Symbol:
Il6st
Name:
interleukin 6 cytokine family signal transducer
RGD ID:
2903
Description:
Predicted to enable several functions, including ciliary neurotrophic factor receptor binding activity; coreceptor activity; and cytokine receptor activity. Predicted to contribute to cytokine receptor activity; growth factor binding activity; and interleukin-6 receptor binding activity. Involved in several processes, including interleukin-6-mediated signaling pathway; positive regulation of smooth muscle cell migration; and triglyceride mobilization. Located in neuronal cell body membrane. Biomarker of brain ischemia; hepatocellular carcinoma; and status epilepticus. Human ortholog(s) of this gene implicated in arteriosclerosis; hyper IgE recurrent infection syndrome 4; hyperandrogenism; and immunodeficiency 94. Orthologous to human IL6ST (interleukin 6 cytokine family signal transducer); PARTICIPATES IN interleukin-6 signaling pathway; interleukin-27 signaling pathway; cytokine mediated signaling pathway; INTERACTS WITH 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Ac1055; Gp130; IL-6 receptor subunit beta; IL-6R subunit beta; IL-6R-beta; IL-6RB; interleukin 6 signal transducer; interleukin-6 receptor subunit beta; interleukin-6 signal transducer; membrane glycoprotein 130; oncostatin-M receptor subunit alpha
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 45,798,872 - 45,839,501 (+) NCBI GRCr8 mRatBN7.2 2 44,065,979 - 44,106,255 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 44,066,130 - 44,109,936 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 51,196,571 - 51,225,818 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 49,255,007 - 49,284,254 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 44,122,946 - 44,152,152 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 44,279,199 - 44,319,427 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 44,289,393 - 44,314,944 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 63,320,957 - 63,361,404 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 43,806,301 - 43,842,365 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 43,736,911 - 43,762,480 (+) NCBI Celera 2 39,857,022 - 39,886,283 (+) NCBI Celera Cytogenetic Map 2 q14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Il6st Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:731410 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of IL6ST mRNA CTD PMID:36331819 Il6st Rat 1,2-dimethylhydrazine increases expression ISO RGD:731410 6480464 1,2-Dimethylhydrazine results in increased expression of IL6ST mRNA CTD PMID:22206623 Il6st Rat 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine decreases expression EXP 6480464 chlorcyclizine results in decreased expression of IL6ST mRNA CTD PMID:21058326 Il6st Rat 1-octadec-9-enoylglycero-3-phosphate multiple interactions ISO RGD:731410 6480464 3-(4-(4-((1-(2-chlorophenyl)ethoxy)carbonyl amino)-3-methyl-5-isoxazolyl) benzylsulfanyl) propanoic acid inhibits the reaction [lysophosphatidic acid results in increased expression of more ... CTD PMID:25822713 Il6st Rat 1-octadec-9-enoylglycero-3-phosphate increases expression ISO RGD:731410 6480464 lysophosphatidic acid results in increased expression of IL6ST protein CTD PMID:25822713 Il6st Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of IL6ST mRNA CTD PMID:29097150 Il6st Rat 17beta-estradiol affects expression ISO RGD:731409 6480464 Estradiol affects the expression of IL6ST mRNA; Estradiol affects the expression of IL6ST protein CTD PMID:19401270 Il6st Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of IL6ST mRNA CTD PMID:32145629 Il6st Rat 