Symbol:
Tacr1
Name:
tachykinin receptor 1
RGD ID:
3811
Description:
Enables substance P receptor activity. Involved in several processes, including learning or memory; positive regulation of cell communication; and regulation of cell migration. Located in cell body; cell surface; and dendrite. Is active in postsynaptic membrane. Used to study central sleep apnea; cystitis; pancreatitis; and pulmonary hypertension. Biomarker of acute necrotizing pancreatitis; allergic rhinitis; asthma; colitis; and respiratory syncytial virus infectious disease. Human ortholog(s) of this gene implicated in developmental disorder of mental health and exercise-induced bronchoconstriction. Orthologous to human TACR1 (tachykinin receptor 1); PARTICIPATES IN calcium/calcium-mediated signaling pathway; measles pathway; INTERACTS WITH (S)-amphetamine; (S)-nicotine; 1,2-naphthoquinone.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
neurokinin 1 receptor; NK-1 receptor; NK-1R; SPR; substance p receptor; substance-P receptor; Tac1r; Tachykinin 1 receptor; Tachykinin 1 receptor (substance P receptor neurokinin 1 receptor); Tachykinin 1 receptor (substance P receptor neurokinin 1 receptor) see also D4Mgh17 D4Wox19 and D4Mit23
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
TACR1 (tachykinin receptor 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Tacr1 (tachykinin receptor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Tacr1 (tachykinin receptor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
TACR1 (tachykinin receptor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
TACR1 (tachykinin receptor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Tacr1 (tachykinin receptor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
TACR1 (tachykinin receptor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
TACR1 (tachykinin receptor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Tacr1 (tachykinin receptor 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
TACR1 (tachykinin receptor 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Tacr1 (tachykinin receptor 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tacr1a (tachykinin receptor 1a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
tacr1b (tachykinin receptor 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
tkr-2
Alliance
DIOPT (Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
TkR99D
Alliance
DIOPT (Hieranoid|InParanoid|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
tacr1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Is Marker For:
Strains:
BB.SHR-(D4Got41-Tacr1 )/K QTLs:
Bw52
Candidate Gene For:
Anxrr16
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 116,478,617 - 116,647,492 (+) NCBI GRCr8 mRatBN7.2 4 114,920,844 - 115,089,733 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 114,920,844 - 115,089,733 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 120,383,645 - 120,552,243 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 116,158,843 - 116,327,453 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 114,778,790 - 114,948,892 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 113,247,236 - 113,416,139 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 113,247,795 - 113,414,504 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 177,926,094 - 178,095,041 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 116,610,595 - 116,780,394 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 116,855,058 - 117,024,964 (+) NCBI Celera 4 103,918,032 - 104,086,347 (+) NCBI Celera Cytogenetic Map 4 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tacr1 Rat (S)-amphetamine affects response to substance EXP 6480464 TACR1 protein affects the susceptibility to Dextroamphetamine CTD PMID:11897087 Tacr1 Rat (S)-nicotine multiple interactions EXP 6480464 Mecamylamine inhibits the reaction [Nicotine results in increased expression of TACR1 mRNA] more ... CTD PMID:26524655 Tacr1 Rat (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of TACR1 mRNA and Nicotine results in decreased expression of TACR1 protein CTD PMID:27329243 Tacr1 Rat (S)-nicotine increases expression EXP 6480464 Nicotine results in increased expression of TACR1 mRNA and Nicotine results in increased expression of TACR1 protein CTD PMID:26524655 Tacr1 Rat 1,2-dichloroethane decreases expression ISO Tacr1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of TACR1 mRNA CTD PMID:28960355 Tacr1 Rat 1,2-dimethylhydrazine decreases expression ISO Tacr1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of TACR1 mRNA CTD PMID:22206623 Tacr1 Rat 1,2-naphthoquinone multiple interactions EXP 6480464 [1 more ... CTD PMID:19399481 Tacr1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of TACR1 mRNA CTD PMID:29097150 Tacr1 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of TACR1 mRNA and [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of TACR1 mRNA CTD PMID:26496021 and PMID:32741896 Tacr1 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of TACR1 mRNA CTD PMID:32741896 Tacr1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:27291303 Tacr1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Tacr1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of TACR1 mRNA CTD PMID:21570461 Tacr1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of TACR1 mRNA CTD PMID:33387578 Tacr1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of TACR1 mRNA CTD PMID:34747641 Tacr1 Rat 2,4,6-trinitrobenzenesulfonic acid multiple interactions ISO Tacr1 (Mus musculus) 6480464 TACR1 gene mutant form inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of COL1A2 mRNA] more ... CTD PMID:20889569 Tacr1 Rat 2,4,6-trinitrobenzenesulfonic acid affects response to substance ISO Tacr1 (Mus musculus) 6480464 TACR1 protein affects the susceptibility to Trinitrobenzenesulfonic Acid CTD PMID:20889569 Tacr1 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:32119087 Tacr1 Rat 4,4'-sulfonyldiphenol increases expression ISO Tacr1 (Mus musculus) 6480464 bisphenol S results in increased expression of TACR1 mRNA CTD PMID:30951980 Tacr1 Rat 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole multiple interactions ISO Tacr1 (Mus musculus) 6480464 Omeprazole inhibits the reaction [Acids affects the localization of TACR1 protein] CTD PMID:16091555 Tacr1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of TACR1 mRNA CTD PMID:31881176 Tacr1 Rat aflatoxin B1 decreases methylation ISO