen results in increased expression of PCSK5 mRNA CTD PMID:26690555 Pcsk5 Rat perfluorononanoic acid decreases expression ISO RGD:732125 6480464 perfluoro-n-nonanoic acid results in decreased expression of PCSK5 mRNA CTD PMID:32588087 Pcsk5 Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of PCSK5 mRNA CTD PMID:19162173 Pcsk5 Rat phenobarbital affects expression ISO RGD:1552230 6480464 Phenobarbital affects the expression of PCSK5 mRNA CTD PMID:23091169 Pcsk5 Rat pirinixic acid multiple interactions ISO RGD:732125 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Pcsk5 Rat pirinixic acid increases expression ISO RGD:1552230 6480464 pirinixic acid results in increased expression of PCSK5 mRNA CTD PMID:18301758|PMID:23811191 Pcsk5 Rat progesterone multiple interactions ISO RGD:732125 6480464 [Estradiol co-treated with Progesterone] results in increased expression of PCSK5 mRNA CTD PMID:20660070 Pcsk5 Rat propiconazole decreases expression ISO RGD:1552230 6480464 propiconazole results in decreased expression of PCSK5 mRNA CTD PMID:21278054 Pcsk5 Rat quercetin increases expression ISO RGD:732125 6480464 Quercetin results in increased expression of PCSK5 mRNA CTD PMID:21632981 Pcsk5 Rat rac-lactic acid decreases expression ISO RGD:732125 6480464 Lactic Acid results in decreased expression of PCSK5 mRNA CTD PMID:30851411 Pcsk5 Rat resveratrol increases expression EXP 6480464 resveratrol results in increased expression of PCSK5 mRNA CTD PMID:25905778 Pcsk5 Rat resveratrol multiple interactions ISO RGD:732125 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of PCSK5 mRNA CTD PMID:23557933 Pcsk5 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of PCSK5 mRNA CTD PMID:28374803 Pcsk5 Rat SB 431542 multiple interactions ISO RGD:732125 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Pcsk5 Rat selenium atom decreases expression ISO RGD:732125 6480464 Selenium results in decreased expression of PCSK5 mRNA CTD PMID:19244175 Pcsk5 Rat silicon dioxide decreases expression ISO RGD:732125 6480464 Silicon Dioxide analog results in decreased expression of PCSK5 mRNA CTD PMID:25895662 Pcsk5 Rat sodium arsenite decreases expression ISO RGD:1552230 6480464 sodium arsenite results in decreased expression of PCSK5 mRNA CTD PMID:37682722 Pcsk5 Rat Soman increases expression EXP 6480464 Soman results in increased expression of PCSK5 mRNA CTD PMID:19281266 Pcsk5 Rat T-2 toxin decreases expression ISO RGD:732125 6480464 T-2 Toxin results in decreased expression of PCSK5 mRNA CTD PMID:31863870 Pcsk5 Rat tetrachloromethane affects expression ISO RGD:1552230 6480464 Carbon Tetrachloride affects the expression of PCSK5 mRNA CTD PMID:17484886 Pcsk5 Rat theophylline increases expression ISO RGD:732125 6480464 Theophylline results in increased expression of PCSK5 mRNA CTD PMID:16083514 Pcsk5 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of PCSK5 mRNA CTD PMID:34492290 Pcsk5 Rat thiram increases expression ISO RGD:732125 6480464 Thiram results in increased expression of PCSK5 mRNA CTD PMID:38568856 Pcsk5 Rat titanium dioxide increases expression ISO RGD:1552230 6480464 titanium dioxide results in increased expression of PCSK5 mRNA CTD PMID:23557971 Pcsk5 Rat titanium dioxide decreases methylation ISO RGD:1552230 6480464 titanium dioxide results in decreased methylation of PCSK5 gene CTD PMID:35295148 Pcsk5 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of PCSK5 mRNA CTD PMID:33387578 Pcsk5 Rat trichostatin A decreases expression ISO RGD:732125 6480464 trichostatin A results in decreased expression of PCSK5 mRNA CTD PMID:24935251|PMID:26272509 Pcsk5 Rat trichostatin A multiple interactions ISO RGD:732125 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Pcsk5 Rat triclosan increases expression ISO RGD:732125 6480464 Triclosan results in increased expression of PCSK5 mRNA CTD PMID:30510588 Pcsk5 Rat triphenyl phosphate affects expression ISO RGD:732125 6480464 triphenyl phosphate affects the expression of PCSK5 mRNA CTD PMID:37042841 Pcsk5 Rat troglitazone decreases expression ISO RGD:1552230 6480464 troglitazone results in decreased expression of PCSK5 mRNA CTD PMID:28973697 Pcsk5 Rat urethane increases expression ISO RGD:732125 6480464 Urethane results in increased expression of PCSK5 mRNA CTD PMID:28818685 Pcsk5 Rat valproic acid affects expression ISO RGD:732125 6480464 Valproic Acid affects the expression of PCSK5 mRNA CTD PMID:25979313 Pcsk5 Rat valproic acid increases expression ISO RGD:732125 6480464 Valproic Acid results in increased expression of PCSK5 mRNA CTD PMID:23179753|PMID:24935251