17beta-estradiol increases expression ISO RGD:731409 6480464 Estradiol results in increased expression of IL6ST mRNA CTD PMID:21185374|PMID:31614463 Il6st Rat 17beta-estradiol multiple interactions ISO RGD:731409 6480464 [Progesterone co-treated with Estradiol] results in increased expression of IL6ST mRNA CTD PMID:17404688 Il6st Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:731409 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of IL6ST mRNA] CTD PMID:11007951 Il6st Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of IL6ST mRNA CTD PMID:32109520 Il6st Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:731410 6480464 Tetrachlorodibenzodioxin affects the expression of IL6ST mRNA CTD PMID:21570461 Il6st Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:731409 6480464 Tetrachlorodibenzodioxin results in increased expression of IL6ST mRNA CTD PMID:11007951|PMID:12377990|PMID:20106945|PMID:21632981 Il6st Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of IL6ST mRNA CTD PMID:16960034|PMID:33387578|PMID:34747641 Il6st Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3,4,5,3',4'-pentachlorobiphenyl results in increased expression of IL6ST mRNA CTD PMID:34256052 Il6st Rat 3,5-diethoxycarbonyl-1,4-dihydrocollidine multiple interactions ISO RGD:731410 6480464 SULT2B1 protein promotes the reaction [3,5-diethoxycarbonyl-1,4-dihydrocollidine results in increased expression of IL6ST mRNA]; SULT2B1 protein more ... CTD PMID:27052460 Il6st Rat 3,5-diethoxycarbonyl-1,4-dihydrocollidine increases expression ISO RGD:731410 6480464 3,5-diethoxycarbonyl-1,4-dihydrocollidine results in increased expression of IL6ST mRNA; 3,5-diethoxycarbonyl-1,4-dihydrocollidine results in increased expression of IL6ST more ... CTD PMID:27052460 Il6st Rat 3-methylcholanthrene multiple interactions ISO RGD:731410 6480464 [Methylcholanthrene co-treated with Nanotubes, Carbon] results in decreased expression of IL6ST mRNA CTD PMID:25926378 Il6st Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:731410 6480464 bisphenol S results in increased expression of IL6ST mRNA CTD PMID:30951980 Il6st Rat 4,4'-sulfonyldiphenol affects methylation ISO RGD:731410 6480464 bisphenol S affects the methylation of IL6ST gene CTD PMID:31683443 Il6st Rat 4,4'-sulfonyldiphenol affects expression ISO RGD:731410 6480464 bisphenol S affects the expression of IL6ST mRNA CTD PMID:39298647 Il6st Rat 4-hydroxynon-2-enal decreases expression ISO RGD:731410 6480464 4-hydroxy-2-nonenal results in decreased expression of IL6ST mRNA CTD PMID:19191707 Il6st Rat 4-hydroxynon-2-enal decreases expression ISO RGD:731409 6480464 4-hydroxy-2-nonenal results in decreased expression of IL6ST mRNA CTD PMID:12419474 Il6st Rat 5-aza-2'-deoxycytidine increases expression ISO RGD:731409 6480464 Decitabine results in increased expression of IL6ST mRNA CTD PMID:19223499 Il6st Rat 5-formyltetrahydrofolic acid multiple interactions ISO RGD:731409 6480464 IL6ST protein affects the reaction [Leucovorin results in increased phosphorylation of STAT3 protein] CTD PMID:25841994 Il6st Rat acetic acid increases expression ISO RGD:731410 6480464 Acetic Acid results in increased expression of IL6ST protein CTD PMID:21296659 Il6st Rat acetylsalicylic acid decreases expression ISO RGD:731409 6480464 Aspirin results in decreased expression of IL6ST mRNA CTD PMID:19595669 Il6st Rat aflatoxin B1 affects expression ISO RGD:731409 6480464 Aflatoxin B1 affects the expression of IL6ST protein CTD PMID:20106945 Il6st Rat aflatoxin B1 decreases methylation ISO RGD:731409 6480464 Aflatoxin B1 results in decreased methylation of IL6ST gene; Aflatoxin B1 results in decreased