TACR1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of TACR1 gene CTD PMID:27153756 Tacr1 Rat alpha-amyrin multiple interactions ISO Tacr1 (Mus musculus) 6480464 [alpha-amyrin co-treated with beta-amyrin] inhibits the reaction [Cyclophosphamide results in increased expression of TACR1 protein] CTD PMID:18210232 Tacr1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TACR1 mRNA CTD PMID:16483693 Tacr1 Rat aprepitant multiple interactions ISO Tacr1 (Mus musculus) 6480464 aprepitant inhibits the reaction [TAC1 protein results in increased expression of TACR1 mRNA] CTD PMID:18441096 Tacr1 Rat aprepitant multiple interactions ISO TACR1 (Homo sapiens) 6480464 aprepitant binds to and results in decreased activity of TACR1 protein CTD PMID:20623144 and PMID:20718754 Tacr1 Rat arsenite(3-) multiple interactions ISO Tacr1 (Mus musculus) 6480464 [arsenite co-treated with Benzo(a)pyrene] results in decreased expression of TACR1 mRNA CTD PMID:15894712 Tacr1 Rat arsenite(3-) decreases expression ISO Tacr1 (Mus musculus) 6480464 arsenite results in decreased expression of TACR1 mRNA CTD PMID:15894712 Tacr1 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of TACR1 gene CTD PMID:35440735 Tacr1 Rat Azoxymethane multiple interactions ISO Tacr1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of TACR1 mRNA CTD PMID:29950665 Tacr1 Rat Bardoxolone methyl decreases activity ISO TACR1 (Homo sapiens) 6480464 bardoxolone methyl results in decreased activity of TACR1 protein CTD PMID:28790194 Tacr1 Rat benzo[a]pyrene multiple interactions ISO Tacr1 (Mus musculus) 6480464 [arsenite co-treated with Benzo(a)pyrene] results in decreased expression of TACR1 mRNA CTD PMID:15894712 Tacr1 Rat benzo[a]pyrene affects methylation ISO TACR1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of TACR1 exon CTD PMID:27901495 Tacr1 Rat benzo[a]pyrene increases methylation ISO TACR1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of TACR1 3' UTR CTD PMID:27901495 Tacr1 Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of TACR1 mRNA CTD PMID:22374506 Tacr1 Rat benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of TACR1 mRNA CTD PMID:21839799 Tacr1 Rat benzo[a]pyrene decreases expression ISO Tacr1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of TACR1 mRNA CTD PMID:15894712 Tacr1 Rat beta-amyrin multiple interactions ISO Tacr1 (Mus musculus) 6480464 [alpha-amyrin co-treated with beta-amyrin] inhibits the reaction [Cyclophosphamide results in increased expression of TACR1 protein] CTD PMID:18210232 Tacr1 Rat bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of TACR1 mRNA CTD PMID:15620428 Tacr1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of TACR1 mRNA and [bisphenol A co-treated with Testosterone] results in increased expression of TACR1 mRNA CTD PMID:26496021 Tacr1 Rat bisphenol A decreases methylation ISO TACR1 (Homo sapiens) 6480464 bisphenol A results in decreased methylation of TACR1 gene CTD PMID:31601247 Tacr1 Rat bisphenol A multiple interactions ISO TACR1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of TACR1 gene CTD PMID:31601247 Tacr1 Rat bisphenol A increases expression ISO TACR1 (Homo sapiens) 6480464 bisphenol A results in increased expression of TACR1 mRNA CTD PMID:29275510 Tacr1 Rat bisphenol A increases expression ISO Tacr1 (Mus musculus) 6480464 bisphenol A results in increased expression of TACR1 mRNA CTD PMID:30951980 Tacr1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of TACR1 gene CTD PMID:28505145 Tacr1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of TACR1 mRNA CTD PMID:25181051 and PMID:30816183 Tacr1 Rat bisphenol F increases expression ISO Tacr1 (Mus musculus) 6480464 bisphenol F results in increased expression of TACR1 mRNA CTD PMID:30951980 Tacr1 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of TACR1 mRNA CTD PMID:19167457 Tacr1 Rat cadmium atom increases expression ISO TACR1 (Homo sapiens) 6480464 Cadmium results in increased expression of TACR1 mRNA CTD PMID:21694771 Tacr1 Rat capsaicin increases expression ISO Tacr1 (Mus musculus) 6480464 Capsaicin results in increased expression of TACR1 protein CTD PMID:21294877 Tacr1 Rat capsaicin multiple interactions EXP 6480464 Capsaicin affects the reaction [Vehicle Emissions affects the expression of TACR1 mRNA] more ... CTD PMID:13680092 and PMID:19399481 Tacr1 Rat capsaicin affects expression EXP 6480464 Capsaicin affects the expression of TACR1 mRNA CTD PMID:13680092 Tacr1 Rat capsaicin increases response to substance ISO Tacr1 (Mus musculus) 6480464 TACR1 results in increased susceptibility to Capsaicin CTD PMID:10360863 and PMID:11166975 Tacr1 Rat capsaicin decreases expression ISO Tacr1 (Mus musculus) 6480464 Capsaicin results in decreased expression of TACR1 mRNA and Capsaicin results in decreased expression of TACR1 protein CTD PMID:18441096 Tacr1 Rat capsazepine multiple interactions ISO Tacr1 (Mus musculus) 6480464 capsazepine inhibits the reaction [Acids affects the localization of TACR1 protein] CTD PMID:16091555 Tacr1 Rat casopitant multiple interactions ISO TACR1 (Homo sapiens) 6480464 casopitant binds to and results in decreased activity of TACR1 protein and casopitant inhibits the reaction [vofopitant binds to TACR1 protein] CTD PMID:21229983 Tacr1 Rat CGP 52608 multiple interactions ISO TACR1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to TACR1 gene] CTD PMID:28238834 Tacr1 Rat clothianidin increases expression ISO TACR1 (Homo sapiens) 6480464 clothianidin results in increased expression of TACR1 mRNA CTD PMID:31626844 Tacr1 Rat cocaine multiple interactions ISO Tacr1 (Mus musculus) 6480464 HDAC5 affects the reaction [Cocaine affects the expression of TACR1 mRNA] CTD PMID:17988634 Tacr1 Rat CP-96345(1+) multiple interactions EXP 6480464 CP 96345 inhibits the reaction [TAC1 protein affects the localization of TACR1 protein] CTD PMID:7524481 Tacr1 Rat cyclophosphamide multiple interactions ISO Tacr1 (Mus musculus) 6480464 [alpha-amyrin co-treated with beta-amyrin] inhibits the reaction [Cyclophosphamide results in increased expression of TACR1 protein] CTD PMID:18210232 Tacr1 Rat cyclophosphamide multiple interactions EXP 6480464 GR 82334 inhibits the reaction [Cyclophosphamide results in increased expression of TACR1 protein] and Suramin inhibits the reaction [Cyclophosphamide results in increased expression of TACR1 protein] CTD PMID:23666265 Tacr1 Rat cyclophosphamide increases expression EXP 6480464 Cyclophosphamide results in increased expression of TACR1 protein