1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) arsenous acid (ISO) atrazine (EXP) benzene (ISO) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (ISO) Benzo[k]fluoranthene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) butanal (ISO) Butylbenzyl phthalate (ISO) cadmium dichloride (EXP) capsaicin (EXP) carbon nanotube (ISO) chloroprene (ISO) choline (ISO) clofibrate (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) cytarabine (ISO) decabromodiphenyl ether (EXP) diarsenic trioxide (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) diuron (EXP) dorsomorphin (ISO) elemental selenium (ISO) endosulfan (EXP) entinostat (ISO) ethanol (ISO) fenvalerate (EXP) ferric oxide (EXP) flavonoids (EXP) folic acid (ISO) genistein (ISO) gentamycin (EXP) indole-3-methanol (EXP) ketoconazole (ISO) L-methionine (ISO) methapyrilene (ISO) methylmercury chloride (ISO) N-ethyl-N-nitrosourea (ISO) okadaic acid (ISO) ozone (ISO) paracetamol (EXP,ISO) perfluorononanoic acid (ISO) perfluorooctanoic acid (EXP) phenobarbital (ISO) pirinixic acid (ISO) progesterone (ISO) propiconazole (ISO) quercetin (ISO) rac-lactic acid (ISO) resveratrol (EXP,ISO) rotenone (EXP) SB 431542 (ISO) selenium atom (ISO) silicon dioxide (ISO) sodium arsenite (ISO) Soman (EXP) T-2 toxin (ISO) tetrachloromethane (ISO) theophylline (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) triphenyl phosphate (ISO) troglitazone (ISO) urethane (ISO) valproic acid (ISO)
Biological Process
anterior/posterior pattern specification (IEA,ISO) cardiac septum development (IEA,ISO) cellular response to platelet-derived growth factor stimulus (IEP) coronary vasculature development (IEA,ISO) cytokine precursor processing (IEA,ISO) determination of left/right symmetry (IEA,ISO) embryo implantation (IEA,ISO) embryonic digestive tract development (IEA,ISO) embryonic skeletal system development (IEA,ISO) female pregnancy (IEA) heart development (IEA,ISO) kidney development (IEA,ISO) limb morphogenesis (IEA,ISO) peptide biosynthetic process (IEA,ISO) peptide hormone processing (IBA,IEA,ISO) positive regulation of integrin activation (IMP) positive regulation of integrin-mediated signaling pathway (IMP) positive regulation of signal transduction (IEA) positive regulation of smooth muscle cell-matrix adhesion (IMP) positive regulation of vascular associated smooth muscle cell migration (IMP) protein processing (IEA,ISO) proteolysis (IEA) renin secretion into blood stream (ISO) respiratory tube development (IEA,ISO) response to gonadotropin (IEP) response to luteinizing hormone (IEP) signal peptide processing (ISO) vascular associated smooth muscle cell proliferation (IEP) viral life cycle (IEA,ISO)
1.
Hormonal regulation of proprotein convertase subtilisin/kexin type 5 expression during ovarian follicle development in the rat.
Bae JA, etal., Mol Cell Endocrinol. 2008 Jul 16;289(1-2):29-37. doi: 10.1016/j.mce.2008.04.006. Epub 2008 Apr 22.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
cDNA structure of the mouse and rat subtilisin/kexin-like PC5: a candidate proprotein convertase expressed in endocrine and nonendocrine cells.
Lusson J, etal., Proc Natl Acad Sci U S A 1993 Jul 15;90(14):6691-5.
5.
The pro-protein convertase PC1 is induced in the transected sciatic nerve and is present in cultured Schwann cells: comparison with PC5, furin and PC7, implication in pro-BDNF processing.