methylation more ... CTD PMID:27153756|PMID:30157460 Il6st Rat Aflatoxin B2 alpha decreases methylation ISO RGD:731409 6480464 aflatoxin B2 results in decreased methylation of IL6ST intron CTD PMID:30157460 Il6st Rat aflatoxin M1 decreases expression ISO RGD:731409 6480464 Aflatoxin M1 results in decreased expression of IL6ST mRNA CTD PMID:30928695 Il6st Rat aldehydo-D-glucose multiple interactions ISO RGD:731410 6480464 [[[Oxygen deficiency co-treated with Glucose deficiency] co-treated with Oxygen] inhibits the reaction [IL6RA protein binds more ... CTD PMID:21940958 Il6st Rat all-trans-retinoic acid increases expression ISO RGD:731409 6480464 Tretinoin results in increased expression of IL6ST mRNA CTD PMID:21934132|PMID:33167477 Il6st Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of IL6ST mRNA CTD PMID:16483693 Il6st Rat antirheumatic drug increases expression ISO RGD:731409 6480464 Antirheumatic Agents results in increased expression of IL6ST mRNA CTD PMID:24449571 Il6st Rat arsenous acid increases expression ISO RGD:731410 6480464 Arsenic Trioxide results in increased expression of IL6ST mRNA CTD PMID:15073043 Il6st Rat asperentin decreases expression ISO RGD:731410 6480464 cladosporin results in decreased expression of IL6ST mRNA CTD PMID:19818335 Il6st Rat auranofin multiple interactions ISO RGD:731409 6480464 [Auranofin co-treated with IL6 protein] results in decreased phosphorylation of IL6ST protein CTD PMID:20542334 Il6st Rat Azoxymethane multiple interactions ISO RGD:731410 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of IL6ST more ... CTD PMID:29950665 Il6st Rat bazedoxifene affects binding ISO RGD:731409 6480464 bazedoxifene binds to IL6ST protein CTD PMID:24456369 Il6st Rat benzo[a]pyrene decreases expression ISO RGD:731410 6480464 Benzo(a)pyrene results in decreased expression of IL6ST mRNA CTD PMID:19770486 Il6st Rat benzo[a]pyrene affects methylation ISO RGD:731409 6480464 Benzo(a)pyrene affects the methylation of IL6ST 5' UTR; Benzo(a)pyrene affects the methylation of IL6ST intron CTD PMID:27901495|PMID:30157460 Il6st Rat benzo[a]pyrene increases expression ISO RGD:731410 6480464 Benzo(a)pyrene results in increased expression of IL6ST mRNA CTD PMID:22228805 Il6st Rat bis(2-chloroethyl) sulfide increases secretion ISO RGD:731409 6480464 Mustard Gas results in increased secretion of IL6ST protein CTD PMID:33491125 Il6st Rat bisphenol A increases expression ISO RGD:731410 6480464 bisphenol A results in increased expression of IL6ST mRNA CTD PMID:26063408|PMID:30951980 Il6st Rat bisphenol A decreases methylation ISO RGD:731409 6480464 bisphenol A results in decreased methylation of IL6ST gene CTD PMID:31601247|PMID:38338858 Il6st Rat bisphenol A increases expression ISO RGD:731409 6480464 bisphenol A results in increased expression of IL6ST mRNA CTD PMID:29275510 Il6st Rat bisphenol A decreases expression ISO RGD:731409 6480464 bisphenol A results in decreased expression of IL6ST protein CTD PMID:31339859 Il6st Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of IL6ST mRNA CTD PMID:30816183|PMID:32145629|PMID:34947998|PMID:38750585 Il6st Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of IL6ST gene CTD PMID:28505145 Il6st Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of IL6ST mRNA CTD PMID:25181051 Il6st Rat bisphenol F increases expression ISO RGD:731410 6480464 bisphenol F results in increased expression of IL6ST mRNA CTD PMID:30951980|PMID:38685157 Il6st Rat bisphenol F decreases methylation ISO RGD:731409 6480464 bisphenol F results in decreased methylation of IL6ST gene CTD PMID:38338858 Il6st Rat Brevianamide A increases expression ISO