CTD PMID:23666265 Tacr1 Rat cyclophosphamide decreases response to substance ISO Tacr1 (Mus musculus) 6480464 TACR1 gene mutant form results in decreased susceptibility to Cyclophosphamide CTD PMID:10854767 Tacr1 Rat cyclophosphamide increases expression ISO Tacr1 (Mus musculus) 6480464 Cyclophosphamide results in increased expression of TACR1 protein CTD PMID:18210232 Tacr1 Rat dextran sulfate affects response to substance ISO Tacr1 (Mus musculus) 6480464 TACR1 protein affects the susceptibility to Dextran Sulfate CTD PMID:20889569 Tacr1 Rat dextran sulfate multiple interactions ISO Tacr1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of TACR1 mRNA CTD PMID:29950665 Tacr1 Rat dioxygen increases response to substance ISO Tacr1 (Mus musculus) 6480464 TACR1 protein results in increased susceptibility to Oxygen CTD PMID:11463606 Tacr1 Rat dobutamine multiple interactions ISO TACR1 (Homo sapiens) 6480464 Dobutamine promotes the reaction [TAC1 protein binds to and results in increased activity of TACR1 protein] CTD PMID:8994422 Tacr1 Rat dydrogesterone decreases expression ISO Tacr1 (Mus musculus) 6480464 Dydrogesterone results in decreased expression of TACR1 protein CTD PMID:16389545 Tacr1 Rat ethylparaben increases expression ISO TACR1 (Homo sapiens) 6480464 ethyl-p-hydroxybenzoate results in increased expression of TACR1 mRNA CTD PMID:37690743 Tacr1 Rat famotidine multiple interactions ISO Tacr1 (Mus musculus) 6480464 Famotidine inhibits the reaction [Acids affects the localization of TACR1 protein] CTD PMID:16091555 Tacr1 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of TACR1 mRNA CTD PMID:30307764 Tacr1 Rat folic acid decreases expression ISO Tacr1 (Mus musculus) 6480464 Folic Acid results in decreased expression of TACR1 mRNA CTD PMID:25629700 Tacr1 Rat fulvestrant multiple interactions ISO TACR1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of TACR1 gene CTD PMID:31601247 Tacr1 Rat furan decreases expression EXP 6480464 furan results in decreased expression of TACR1 mRNA CTD PMID:25539665 Tacr1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of TACR1 mRNA CTD PMID:22061828 and PMID:33387578 Tacr1 Rat hydrogen chloride affects response to substance EXP 6480464 TACR1 protein affects the susceptibility to Hydrochloric Acid CTD PMID:11730984 Tacr1 Rat lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of TACR1 protein CTD PMID:21570423 Tacr1 Rat lipopolysaccharide increases expression ISO TACR1 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of TACR1 mRNA CTD PMID:35811015 Tacr1 Rat lipopolysaccharide multiple interactions ISO TACR1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of TACR1 mRNA CTD PMID:35811015 Tacr1 Rat manganese atom decreases expression ISO TACR1 (Homo sapiens) 6480464 Manganese results in decreased expression of TACR1 mRNA CTD PMID:17175027 Tacr1 Rat manganese(0) decreases expression ISO TACR1 (Homo sapiens) 6480464 Manganese results in decreased expression of TACR1 mRNA CTD PMID:17175027 Tacr1 Rat manganese(II) chloride decreases expression ISO TACR1 (Homo sapiens) 6480464 manganese chloride results in decreased expression of TACR1 mRNA CTD PMID:17175027 Tacr1 Rat Mecamylamine multiple interactions EXP 6480464 Mecamylamine inhibits the reaction [Nicotine results in increased expression of TACR1 mRNA] and Mecamylamine inhibits the reaction [Nicotine results in increased expression of TACR1 protein] CTD PMID:26524655 Tacr1 Rat methyllycaconitine multiple interactions EXP 6480464 methyllycaconitine inhibits the reaction [Nicotine results in increased expression of TACR1 mRNA] and methyllycaconitine inhibits the reaction [Nicotine results in increased expression of TACR1 protein] CTD PMID:26524655 Tacr1 Rat morphine multiple interactions EXP 6480464 [SR 140333 binds to and results in decreased activity of TACR1 protein] which results in increased susceptibility to Morphine and substance P-saporin inhibits the reaction [Morphine results in increased expression of TACR1 protein] CTD PMID:14511336 and PMID:17123731 Tacr1 Rat morphine decreases expression EXP 6480464 Morphine results in decreased expression of TACR1 protein CTD PMID:19428329 Tacr1 Rat morphine increases expression EXP 6480464 Morphine results in increased expression of TACR1 protein CTD PMID:15964684 and PMID:17123731 Tacr1 Rat nicotine multiple interactions EXP 6480464 Mecamylamine inhibits the reaction [Nicotine results in increased expression of TACR1 mRNA] more ... CTD PMID:26524655 Tacr1 Rat nicotine increases expression EXP 6480464 Nicotine results in increased expression of TACR1 mRNA and Nicotine results in increased expression of TACR1 protein CTD PMID:26524655 Tacr1 Rat nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of TACR1 mRNA and Nicotine results in decreased expression of TACR1 protein CTD PMID:27329243 Tacr1 Rat nitroprusside increases response to substance EXP 6480464 TACR1 protein results in increased susceptibility to Nitroprusside CTD PMID:16982039 Tacr1 Rat omeprazole multiple interactions ISO Tacr1 (Mus musculus) 6480464 Omeprazole inhibits the reaction [Acids affects the localization of TACR1 protein] CTD PMID:16091555 Tacr1 Rat phenyl biguanide increases response to substance EXP 6480464 TACR1 protein results in increased susceptibility to phenyl biguanide CTD PMID:16982039 Tacr1 Rat phenylarsine oxide multiple interactions EXP 6480464 oxophenylarsine inhibits the reaction [TAC1 protein affects the localization of TACR1 protein] CTD PMID:7524481 Tacr1 Rat phenylephrine increases response to substance EXP 6480464 TACR1 protein results in increased susceptibility to Phenylephrine CTD PMID:16982039 Tacr1 Rat rotenone decreases expression ISO Tacr1 (Mus musculus) 6480464 Rotenone results in decreased expression of TACR1 mRNA CTD PMID:35919817 Tacr1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO TACR1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of TACR1 mRNA CTD PMID:35811015 Tacr1 Rat sodium arsenite increases activity ISO Tacr1 (Mus musculus) 6480464 sodium arsenite results in increased activity of TACR1 protein CTD PMID:17056641 Tacr1 Rat sodium arsenite increases expression ISO Tacr1 (Mus musculus) 6480464 sodium arsenite results in increased expression of TACR1 mRNA CTD PMID:37682722 Tacr1 Rat sodium cyanide increases response to substance EXP 6480464 TACR1 protein results in increased susceptibility to Sodium Cyanide CTD PMID:16982039 Tacr1 Rat sucrose multiple interactions EXP 6480464 Sucrose inhibits