Marcinkiewicz M, etal., Brain Res Mol Brain Res. 1998 Aug 31;59(2):229-46.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
GOA pipeline
RGD automated data pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Comprehensive gene review and curation
RGD comprehensive gene curation
12.
Endoproteolytic activation of alpha(v) integrin by proprotein convertase PC5 is required for vascular smooth muscle cell adhesion to vitronectin and integrin-dependent signaling.
Stawowy P, etal., Circulation. 2004 Feb 17;109(6):770-6.
13.
Coordinated regulation and colocalization of alphav integrin and its activating enzyme proprotein convertase PC5 in vivo.
Stawowy P, etal., Histochem Cell Biol. 2003 Mar;119(3):239-45. Epub 2003 Feb 20.
14.
Proprotein convertase PC5 regulation by PDGF-BB involves PI3-kinase/p70(s6)-kinase activation in vascular smooth muscle cells.
Stawowy P, etal., Hypertension. 2002 Feb;39(2 Pt 2):399-404.
15.
Selective expression of the proprotein convertases furin, pc5, and pc7 in proliferating vascular smooth muscle cells of the rat aorta in vitro.
Stawowy P, etal., J Histochem Cytochem. 2001 Mar;49(3):323-32.
16.
The proprotein convertase PC5/6 is protective against intestinal tumorigenesis: in vivo mouse model.
Sun X, etal., Mol Cancer. 2009 Sep 8;8:73. doi: 10.1186/1476-4598-8-73.
17.
VACTERL/caudal regression/Currarino syndrome-like malformations in mice with mutation in the proprotein convertase Pcsk5.
Szumska D, etal., Genes Dev. 2008 Jun 1;22(11):1465-77. doi: 10.1101/gad.479408.
18.
PCSK5 and GDF11 expression in the hindgut region of mouse embryos with anorectal malformations.
Tsuda T, etal., Eur J Pediatr Surg. 2011 Aug;21(4):238-41. doi: 10.1055/s-0031-1273691. Epub 2011 Apr 8.
19.
Immunohistochemical evidence for the involvement of protein convertases 5A and 2 in the processing of pro-neurotensin in rat brain.
Villeneuve P, etal., J Comp Neurol. 2000 Aug 28;424(3):461-75.
20.
Immunohistochemical distribution of the prohormone convertase PC5-A in rat brain.
Villeneuve P, etal., Neuroscience. 1999;92(2):641-54.
Pcsk5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 224,263,823 - 224,694,350 (-) NCBI GRCr8 mRatBN7.2 1 214,837,847 - 215,267,626 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 214,837,927 - 215,267,600 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 223,320,598 - 223,601,308 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 230,257,142 - 230,537,850 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 223,075,150 - 223,355,852 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 236,031,988 - 236,313,858 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 236,031,988 - 236,313,858 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 243,339,259 - 243,768,026 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 220,961,912 - 221,405,907 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 221,283,956 - 221,569,937 (-) NCBI Celera 1 212,298,555 - 212,578,355 (-) NCBI Celera Cytogenetic Map 1 q43 NCBI
PCSK5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 75,889,809 - 76,362,975 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 75,890,644 - 76,362,975 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 78,505,589 - 78,977,891 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 77,695,441 - 77,998,164 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 75,735,174 - 76,037,889 NCBI Celera 9 49,083,010 - 49,551,972 (+) NCBI Celera Cytogenetic Map 9 q21.13 NCBI HuRef 9 48,336,126 - 48,806,234 (+) NCBI HuRef CHM1_1 9 78,651,993 - 79,121,401 (+) NCBI CHM1_1 T2T-CHM13v2.0 9 88,048,502 - 88,519,580 (+) NCBI T2T-CHM13v2.0
Pcsk5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 17,409,678 - 17,815,076 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 17,409,683 - 17,814,996 (-) Ensembl GRCm39 Ensembl GRCm38 19 17,432,314 - 17,837,712 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 17,432,319 - 17,837,632 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 17,507,322 - 17,912,122 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 17,499,851 - 17,993,244 (-) NCBI MGSCv36 mm8 Celera 19 18,108,836 - 18,517,555 (-) NCBI Celera Cytogenetic Map 19 B NCBI cM Map 19 12.86 NCBI
Pcsk5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955512 2,917,243 - 3,333,688 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955512 2,914,834 - 3,333,440 (-) NCBI ChiLan1.0 ChiLan1.0
PCSK5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 75,063,314 - 75,524,928 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 75,069,756 - 75,532,735 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 48,480,607 - 48,943,331 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 74,745,187 - 75,224,347 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 74,745,761 - 75,220,502 (+) Ensembl panpan1.1 panPan2
PCSK5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 82,088,090 - 82,506,131 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 82,090,664 - 82,555,145 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 82,554,152 - 83,012,101 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 82,504,812 - 82,963,105 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 82,506,866 - 82,963,633 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 82,293,218 - 82,750,127 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 82,009,456 - 82,467,391 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 82,737,312 - 83,195,037 (-) NCBI UU_Cfam_GSD_1.0
Pcsk5 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 129,415,166 - 129,706,026 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936503 11,466,950 - 11,896,887 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936503 11,466,955 - 11,896,887 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PCSK5 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 228,854,595 - 229,308,906 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 228,854,587 - 229,308,054 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 255,618,184 - 255,748,891 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PCSK5 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 86,907,173 - 87,367,935 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 87,042,557 - 87,367,033 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 75,357,152 - 75,822,509 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pcsk5
.