RGD:731410 6480464 brevianamide A results in increased expression of IL6ST mRNA CTD PMID:19818335 Il6st Rat bromochloroacetic acid increases expression ISO RGD:731410 6480464 bromochloroacetic acid results in increased expression of IL6ST protein CTD PMID:21296659 Il6st Rat cadmium atom decreases expression ISO RGD:731409 6480464 Cadmium results in decreased expression of IL6ST mRNA CTD PMID:36321828 Il6st Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of IL6ST mRNA CTD PMID:25993096 Il6st Rat cadmium dichloride increases expression ISO RGD:731409 6480464 Cadmium Chloride results in increased expression of IL6ST mRNA CTD PMID:38382870 Il6st Rat caffeine affects phosphorylation ISO RGD:731409 6480464 Caffeine affects the phosphorylation of IL6ST protein CTD PMID:35688186 Il6st Rat calcitriol multiple interactions ISO RGD:731409 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of IL6ST mRNA CTD PMID:21592394 Il6st Rat calcitriol increases expression ISO RGD:731409 6480464 Calcitriol results in increased expression of IL6ST mRNA CTD PMID:21592394 Il6st Rat calcium atom multiple interactions ISO RGD:731410 6480464 IL6ST protein promotes the reaction [IL11 protein results in increased abundance of Calcium] CTD PMID:12110441 Il6st Rat calcium(0) multiple interactions ISO RGD:731410 6480464 IL6ST protein promotes the reaction [IL11 protein results in increased abundance of Calcium] CTD PMID:12110441 Il6st Rat cannabidiol decreases expression ISO RGD:731409 6480464 Cannabidiol results in decreased expression of IL6ST mRNA CTD PMID:27932991|PMID:31801206 Il6st Rat capsaicin decreases expression EXP 6480464 Capsaicin results in decreased expression of IL6ST protein CTD PMID:19285962 Il6st Rat carbon nanotube decreases expression EXP 6480464 Nanotubes, Carbon results in decreased expression of IL6ST protein CTD PMID:26589480 Il6st Rat carbon nanotube multiple interactions ISO RGD:731410 6480464 [Methylcholanthrene co-treated with Nanotubes, Carbon] results in decreased expression of IL6ST mRNA CTD PMID:25926378 Il6st Rat carbon nanotube increases expression ISO RGD:731410 6480464 Nanotubes, Carbon results in increased expression of IL6ST mRNA CTD PMID:25554681|PMID:25620056 Il6st Rat carbon nanotube affects expression EXP 6480464 Nanotubes, Carbon affects the expression of IL6ST mRNA CTD PMID:26589480 Il6st Rat CGP 52608 multiple interactions ISO RGD:731409 6480464 CGP 52608 promotes the reaction [RORA protein binds to IL6ST gene] CTD PMID:28238834 Il6st Rat ciglitazone multiple interactions ISO RGD:731409 6480464 [ciglitazone binds to PPARG protein] which results in increased expression of IL6ST mRNA CTD PMID:16197558 Il6st Rat ciguatoxin CTX1B affects expression ISO RGD:731410 6480464 Ciguatoxins affects the expression of IL6ST mRNA CTD PMID:18353800 Il6st Rat cisplatin decreases expression ISO RGD:731409 6480464 Cisplatin results in decreased expression of IL6ST mRNA CTD PMID:27392435 Il6st Rat cisplatin multiple interactions ISO RGD:731409 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of IL6ST mRNA CTD PMID:27392435 Il6st Rat cobalt dichloride decreases expression ISO RGD:731409 6480464 cobaltous chloride results in decreased expression of IL6ST mRNA CTD PMID:19320972 Il6st Rat copper atom multiple interactions ISO RGD:731409 6480464 [NSC 689534 binds to Copper] which results in increased expression of IL6ST mRNA CTD PMID:20971185 Il6st Rat copper(0) multiple interactions ISO RGD:731409 6480464 [NSC 689534 binds to Copper] which results in increased expression of IL6ST mRNA CTD PMID:20971185 Il6st Rat copper(II) sulfate increases expression ISO RGD:731409 6480464 Copper Sulfate