the reaction [TAC1 protein affects the localization of TACR1 protein] CTD PMID:7524481 Tacr1 Rat suramin multiple interactions EXP 6480464 Suramin inhibits the reaction [Cyclophosphamide results in increased expression of TACR1 protein] CTD PMID:23666265 Tacr1 Rat taurine decreases expression ISO TACR1 (Homo sapiens) 6480464 Taurine results in decreased expression of TACR1 mRNA CTD PMID:16579726 Tacr1 Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in increased expression of TACR1 mRNA and [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of TACR1 mRNA CTD PMID:26496021 and PMID:32741896 Tacr1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of TACR1 mRNA CTD PMID:34492290 Tacr1 Rat titanium dioxide multiple interactions ISO Tacr1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of TACR1 mRNA CTD PMID:29950665 Tacr1 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of TACR1 mRNA CTD PMID:33387578 Tacr1 Rat triptonide increases expression ISO Tacr1 (Mus musculus) 6480464 triptonide results in increased expression of TACR1 mRNA CTD PMID:33045310 Tacr1 Rat valproic acid decreases expression ISO TACR1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of TACR1 mRNA CTD PMID:12807426
Imported Annotations - KEGG (archival)
(S)-amphetamine (EXP) (S)-nicotine (EXP) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1,2-naphthoquinone (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 4,4'-sulfonyldiphenol (ISO) 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (ISO) acetamide (EXP) aflatoxin B1 (ISO) alpha-amyrin (ISO) ammonium chloride (EXP) aprepitant (ISO) arsenite(3-) (ISO) atrazine (EXP) Azoxymethane (ISO) Bardoxolone methyl (ISO) benzo[a]pyrene (EXP,ISO) beta-amyrin (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) bisphenol F (ISO) C60 fullerene (EXP) cadmium atom (ISO) capsaicin (EXP,ISO) capsazepine (ISO) casopitant (ISO) CGP 52608 (ISO) clothianidin (ISO) cocaine (ISO) CP-96345(1+) (EXP) cyclophosphamide (EXP,ISO) dextran sulfate (ISO) dioxygen (ISO) dobutamine (ISO) dydrogesterone (ISO) ethylparaben (ISO) famotidine (ISO) fenvalerate (EXP) folic acid (ISO) fulvestrant (ISO) furan (EXP) gentamycin (EXP) hydrogen chloride (EXP) lipopolysaccharide (EXP,ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) Mecamylamine (EXP) methyllycaconitine (EXP) morphine (EXP) nicotine (EXP) nitroprusside (EXP) omeprazole (ISO) phenyl biguanide (EXP) phenylarsine oxide (EXP) phenylephrine (EXP) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) sodium arsenite (ISO) sodium cyanide (EXP) sucrose (EXP) suramin (EXP) taurine (ISO) testosterone (EXP) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) triptonide (ISO) valproic acid (ISO)
1.
Increased tachykinin receptor gene expression in asthmatic lung and its modulation by steroids.
Adcock IM, etal., J Mol Endocrinol. 1993 Aug;11(1):1-7.
2.
Thiorphan-induced survival and proliferation of rat thymocytes by activation of Akt/survivin pathway and inhibition of caspase-3 activity.
Amantini C, etal., J Pharmacol Exp Ther. 2008 Oct;327(1):215-25. Epub 2008 Jul 11.
3.
Neurokinin-1 receptor antagonism in a rat model of subarachnoid hemorrhage: prevention of upregulation of contractile ETB and 5-HT1B receptors and cerebral blood flow reduction.
Ansar S, etal., J Neurosurg. 2007 May;106(5):881-6.
4.
Intrathecal administration of neurokinin 1 and neurokinin 2 receptor antagonists undermines the savings effect in spinal rats seen in an instrumental learning paradigm.
Baumbauer KM, etal., Behav Neurosci. 2007 Feb;121(1):186-99.
5.
Role of Spinal Microglia in Visceral Hyperalgesia and NK1R Up-regulation in a Rat Model of Chronic Stress.
Bradesi S, etal., Gastroenterology. 2008 Dec 24.
6.
Substance P receptor blockade decreases stretch-induced lung cytokines and lung injury in rats.
Bregeon F, etal., J Physiol. 2010 Apr 15;588(Pt 8):1309-19. Epub 2010 Feb 22.
7.
Direct evidence for the interaction of neurokinin A with the tachykinin NK(1) receptor in tissue.
Bremer AA, etal., Eur J Pharmacol. 2001 Jul 6;423(2-3):143-7.
8.
Ablation of primary afferent neurons by neonatal capsaicin treatment reduces the susceptibility of the portal hypertensive gastric mucosa to ethanol-induced injury in cirrhotic rats.
Camara PR, etal., Eur J Pharmacol. 2008 Jul 28;589(1-3):245-50. Epub 2008 May 16.
9.
Role of substance P and bradykinin in acute pancreatitis induced by secretory phospholipase A2.
Camargo EA, etal., Pancreas. 2008 Jul;37(1):50-5.
10.
Hemodynamic effects of substance P and its receptor antagonist RP67580 in anesthetized rats with carbon tetrachloride-induced cirrhosis.
Cardenas A, etal., Scand J Gastroenterol. 2008 Mar;43(3):328-33.
11.
Exercise reduces GABA synaptic input onto nucleus tractus solitarii baroreceptor second-order neurons via NK1 receptor internalization in spontaneously hypertensive rats.
Chen CY, etal., J Neurosci. 2009 Mar 4;29(9):2754-61.
12.
Tachykinin dysfunction attenuates monocrotaline-induced pulmonary hypertension.
Chen MJ and Lai YL, Toxicol Appl Pharmacol. 2003 Mar 15;187(3):178-85.
13.
Colorectal distension enforce acute urinary bladder distension-induced hepatic vasoconstriction in the rat.
Chen SS, etal., Neurosci Lett. 2008 Oct 10;443(3):257-60. Epub 2008 Jun 27.
14.
Role of the neurokinin-1 receptors in ejaculation in anesthetized rats.
Clement P, etal., J Sex Med. 2009 Jan;6(1):126-34.
15.
Role of kinins and sensory neurons in the rat pleural leukocyte migration induced by Phoneutria nigriventer spider venom.
Costa SK, etal., Neurosci Lett. 2002 Feb 1;318(3):158-62.
16.
Estrogen-dependent regulation of neurokinin 3 receptor-mediated uterine contractility in the rat.
Crane LH, etal., Biol Reprod. 2002 Nov;67(5):1480-7.
17.
Altered neuropeptide Y and neurokinin messenger RNA expression and receptor binding in stress-sensitised rats.
de Lange RP, etal., Brain Res. 2008 May 30;1212:35-47. Epub 2008 Mar 20.
18.
Role of the tachykinin NK1 receptor in a murine model of cigarette smoke-induced pulmonary inflammation.
De Swert KO, etal., Respir Res. 2009 May 15;10:37.
19.
A paradoxical protective role for the proinflammatory peptide substance P receptor (NK1R) in acute hyperoxic lung injury.
Dib M, etal., Am J Physiol Lung Cell Mol Physiol. 2009 Oct;297(4):L687-97. Epub 2009 Jul 24.
20.
Spatial and temporal expression of tachykinins and NK1- and NK2-receptor gene during TNB induced colitis in rats.
Evangelista S, etal., Neuropeptides. 2008 Oct-Dec;42(5-6):663-70. Epub 2008 Aug 19.