Predicted Target Of
Count of predictions: 48 Count of miRNA genes: 40 Interacting mature miRNAs: 43 Transcripts: ENSRNOT00000016164 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
8693637 Alc29 Alcohol consumption QTL 29 2.7 0.258 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 234238494 Rat 1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 61455 Niddm7 Non-insulin dependent diabetes mellitus QTL 7 5.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 214537555 238757011 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 1600397 Edcs4 Endometrial carcinoma susceptibility QTL 4 2.2 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 1 206081677 251081677 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 8693661 Alc34 Alcohol consumption QTL 34 2.2 0.611 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 228627600 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 724538 Kidm1 Kidney mass QTL 1 3.2 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 213707201 252085212 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 734768 Niddm59 Non-insulin dependent diabetes mellitus QTL 59 body mass (VT:0001259) body weight (CMO:0000012) 1 213843987 258843987 Rat 1358890 Bp259 Blood pressure QTL 259 3.06 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 210702053 260522016 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1549910 Bw54 Body weight QTL 54 0.05 body mass (VT:0001259) body weight (CMO:0000012) 1 214647894 259647894 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 70211 Niddm24 Non-insulin dependent diabetes mellitus QTL 24 3.79 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 214647894 259647894 Rat 1357399 Bw45 Body weight QTL 45 3.05 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 1 206329708 251329708 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 1357404 Bw42 Body weight QTL 42 4.49 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 206329708 251329708 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 1358916 Kidm22 Kidney mass QTL 22 3.32 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 210702053 240947965 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 2292218 Kidm35 Kidney mass QTL 35 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 199368955 224569684 Rat 1331790 Bp201 Blood pressure QTL 201 3.127 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 198211513 225126682 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292216 Bw80 Body weight QTL 80 3.23 0.0019 body mass (VT:0001259) body weight (CMO:0000012) 1 213533809 243914901 Rat 61403 Niddm4 Non-insulin dependent diabetes mellitus QTL 4 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 206329708 222745518 Rat 1300168 Bp170 Blood pressure QTL 170 2.76 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 207702246 228581766 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634340 Hcar5 Hepatocarcinoma resistance QTL 5 8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 214537555 226660468 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 8693618 Alc25 Alcohol consumption QTL 25 3 0.28 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 228627600 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat
WI-15571
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 1 243,620,894 - 243,621,018 NCBI Rnor5.0 RGSC_v3.4 1 221,117,553 - 221,117,676 UniSTS RGSC3.4 Celera 1 212,298,590 - 212,298,713 UniSTS Cytogenetic Map 1 q43 UniSTS