results in increased expression of IL6ST mRNA CTD PMID:19549813 Il6st Rat coumestrol multiple interactions ISO RGD:731409 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of IL6ST mRNA CTD PMID:19167446 Il6st Rat curcumin multiple interactions ISO RGD:731409 6480464 Curcumin inhibits the reaction [Trichloroethylene results in increased expression of IL6ST protein] CTD PMID:34233590 Il6st Rat cycloheximide multiple interactions ISO RGD:731409 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of IL6ST mRNA] CTD PMID:11007951 Il6st Rat cyclosporin A decreases expression ISO RGD:731409 6480464 Cyclosporine results in decreased expression of IL6ST mRNA CTD PMID:25562108 Il6st Rat D-glucose multiple interactions ISO RGD:731410 6480464 [[[Oxygen deficiency co-treated with Glucose deficiency] co-treated with Oxygen] inhibits the reaction [IL6RA protein binds more ... CTD PMID:21940958 Il6st Rat dexamethasone increases expression ISO RGD:731410 6480464 Dexamethasone results in increased expression of IL6ST mRNA CTD PMID:21041162 Il6st Rat dextran sulfate multiple interactions ISO RGD:731410 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of IL6ST more ... CTD PMID:29950665 Il6st Rat diarsenic trioxide increases expression ISO RGD:731410 6480464 Arsenic Trioxide results in increased expression of IL6ST mRNA CTD PMID:15073043 Il6st Rat dicrotophos decreases expression ISO RGD:731409 6480464 dicrotophos results in decreased expression of IL6ST mRNA CTD PMID:28302478 Il6st Rat dioxygen multiple interactions ISO RGD:731410 6480464 [[[Oxygen deficiency co-treated with Glucose deficiency] co-treated with Oxygen] inhibits the reaction [IL6RA protein binds more ... CTD PMID:21940958 Il6st Rat diuron increases expression EXP 6480464 Diuron results in increased expression of IL6ST mRNA CTD PMID:21551480 Il6st Rat dorsomorphin multiple interactions ISO RGD:731409 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Il6st Rat doxorubicin decreases expression ISO RGD:731409 6480464 Doxorubicin results in decreased expression of IL6ST mRNA CTD PMID:29803840 Il6st Rat elemental selenium decreases expression ISO RGD:731409 6480464 Selenium results in decreased expression of IL6ST mRNA CTD PMID:19244175 Il6st Rat ethanol increases expression ISO RGD:731410 6480464 Ethanol results in increased expression of IL6ST mRNA CTD PMID:30319688 Il6st Rat ethanol affects splicing ISO RGD:731410 6480464 Ethanol affects the splicing of IL6ST mRNA CTD PMID:30319688 Il6st Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of IL6ST mRNA CTD PMID:24136188 Il6st Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of IL6ST mRNA CTD PMID:20566332 Il6st Rat folic acid multiple interactions ISO RGD:731409 6480464 IL6ST protein affects the reaction [Folic Acid results in increased phosphorylation of STAT3 protein] CTD PMID:25841994 Il6st Rat folic acid decreases expression ISO RGD:731410 6480464 Folic Acid results in decreased expression of IL6ST mRNA CTD PMID:25629700 Il6st Rat formaldehyde increases expression ISO RGD:731409 6480464 Formaldehyde results in increased expression of IL6ST mRNA CTD PMID:23649840 Il6st Rat FR900359 affects phosphorylation ISO RGD:731409 6480464 FR900359 affects the phosphorylation of IL6ST protein CTD PMID:37730182 Il6st Rat geldanamycin increases expression ISO RGD:731409 6480464 geldanamycin results in increased expression of IL6ST mRNA CTD PMID:26705709 Il6st Rat glucose multiple interactions ISO RGD:731410 6480464 [[[Oxygen deficiency co-treated with Glucose deficiency] co-treated with Oxygen] inhibits the reaction [IL6RA protein binds more ... CTD PMID:21940958 Il6st Rat hexachlorobenzene