21.
Localization of NK1 receptors and roles of substance-P in subepithelial fibroblasts of rat intestinal villi.
Furuya S, etal., Cell Tissue Res. 2010 Nov;342(2):243-59. Epub 2010 Oct 22.
22.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
23.
Substance P stimulates late-stage rat osteoblastic bone formation through neurokinin-1 receptors.
Goto T, etal., Neuropeptides. 2007 Feb;41(1):25-31. Epub 2007 Jan 3.
24.
Neurokinin-1 receptor-expressing cells of the ventral respiratory group are functionally heterogeneous and predominantly glutamatergic.
Guyenet PG, etal., J Neurosci 2002 May 1;22(9):3806-16.
25.
The effect of neurokinin1 receptor blockade on territorial aggression and in a model of violent aggression.
Halasz J, etal., Biol Psychiatry. 2008 Feb 1;63(3):271-8. Epub 2007 Aug 3.
26.
Neurokinin-1 receptor antagonist treatment protects mice against lung injury in polymicrobial sepsis.
Hegde A, etal., J Leukoc Biol. 2007 Sep;82(3):678-85. Epub 2007 Jun 12.
27.
Organization, structure, and expression of the gene encoding the rat substance P receptor.
Hershey AD, etal., J Biol Chem 1991 Mar 5;266(7):4366-74.
28.
Nerve growth factor and nerve growth factor receptors in respiratory syncytial virus-infected lungs.
Hu C, etal., Am J Physiol Lung Cell Mol Physiol 2002 Aug;283(2):L494-502.
29.
LIF upregulates expression of NK-1R in NHBE cells.
Hu CP, etal., Mediators Inflamm. 2006;2006(5):84829.
30.
A neurokinin 1-receptor antagonist improves exercise-induced airway narrowing in asthmatic patients.
Ichinose M, etal., Am J Respir Crit Care Med. 1996 Mar;153(3):936-41.
31.
Synaptic plasticity in spinal lamina I projection neurons that mediate hyperalgesia.
Ikeda H, etal., Science 2003 Feb 21;299(5610):1237-40.
32.
Neurokinin-1 receptor mediates stress-exacerbated allergic airway inflammation and airway hyperresponsiveness in mice.
Joachim RA, etal., Psychosom Med. 2004 Jul-Aug;66(4):564-71.
33.
Role of tachykinin receptors and melatonin in oxitocin secretion from isolated rat hypothalmo-neurohypophysial system.
Juszczak M, etal., J Physiol Pharmacol. 2004 Dec;55(4):739-49.
34.
Effect of melatonin on the vasopressin secretion as influenced by tachykinin NK-1 receptor agonist and antagonist: in vivo and in vitro studies.
Juszczak M, etal., J Physiol Pharmacol. 2007 Dec;58(4):829-43.
35.
Substance P (SP)-neurokinin-1 receptor (NK-1R) alters adipose tissue responses to high-fat diet and insulin action.
Karagiannides I, etal., Endocrinology. 2011 Jun;152(6):2197-205. Epub 2011 Apr 5.
36.
Effects of substance P microinjections into the globus pallidus and central nucleus of amygdala on passive avoidance learning in rats.
Kertes E, etal., Behav Brain Res. 2009 Mar 17;198(2):397-403. Epub 2008 Nov 24.
37.
Elimination of rat spinal substance P receptor bearing neurons dissociates cardiovascular and nocifensive responses to nicotinic agonists.
Khan IM, etal., Neuropharmacology. 2008 Feb;54(2):269-79. Epub 2007 Oct 17.
38.
Substance P is involved in the cutaneous blood flow increase response to sympathetic nerve stimulation in persistently inflamed rats.
Koeda T, etal., J Physiol Sci. 2007 Dec;57(6):361-6. Epub 2007 Dec 4.
39.
The substance P receptor, which couples to Gq/11, is a substrate of beta-adrenergic receptor kinase 1 and 2.
Kwatra MM, etal., J Biol Chem. 1993 May 5;268(13):9161-4.
40.
The effect of CP96,345 on the expression of tachykinins and neurokinin receptors in acute pancreatitis.
Lau HY and Bhatia M, J Pathol. 2006 Feb;208(3):364-71.
41.
The effect of substance P on asthmatic rat airway smooth muscle cell proliferation, migration, and cytoplasmic calcium concentration in vitro.
Li M, etal., J Inflamm (Lond). 2011 Jul 21;8(1):18.
42.
Substance P acts via the neurokinin receptor 1 to elicit bronchoconstriction, oxidative stress, and upregulated ICAM-1 expression after oil smoke exposure.
Li PC, etal., Am J Physiol Lung Cell Mol Physiol. 2008 May;294(5):L912-20. Epub 2008 Mar 7.
43.
[The relationship between leukemia inhibitory factor and neurokinin receptors in a rat model of asthma].
Lin MJ, etal., Zhonghua Jie He He Hu Xi Za Zhi. 2005 Dec;28(12):820-4.
44.
Cyclophosphamide induced cystitis: role of nitric oxide synthase, cyclooxygenase-1 and 2, and NK(1) receptors.
Linares-Fernandez BE and Alfieri AB, J Urol. 2007 Apr;177(4):1531-6.
45.
Synaptic relationship between substance P and the substance P receptor: light and electron microscopic characterization of the mismatch between neuropeptides and their receptors.
Liu H, etal., Proc Natl Acad Sci U S A. 1994 Feb 1;91(3):1009-13. doi: 10.1073/pnas.91.3.1009.
46.
The Role of Substance P in the Marginal Division of the Neostriatum in Learning and Memory is Mediated Through the Neurokinin 1 Receptor in Rats.
Liu XM, etal., Neurochem Res. 2011 May 25.
47.
Mutation burden analysis of six common mental disorders in African Americans by whole genome sequencing.
Liu Y, etal., Hum Mol Genet. 2022 Nov 10;31(22):3769-3776. doi: 10.1093/hmg/ddac129.
48.
Differential effects of dexamethasone, ondansetron and a tachykinin NK1 receptor antagonist (GR205171) on cisplatin-induced changes in behaviour, food intake, pica and gastric function in rats.
Malik NM, etal., Eur J Pharmacol. 2007 Jan 26;555(2-3):164-73. Epub 2006 Oct 28.
49.
Estrogen determines sex differences in airway responsiveness after allergen exposure.
Matsubara S, etal., Am J Respir Cell Mol Biol. 2008 May;38(5):501-8. Epub 2007 Dec 6.
50.
Central and peripheral expression of neurokinin-1 and neurokinin-3 receptor and substance P-encoding messenger RNAs: peripheral regulation during formalin-induced inflammation and lack of neurokinin receptor expression in primary afferent sensory neurons.