D1Bda56
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 214,838,009 - 214,838,227 (-) MAPPER mRatBN7.2 Rnor_6.0 1 236,463,116 - 236,463,333 NCBI Rnor6.0 Rnor_5.0 1 243,767,646 - 243,767,863 UniSTS Rnor5.0 RGSC_v3.4 1 220,962,676 - 220,962,893 UniSTS RGSC3.4 Celera 1 212,153,579 - 212,153,796 UniSTS Cytogenetic Map 1 q43 UniSTS
RH137520
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 215,113,055 - 215,113,207 (-) MAPPER mRatBN7.2 Rnor_6.0 1 236,187,308 - 236,187,459 NCBI Rnor6.0 Rnor_5.0 1 243,494,174 - 243,494,325 UniSTS Rnor5.0 RGSC_v3.4 1 221,245,252 - 221,245,403 UniSTS RGSC3.4 Celera 1 212,423,976 - 212,424,127 UniSTS Cytogenetic Map 1 q43 UniSTS
BF390451
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 215,029,096 - 215,029,264 (-) MAPPER mRatBN7.2 Rnor_6.0 1 236,271,388 - 236,271,555 NCBI Rnor6.0 Rnor_5.0 1 243,578,583 - 243,578,750 UniSTS Rnor5.0 RGSC_v3.4 1 221,159,182 - 221,159,349 UniSTS RGSC3.4 Celera 1 212,340,809 - 212,340,976 UniSTS RH 3.4 Map 9 759.09 UniSTS Cytogenetic Map 1 q43 UniSTS
D19Dcr4
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 214,924,277 - 214,924,324 (-) MAPPER mRatBN7.2 Rnor_6.0 1 236,378,896 - 236,378,942 NCBI Rnor6.0 Rnor_5.0 1 243,682,944 - 243,682,990 UniSTS Rnor5.0 RGSC_v3.4 1 221,049,791 - 221,049,837 UniSTS RGSC3.4 Celera 1 212,236,451 - 212,236,497 UniSTS Cytogenetic Map 1 q43 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016164 ⟹ ENSRNOP00000016164
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 214,986,922 - 215,267,600 (-) Ensembl Rnor_6.0 Ensembl 1 236,031,988 - 236,313,858 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000100985 ⟹ ENSRNOP00000089163
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 214,837,927 - 215,267,600 (-) Ensembl
RefSeq Acc Id:
NM_053823 ⟹ NP_446275
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 224,413,648 - 224,694,347 (-) NCBI mRatBN7.2 1 214,986,922 - 215,267,600 (-) NCBI Rnor_6.0 1 236,031,988 - 236,313,858 (+) NCBI Rnor_5.0 1 243,339,259 - 243,768,026 (+) NCBI Celera 1 212,298,555 - 212,578,355 (-) NCBI
Sequence:
CGGGACCATGGACTGGGGCTGGGGGAGCCGCTGCTGTCGCCCGGGACGGCGGGATCTGCTGTGCGTGCTGGCACTGCTCGCCGGCTGTCTGCTCCCAGTGTGCCGGACGCGTGTCTACACCAACCACT
hide sequence
RefSeq Acc Id:
XM_039109692 ⟹ XP_038965620
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 224,263,823 - 224,694,350 (-) NCBI mRatBN7.2 1 214,837,847 - 215,267,626 (-) NCBI
RefSeq Acc Id:
XM_039109729 ⟹ XP_038965657
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 224,263,823 - 224,694,350 (-) NCBI mRatBN7.2 1 214,837,847 - 215,267,626 (-) NCBI
RefSeq Acc Id:
XM_039109772 ⟹ XP_038965700
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 224,263,823 - 224,468,364 (-) NCBI mRatBN7.2 1 214,837,847 - 215,041,606 (-) NCBI
RefSeq Acc Id:
XM_039109807 ⟹ XP_038965735
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 224,263,823 - 224,393,988 (-) NCBI mRatBN7.2 1 214,837,847 - 214,974,625 (-) NCBI
RefSeq Acc Id:
XM_063264264 ⟹ XP_063120334
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 224,372,010 - 224,694,350 (-) NCBI
RefSeq Acc Id:
NP_446275 ⟸ NM_053823
- Peptide Label:
preproprotein
- UniProtKB:
A6I0J8 (UniProtKB/TrEMBL)
- Sequence:
MDWGWGSRCCRPGRRDLLCVLALLAGCLLPVCRTRVYTNHWAVKIAGGFAEADRIASKYGFINVGQIGALKDYYHFYHSRTIKRSVLSSRGTHSFISMEPKVEWIQQQVVKKRTKRDYDLSRAQSTYF
hide sequence