increases expression EXP 6480464 Hexachlorobenzene results in increased expression of IL6ST mRNA CTD PMID:15159207 Il6st Rat hydrogen peroxide increases secretion ISO RGD:731409 6480464 Hydrogen Peroxide results in increased secretion of IL6ST protein CTD PMID:33491125 Il6st Rat hydrogen peroxide increases expression ISO RGD:731409 6480464 Hydrogen Peroxide results in increased expression of IL6ST mRNA CTD PMID:33491125 Il6st Rat hydroquinone O-beta-D-glucopyranoside decreases expression ISO RGD:731409 6480464 Arbutin results in decreased expression of IL6ST mRNA CTD PMID:17103032 Il6st Rat indometacin decreases expression ISO RGD:731409 6480464 Indomethacin results in decreased expression of IL6ST mRNA CTD PMID:16984733 Il6st Rat kojic acid decreases expression ISO RGD:731409 6480464 kojic acid results in decreased expression of IL6ST mRNA CTD PMID:16595896 Il6st Rat leflunomide increases expression ISO RGD:731409 6480464 leflunomide results in increased expression of IL6ST mRNA CTD PMID:28988120 Il6st Rat lenalidomide decreases expression ISO RGD:731409 6480464 lenalidomide results in decreased expression of IL6ST mRNA CTD PMID:15618473 Il6st Rat lipopolysaccharide increases expression ISO RGD:731410 6480464 Lipopolysaccharides results in increased expression of IL6ST mRNA CTD PMID:15919760 Il6st Rat lipopolysaccharide multiple interactions ISO RGD:731409 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in increased expression of IL6ST mRNA CTD PMID:31059760 Il6st Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of IL6ST mRNA CTD PMID:30467583 Il6st Rat methyl methanesulfonate increases expression ISO RGD:731409 6480464 Methyl Methanesulfonate results in increased expression of IL6ST mRNA CTD PMID:23649840 Il6st Rat methylmercury chloride decreases expression ISO RGD:731409 6480464 methylmercuric chloride results in decreased expression of IL6ST mRNA CTD PMID:28001369 Il6st Rat methylmercury chloride increases expression ISO RGD:731409 6480464 methylmercuric chloride results in increased expression of IL6ST mRNA; methylmercuric chloride results in increased expression more ... CTD PMID:34328791 Il6st Rat mycophenolic acid increases expression ISO RGD:731410 6480464 Mycophenolic Acid results in increased expression of IL6ST mRNA CTD PMID:19818335 Il6st Rat mycotoxin decreases expression ISO RGD:731410 6480464 Mycotoxins results in decreased expression of IL6ST mRNA CTD PMID:19818335 Il6st Rat neoechinulin A increases expression ISO RGD:731410 6480464 neoechinulin A results in increased expression of IL6ST mRNA CTD PMID:19818335 Il6st Rat nickel atom decreases expression ISO RGD:731409 6480464 Nickel results in decreased expression of IL6ST mRNA CTD PMID:25583101 Il6st Rat obeticholic acid decreases expression ISO RGD:731409 6480464 obeticholic acid results in decreased expression of IL6ST mRNA CTD PMID:27939613 Il6st Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of IL6ST mRNA CTD PMID:25729387 Il6st Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of IL6ST mRNA CTD PMID:25729387 Il6st Rat ozone decreases expression ISO RGD:731410 6480464 Ozone results in decreased expression of IL6ST mRNA CTD PMID:17460151 Il6st Rat ozone decreases expression EXP 6480464 Ozone results in decreased expression of IL6ST mRNA CTD PMID:35737395 Il6st Rat paracetamol affects expression ISO RGD:731410 6480464 Acetaminophen affects the expression of IL6ST mRNA CTD PMID:17562736 Il6st Rat paracetamol multiple interactions ISO RGD:731409 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in increased expression of IL6ST mRNA CTD PMID:31059760 Il6st Rat paracetamol increases expression ISO