McCarson KE Neuroscience. 1999;93(1):361-70.
51.
Unilateral ablation of pre-Botzinger complex disrupts breathing during sleep but not wakefulness.
McKay LC and Feldman JL, Am J Respir Crit Care Med. 2008 Jul 1;178(1):89-95. Epub 2008 Apr 17.
52.
Neurokinin-1 receptors in cholinergic neurons of the rat ventral pallidum have a predominantly dendritic distribution that is affected by apomorphine when combined with startle-evoking auditory stimulation.
Mengual E, etal., Neuroscience. 2008 Feb 6;151(3):711-24. Epub 2007 Dec 4.
53.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
54.
Physiological and morphological properties of, and effect of substance P on, neurons in the A7 catecholamine cell group in rats.
Min MY, etal., Neuroscience. 2008 Jun 2;153(4):1020-33. Epub 2008 Mar 19.
55.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
56.
Activation of neurokinin-1 receptors during ozone inhalation contributes to epithelial injury and repair.
Oslund KL, etal., Am J Respir Cell Mol Biol. 2008 Sep;39(3):279-88. Epub 2008 Apr 3.
57.
NK-1 receptors in the rostral ventromedial medulla contribute to hyperalgesia produced by intraplantar injection of capsaicin.
Pacharinsak C, etal., Pain. 2008 Sep 30;139(1):34-46. Epub 2008 Apr 14.
58.
Tachykinin regulation of cholinergic transmission in the limbic/prefrontal territory of the rat dorsal striatum: implication of new neurokinine 1-sensitive receptor binding site and interaction with enkephalin/mu opioid receptor transmission.
Perez S, etal., J Neurochem. 2007 Dec;103(6):2153-63. Epub 2007 Oct 18.
59.
Respiratory syncytial virus upregulates expression of the substance P receptor in rat lungs.
Piedimonte G, etal., Am J Physiol. 1999 Oct;277(4 Pt 1):L831-40.
60.
Tachykinin receptor and neutral endopeptidase gene expression in the rat uterus: characterization and regulation in response to ovarian steroid treatment.
Pinto FM, etal., Endocrinology. 1999 Jun;140(6):2526-32.
61.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
62.
Further evidence that central tachykinin NK-1 receptors mediate the inhibitory effect of tachykinins on angiotensin-induced drinking in rats.
Polidori C, etal., Peptides. 1998;19(1):149-55.
63.
Neurokinin-1 receptor and substance P messenger RNA levels increase during intraabdominal adhesion formation.
Reed KL, etal., J Surg Res 2002 Nov;108(1):165-72.
64.
GOA pipeline
RGD automated data pipeline
65.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
66.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
67.
Ablation of NK1 receptors in rat nucleus tractus solitarii blocks baroreflexes.
Riley J, etal., Hypertension 2002 Dec;40(6):823-6.
68.
Calcitonin gene-related peptide regulates expression of neurokinin1 receptors by rat spinal neurons.
Seybold VS, etal., J Neurosci 2003 Mar 1;23(5):1816-24.
69.
[Role of neurokinin-1 receptor in lung injury in rats with acute necrotizing pancreatitis].
Shi X, etal., Zhongguo Wei Zhong Bing Ji Jiu Yi Xue. 2003 Jul;15(7):422-5.
70.
Early protection from burn-induced acute lung injury by deletion of preprotachykinin-A gene.
Sio SW, etal., Am J Respir Crit Care Med. 2010 Jan 1;181(1):36-46. Epub 2009 Oct 1.
71.
The neuropeptide substance P is a critical mediator of burn-induced acute lung injury.
Sio SW, etal., J Immunol. 2008 Jun 15;180(12):8333-41.
72.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
73.
Decreased substance P and NK1 receptor immunoreactivity and function in the spinal cord dorsal horn of morphine-treated neonatal rats.
Thomson LM, etal., J Pain. 2008 Jan;9(1):11-9. Epub 2007 Oct 24.
74.
Substance P regulates migration in rat intestinal epithelial cells.
Turner DJ, etal., Ann Surg. 2007 Mar;245(3):408-14.
75.
TRPV1-mediated protection against endotoxin-induced hypotension and mortality in rats.
Wang Y, etal., Am J Physiol Regul Integr Comp Physiol. 2008 May;294(5):R1517-23. Epub 2008 Mar 12.
76.
Interdependent regulation of afferent renal nerve activity and renal function: role of transient receptor potential vanilloid type 1, neurokinin 1, and calcitonin gene-related peptide receptors.
Xie C, etal., J Pharmacol Exp Ther. 2008 Jun;325(3):751-7. Epub 2008 Mar 25.
77.
[Expression of substance P receptor mRNA in nasal mucosa of rat in allergic rhinitis model].
Xue J, etal., Zhonghua Er Bi Yan Hou Ke Za Zhi. 2000 Aug;35(4):247-50.
78.
Neurokinin-1 receptor enhances TRPV1 activity in primary sensory neurons via PKCepsilon: a novel pathway for heat hyperalgesia.
Zhang H, etal., J Neurosci. 2007 Oct 31;27(44):12067-77.
79.
Sprouting of substance P-expressing primary afferent central terminals and spinal micturition reflex NK1 receptor dependence after spinal cord injury.
Zhang X, etal., Am J Physiol Regul Integr Comp Physiol. 2008 Dec;295(6):R2084-96. Epub 2008 Oct 22.