Ensembl Acc Id:
ENSRNOP00000016164 ⟸ ENSRNOT00000016164
RefSeq Acc Id:
XP_038965657 ⟸ XM_039109729
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6AKB3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038965620 ⟸ XM_039109692
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AKB3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038965700 ⟸ XM_039109772
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038965735 ⟸ XM_039109807
- Peptide Label:
isoform X4
- UniProtKB:
A6I0J7 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000089163 ⟸ ENSRNOT00000100985
RefSeq Acc Id:
XP_063120334 ⟸ XM_063264264
- Peptide Label:
isoform X5
RGD ID: 13690809 Promoter ID: EPDNEW_R1334 Type: single initiation site Name: Pcsk5_1 Description: proprotein convertase subtilisin/kexin type 5 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 236,031,944 - 236,032,004 EPDNEW
BioCyc Gene G2FUF-56209 BioCyc
Ensembl Genes ENSRNOG00000012036 Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript ENSRNOT00000016164 ENTREZGENE
ENSRNOT00000016164.8 UniProtKB/Swiss-Prot
ENSRNOT00000100985 ENTREZGENE
Gene3D-CATH 3.30.70.850 UniProtKB/Swiss-Prot
3.40.50.200 UniProtKB/Swiss-Prot
Galactose-binding domain-like UniProtKB/Swiss-Prot
Hormone Receptor, Insulin-like Growth Factor Receptor 1, Chain A, domain 2 UniProtKB/Swiss-Prot
InterPro EGF-like_dom UniProtKB/Swiss-Prot
Furin_repeat UniProtKB/Swiss-Prot
Galactose-bd-like_sf UniProtKB/Swiss-Prot
GF_recep_IV UniProtKB/Swiss-Prot
Growth_fac_rcpt_cys_sf UniProtKB/Swiss-Prot
Kexin/furin UniProtKB/Swiss-Prot
P_dom UniProtKB/Swiss-Prot
Peptidase_S8/S53_dom UniProtKB/Swiss-Prot
Peptidase_S8/S53_dom_sf UniProtKB/Swiss-Prot
Peptidase_S8_Asp-AS UniProtKB/Swiss-Prot
Peptidase_S8_His-AS UniProtKB/Swiss-Prot
Peptidase_S8_Ser-AS UniProtKB/Swiss-Prot
Peptidase_S8_subtilisin-rel UniProtKB/Swiss-Prot
Rspo_Fu-CRD_dom UniProtKB/Swiss-Prot
S8_pro-domain UniProtKB/Swiss-Prot
S8_pro-domain_sf UniProtKB/Swiss-Prot
KEGG Report rno:116548 UniProtKB/Swiss-Prot
NCBI Gene 116548 ENTREZGENE
PANTHER FURIN-LIKE PROTEASE 1, ISOFORMS 1_1-X_2 UniProtKB/Swiss-Prot
PROPROTEIN CONVERTASE SUBTILISIN/KEXIN-RELATED UniProtKB/Swiss-Prot
Pfam Furin-like_2 UniProtKB/Swiss-Prot
GF_recep_IV UniProtKB/Swiss-Prot
P_proprotein UniProtKB/Swiss-Prot
Peptidase_S8 UniProtKB/Swiss-Prot
S8_pro-domain UniProtKB/Swiss-Prot
PhenoGen Pcsk5 PhenoGen
PRINTS SUBTILISIN UniProtKB/Swiss-Prot
PROSITE P_HOMO_B UniProtKB/Swiss-Prot
SUBTILASE UniProtKB/Swiss-Prot
SUBTILASE_ASP UniProtKB/Swiss-Prot
SUBTILASE_HIS UniProtKB/Swiss-Prot
SUBTILASE_SER UniProtKB/Swiss-Prot
RatGTEx ENSRNOG00000012036 RatGTEx
SMART EGF UniProtKB/Swiss-Prot
Ephrin_rec_like UniProtKB/Swiss-Prot
SM00261 UniProtKB/Swiss-Prot
Superfamily-SCOP Protease propeptides/inhibitors UniProtKB/Swiss-Prot
SSF49785 UniProtKB/Swiss-Prot
SSF52743 UniProtKB/Swiss-Prot
SSF57184 UniProtKB/Swiss-Prot
UniProt A0A8I6AKB3 ENTREZGENE, UniProtKB/TrEMBL
A6I0J7 ENTREZGENE, UniProtKB/TrEMBL
A6I0J8 ENTREZGENE, UniProtKB/TrEMBL
P41413 ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary D3ZVZ3 UniProtKB/Swiss-Prot
Q62914 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Pcsk5
proprotein convertase subtilisin/kexin type 5
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Pcsk5
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_product
member of the subtilisin/kexin like proprotein convertase family
729485