RGD:731409 6480464 Acetaminophen results in increased expression of IL6ST mRNA CTD PMID:27761495|PMID:31059760 Il6st Rat paracetamol decreases expression ISO RGD:731409 6480464 Acetaminophen results in decreased expression of IL6ST mRNA CTD PMID:22230336|PMID:27761495 Il6st Rat paracetamol increases expression ISO RGD:731410 6480464 Acetaminophen results in increased expression of IL6ST mRNA CTD PMID:19420014 Il6st Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of IL6ST mRNA CTD PMID:32680482 Il6st Rat perfluorooctane-1-sulfonic acid decreases expression ISO RGD:731409 6480464 perfluorooctane sulfonic acid results in decreased expression of IL6ST mRNA CTD PMID:27153767 Il6st Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:731410 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of IL6ST mRNA; [perfluorooctane sulfonic more ... CTD PMID:36331819 Il6st Rat perfluorooctanoic acid increases expression ISO RGD:731409 6480464 perfluorooctanoic acid results in increased expression of IL6ST mRNA CTD PMID:36326898 Il6st Rat phenobarbital affects expression ISO RGD:731410 6480464 Phenobarbital affects the expression of IL6ST mRNA CTD PMID:23091169 Il6st Rat phenylmercury acetate increases expression ISO RGD:731409 6480464 Phenylmercuric Acetate results in increased expression of IL6ST mRNA CTD PMID:26272509 Il6st Rat phenylmercury acetate multiple interactions ISO RGD:731409 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Il6st Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in increased expression of IL6ST mRNA; 2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in increased expression of IL6ST more ... CTD PMID:12606953 Il6st Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of IL6ST mRNA CTD PMID:19162173 Il6st Rat progesterone multiple interactions ISO RGD:731409 6480464 [Progesterone co-treated with Estradiol] results in increased expression of IL6ST mRNA CTD PMID:17404688 Il6st Rat quercetin multiple interactions ISO RGD:731409 6480464 Quercetin inhibits the reaction [IL6 protein results in increased phosphorylation of IL6ST protein] CTD PMID:22394507 Il6st Rat quercetin decreases expression ISO RGD:731409 6480464 Quercetin results in decreased expression of IL6ST mRNA CTD PMID:21632981 Il6st Rat quinolin-8-ol decreases expression ISO RGD:731409 6480464 Oxyquinoline results in decreased expression of IL6ST mRNA CTD PMID:21632981 Il6st Rat raloxifene affects binding ISO RGD:731409 6480464 Raloxifene Hydrochloride binds to IL6ST protein CTD PMID:24456369|PMID:32940862 Il6st Rat resveratrol multiple interactions ISO RGD:731409 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of IL6ST mRNA CTD PMID:19167446 Il6st Rat SB 431542 multiple interactions ISO RGD:731409 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Il6st Rat selenium atom decreases expression ISO RGD:731409 6480464 Selenium results in decreased expression of IL6ST mRNA CTD PMID:19244175 Il6st Rat senecionine decreases expression ISO RGD:731410 6480464 senecionine results in decreased expression of IL6ST protein CTD PMID:35357534 Il6st Rat serpentine asbestos increases expression ISO RGD:731410 6480464 Asbestos, Serpentine results in increased expression of IL6ST mRNA CTD PMID:16251409 Il6st Rat sodium arsenate decreases expression ISO RGD:731410 6480464 sodium arsenate results in decreased expression of IL6ST mRNA CTD PMID:21795629 Il6st Rat sodium arsenate increases expression ISO RGD:731410 6480464 sodium arsenate results in increased expression of IL6ST mRNA CTD PMID:21795629 Il6st Rat sodium arsenite multiple interactions ISO RGD:731409 6480464 sodium arsenite inhibits the reaction [IL6 