Tacr1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 116,478,617 - 116,647,492 (+) NCBI GRCr8 mRatBN7.2 4 114,920,844 - 115,089,733 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 114,920,844 - 115,089,733 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 120,383,645 - 120,552,243 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 116,158,843 - 116,327,453 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 114,778,790 - 114,948,892 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 113,247,236 - 113,416,139 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 113,247,795 - 113,414,504 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 177,926,094 - 178,095,041 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 116,610,595 - 116,780,394 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 116,855,058 - 117,024,964 (+) NCBI Celera 4 103,918,032 - 104,086,347 (+) NCBI Celera Cytogenetic Map 4 q34 NCBI
TACR1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 75,046,463 - 75,199,520 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 75,046,463 - 75,199,520 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 75,273,590 - 75,426,646 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 75,129,738 - 75,279,781 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 75,189,817 - 75,337,838 NCBI Celera 2 75,104,880 - 75,257,954 (-) NCBI Celera Cytogenetic Map 2 p12 NCBI HuRef 2 75,010,440 - 75,164,411 (-) NCBI HuRef CHM1_1 2 75,202,888 - 75,356,007 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 75,055,302 - 75,208,694 (-) NCBI T2T-CHM13v2.0
Tacr1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 82,378,990 - 82,537,085 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 82,379,315 - 82,537,085 (+) Ensembl GRCm39 Ensembl GRCm38 6 82,402,003 - 82,560,104 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 82,402,334 - 82,560,104 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 82,352,469 - 82,510,098 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 82,368,133 - 82,525,757 (+) NCBI MGSCv36 mm8 Celera 6 84,384,420 - 84,542,486 (+) NCBI Celera Cytogenetic Map 6 C3 NCBI cM Map 6 35.94 NCBI
Tacr1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955424 10,614,340 - 10,761,872 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955424 10,614,340 - 10,761,872 (+) NCBI ChiLan1.0 ChiLan1.0
TACR1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 51,188,457 - 51,344,443 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 51,191,211 - 51,347,197 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 75,111,339 - 75,267,320 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 76,614,478 - 76,771,018 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 76,614,478 - 76,771,018 (-) Ensembl panpan1.1 panPan2
TACR1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 48,038,010 - 48,178,971 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 48,038,010 - 48,178,971 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 47,681,510 - 47,821,826 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 48,900,538 - 49,041,473 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 48,899,743 - 49,044,192 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 47,916,025 - 48,056,577 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 47,980,726 - 48,121,228 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 48,542,868 - 48,683,479 (+) NCBI UU_Cfam_GSD_1.0
Tacr1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024406292 9,315,839 - 9,471,281 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936556 1,266,613 - 1,421,275 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936556 1,266,621 - 1,421,271 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TACR1
TACR1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 14 32,080,319 - 32,236,556 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 14 32,083,615 - 32,233,596 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 79,940,541 - 80,098,197 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tacr1
.
Predicted Target Of
Count of predictions: 190 Count of miRNA genes: 128 Interacting mature miRNAs: 152 Transcripts: ENSRNOT00000007984 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
1582232 Gluco25 Glucose level QTL 25 3.6 0.0023 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 85253748 148090731 Rat 631689 Scl4 Serum cholesterol level QTL 4 1.9 0.008 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 4 95174120 140174120 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1578655 Bmd11 Bone mineral density QTL 11 11 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 4 90850165 135850165 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1357342 Bw40 Body weight QTL 40 0.001 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 631556 Bp135 Blood pressure QTL 135 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 78881294 117676292 Rat 61330 Eau1 Experimental allergic uveoretinitis QTL 1 0.0003 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 4 70362013 132642728 Rat 70167 Bw22 Body weight QTL 22 3.1 body mass (VT:0001259) body weight (CMO:0000012) 4 76647384 117676292 Rat 731165 Uae21 Urinary albumin excretion QTL 21 2.4 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 106649412 151649412 Rat 737821 Hcar9 Hepatocarcinoma resistance QTL 9 3.7 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 109866907 167139601 Rat 1549839 Bw52 Body weight QTL 52 0.0001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 61697658 115089733 Rat 1549832 Bss3 Bone structure and strength QTL 3 11 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 4 109827074 154827074 Rat 70177 Xhs1 X-ray hypersensitivity QTL 1 25.1 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 82798864 152731274 Rat 724522 Bp146 Blood pressure QTL 146 2.2 0.0021 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 73630210 118630210 Rat 61476 Aia3 Adjuvant induced arthritis QTL 3 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 86730991 131730991 Rat 1641919 Alc22 Alcohol consumption QTL 22 0.0005 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 81192555 126192555 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 70192 BpQTLcluster5 Blood pressure QTL cluster 5 4.183 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 4 62933508 114921294 Rat 1578670 Bss14 Bone structure and strength QTL 14 16.4 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 4 87327165 132327165 Rat 1300139 Hrtrt6 Heart rate QTL 6 2.85 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 39524264 116179656 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 1331759 Hrtrt13 Heart rate QTL 13 3.54628 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 110275411 168266883 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 1578662 Bss15 Bone structure and strength QTL 15 19.6 femur width (VT:1000666) femoral neck width (CMO:0001695) 4 87327165 132327165 Rat 2302051 Pia28 Pristane induced arthritis QTL 28 5.3 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 73630210 118630210 Rat 2302049 Pia32 Pristane induced arthritis QTL 32 5.1 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112) 4 105789505 150789505 Rat 6478763 Anxrr46 Anxiety related response QTL 46 0.07428 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 6478760 Anxrr45 Anxiety related response QTL 45 0.06717 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 110870972 155870972 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 738015 Pia9 Pristane induced arthritis QTL 9 4.5 0.048 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 80694870 125694870 Rat 7207480 Bss105 Bone structure and strength QTL 105 8.1 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 4 109827074 154827074 Rat 634335 Anxrr16 Anxiety related response QTL 16 7.22 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 93308457 167139447 Rat 631646 Stl4 Serum triglyceride level QTL 4 6.5 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 4 73169846 132642728 Rat 634334 Xhs3 X-ray hypersensitivity QTL 3 10 intestine integrity trait (VT:0010554) post-insult time to onset of moribundity (CMO:0001896) 4 84728680 129854654 Rat 61406 Scwia1 Streptococcal cell wall induced arthritis QTL 1 2.3 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 4 106805662 151805662 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 634344 Hcar7 Hepatocarcinoma resistance QTL 7 7.8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 4 70808386 115808386 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1576316 Ept5 Estrogen-induced pituitary tumorigenesis QTL 5 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 4 83428419 177635233 Rat 631662 Hcar2 Hepatocarcinoma resistance QTL 2 3.1 0.0003 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 4 78878504 123878504 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 61418 Pia5 Pristane induced arthritis QTL 5 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 62277855 128289560 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1358202 Gluco11 Glucose level QTL 11 2.4 0.02 adipocyte glucose uptake trait (VT:0004185) absolute change in adipocyte glucose uptake (CMO:0000873) 4 85379421 167139601 Rat 1641833 Alc21 Alcohol consumption QTL 21 8.6 0.0001 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 56698790 126192555 Rat 2306899 Bp338 Blood pressure QTL 338 0.071 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 81006124 120102625 Rat 631674 Iddm14 Insulin dependent diabetes mellitus QTL 14 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 64528739 157573521 Rat 12798519 Anxrr54 Anxiety related response QTL 54 2.54 0.05 locomotor behavior trait (VT:0001392) distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493) 4 114627026 159627026 Rat 12798523 Anxrr56 Anxiety related response QTL 56 2.83 0.05 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 85253748 150276390 Rat 61434 Cia3 Collagen induced arthritis QTL 3 4.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 103194656 148194656 Rat
D4Mgh17
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 114,921,280 - 114,921,417 (+) MAPPER mRatBN7.2 Rnor_6.0 4 113,247,673 - 113,247,809 NCBI Rnor6.0 Rnor_6.0 4 113,100,978 - 113,101,114 NCBI Rnor6.0 Rnor_5.0 4 177,926,531 - 177,926,667 UniSTS Rnor5.0 Rnor_5.0 4 177,782,842 - 177,782,978 UniSTS Rnor5.0 RGSC_v3.4 4 116,611,031 - 116,611,168 RGD RGSC3.4 RGSC_v3.4 4 116,611,032 - 116,611,168 UniSTS RGSC3.4 RGSC_v3.1 4 116,855,512 - 116,855,649 RGD Celera 4 103,918,469 - 103,918,605 UniSTS RH 3.4 Map 4 660.47 UniSTS RH 3.4 Map 4 660.47 RGD RH 2.0 Map 4 668.7 RGD Cytogenetic Map 4 q34 UniSTS
D4Wox19
Rat Assembly Chr Position (strand) Source JBrowse Rnor_5.0 4 177,782,855 - 177,782,975 NCBI Rnor5.0 Rnor_5.0 4 177,782,854 - 177,782,975 NCBI Rnor5.0 RGSC_v3.4 4 116,611,045 - 116,611,165 RGD RGSC3.4 RGSC_v3.4 4 116,611,046 - 116,611,165 UniSTS RGSC3.4 Celera 4 103,918,483 - 103,918,602 UniSTS
D4Mit23
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 114,921,294 - 114,921,414 (+) MAPPER mRatBN7.2 Rnor_6.0 4 113,247,687 - 113,247,806 NCBI Rnor6.0 Rnor_6.0 4 113,100,992 - 113,101,111 NCBI Rnor6.0 Rnor_5.0 4 177,926,545 - 177,926,664 UniSTS Rnor5.0 Rnor_5.0 4 177,782,856 - 177,782,975 UniSTS Rnor5.0 RGSC_v3.4 4 116,611,046 - 116,611,165 UniSTS RGSC3.4 RGSC_v3.1 4 116,855,526 - 116,855,646 RGD Celera 4 103,918,483 - 103,918,602 UniSTS Cytogenetic Map 4 q34 UniSTS
D4Arb39
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 114,921,179 - 114,921,479 (+) MAPPER mRatBN7.2 Rnor_6.0 4 113,247,572 - 113,247,871 NCBI Rnor6.0 Rnor_6.0 4 113,100,877 - 113,101,176 NCBI Rnor6.0 Rnor_5.0 4 177,782,741 - 177,783,040 UniSTS Rnor5.0 Rnor_5.0 4 177,926,430 - 177,926,729 UniSTS Rnor5.0 RGSC_v3.4 4 116,610,931 - 116,611,230 UniSTS RGSC3.4 Celera 4 103,918,368 - 103,918,667 UniSTS Cytogenetic Map 4 q34 UniSTS
D4Got293
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 115,057,756 - 115,057,980 (+) MAPPER mRatBN7.2 Rnor_6.0 4 113,384,167 - 113,384,390 NCBI Rnor6.0 Rnor_5.0 4 178,063,069 - 178,063,292 UniSTS Rnor5.0 RGSC_v3.4 4 116,748,422 - 116,748,645 UniSTS RGSC3.4 Celera 4 104,054,420 - 104,054,643 UniSTS Cytogenetic Map 4 q34 UniSTS
RH138512
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 115,026,055 - 115,026,184 (+) MAPPER mRatBN7.2 Rnor_6.0 4 113,352,468 - 113,352,596 NCBI Rnor6.0 Rnor_5.0 4 178,031,370 - 178,031,498 UniSTS Rnor5.0 RGSC_v3.4 4 116,716,721 - 116,716,849 UniSTS RGSC3.4 Celera 4 104,022,720 - 104,022,848 UniSTS RH 3.4 Map 4 660.26 UniSTS Cytogenetic Map 4 q34 UniSTS
UniSTS:480302
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 114,921,402 - 114,921,609 (+) MAPPER mRatBN7.2 Rnor_6.0 4 113,247,795 - 113,248,001 NCBI Rnor6.0 Rnor_6.0 4 113,101,100 - 113,101,306 NCBI Rnor6.0 Rnor_5.0 4 177,782,964 - 177,783,170 UniSTS Rnor5.0 Rnor_5.0 4 177,926,653 - 177,926,859 UniSTS Rnor5.0 RGSC_v3.4 4 116,611,154 - 116,611,360 UniSTS RGSC3.4 Celera 4 103,918,591 - 103,918,797 UniSTS Cytogenetic Map 4 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
10
27
108
65
66
37
24
37
6
154
71
91
30
49
29
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000007984 ⟹ ENSRNOP00000007984
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 114,920,844 - 115,089,733 (+) Ensembl Rnor_6.0 Ensembl 4 113,247,795 - 113,414,504 (+) Ensembl
RefSeq Acc Id:
NM_012667 ⟹ NP_036799
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 116,478,617 - 116,647,492 (+) NCBI mRatBN7.2 4 114,920,844 - 115,089,733 (+) NCBI Rnor_6.0 4 113,247,236 - 113,416,139 (+) NCBI Rnor_5.0 4 177,926,094 - 178,095,041 (+) NCBI RGSC_v3.4 4 116,610,595 - 116,780,394 (+) RGD Celera 4 103,918,032 - 104,086,347 (+) NCBI
Sequence:
AGAAGGACCAAGACGGACAAGCTGCGGGTGACAGTAGAAGCTTCAAGCGAAGCAAAGAAAAAGGGAGCTCACCAGCTGGATGCGGACCTCAGAACCCGGCCAGAGGACCAGAACTTTTGCAAGCAACA
hide sequence
RefSeq Acc Id:
NP_036799 ⟸ NM_012667
- UniProtKB:
P14600 (UniProtKB/Swiss-Prot), A6IAH6 (UniProtKB/TrEMBL)
- Sequence:
MDNVLPMDSDLFPNISTNTSESNQFVQPTWQIVLWAAAYTVIVVTSVVGNVVVIWIILAHKRMRTVTNYFLVNLAFAEACMAAFNTVVNFTYAVHNVWYYGLFYCKFHNFFPIAALFASIYSMTAVAF
hide sequence
Ensembl Acc Id:
ENSRNOP00000007984 ⟸ ENSRNOT00000007984
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2001-06-20
Tacr1
Tachykinin 1 receptor
Name updated
67952 APPROVED
2001-06-20
Tac1r
Tachykinin 1 receptor (substance P receptor, neurokinin 1 receptor)
Symbol withdrawn, duplicate of Tacr1 (RGD:3811)
67952 WITHDRAWN
Note Type
Note
Reference
gene_expression
mRNA is stable and expressed in low levels in the lungs
625601
gene_expression
expression declined with age in the lungs of pathogen free rats
625601
gene_process
mediates the respiratory stimulant effect of substance P
625695