protein results in increased phosphorylation of IL6ST protein] CTD PMID:15116095 Il6st Rat sodium arsenite increases expression ISO RGD:731409 6480464 sodium arsenite results in increased expression of IL6ST mRNA CTD PMID:38568856 Il6st Rat sodium arsenite decreases expression ISO RGD:731410 6480464 sodium arsenite results in decreased expression of IL6ST mRNA CTD PMID:28370166 Il6st Rat sodium arsenite decreases expression ISO RGD:731409 6480464 sodium arsenite results in decreased expression of IL6ST mRNA CTD PMID:22714537|PMID:28595984|PMID:34032870 Il6st Rat Soman increases expression EXP 6480464 Soman results in increased expression of IL6ST mRNA CTD PMID:19281266 Il6st Rat sterigmatocystin decreases expression ISO RGD:731410 6480464 Sterigmatocystin results in decreased expression of IL6ST mRNA CTD PMID:19818335 Il6st Rat streptozocin affects expression ISO RGD:731410 6480464 Streptozocin affects the expression of IL6ST mRNA CTD PMID:26073000 Il6st Rat succimer multiple interactions ISO RGD:731410 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of IL6ST mRNA CTD PMID:21641980 Il6st Rat sunitinib decreases expression ISO RGD:731409 6480464 Sunitinib results in decreased expression of IL6ST mRNA CTD PMID:31533062 Il6st Rat tert-butyl hydroperoxide decreases expression ISO RGD:731409 6480464 tert-Butylhydroperoxide results in decreased expression of IL6ST mRNA CTD PMID:12419474 Il6st Rat testosterone multiple interactions ISO RGD:731409 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of IL6ST mRNA CTD PMID:21592394 Il6st Rat testosterone increases expression ISO RGD:731409 6480464 Testosterone results in increased expression of IL6ST mRNA CTD PMID:21592394 Il6st Rat testosterone enanthate affects expression ISO RGD:731409 6480464 testosterone enanthate affects the expression of IL6ST mRNA CTD PMID:17440010 Il6st Rat tetrachloromethane multiple interactions ISO RGD:731410 6480464 IL6ST protein affects the reaction [Carbon Tetrachloride results in increased activity of STAT3 protein] CTD PMID:12830005 Il6st Rat thalidomide decreases expression ISO RGD:731409 6480464 Thalidomide results in decreased expression of IL6ST mRNA CTD PMID:15618473 Il6st Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of IL6ST protein CTD PMID:19285962 Il6st Rat theophylline increases expression ISO RGD:731409 6480464 Theophylline results in increased expression of IL6ST mRNA CTD PMID:16083514 Il6st Rat thiram increases expression ISO RGD:731409 6480464 Thiram results in increased expression of IL6ST mRNA CTD PMID:38568856 Il6st Rat titanium dioxide multiple interactions ISO RGD:731410 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of IL6ST more ... CTD PMID:29950665 Il6st Rat titanium dioxide increases methylation ISO RGD:731410 6480464 titanium dioxide results in increased methylation of IL6ST gene CTD PMID:35295148 Il6st Rat TMC-120A decreases expression ISO RGD:731410 6480464 TMC 120A results in decreased expression of IL6ST mRNA CTD PMID:19818335 Il6st Rat TMC-120A increases expression ISO RGD:731410 6480464 TMC 120A results in increased expression of IL6ST mRNA CTD PMID:19818335 Il6st Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of IL6ST mRNA CTD PMID:25729387 Il6st Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of IL6ST mRNA CTD PMID:25729387 Il6st Rat torcetrapib increases expression ISO RGD:731409 6480464 torcetrapib results in increased expression of IL6ST mRNA CTD PMID:23228038 Il6st Rat trichloroethene affects expression ISO RGD:731410 6480464 Trichloroethylene affects the expression of IL6ST mRNA CTD PMID:25026505 Il6st Rat trichloroethene increases expression ISO RGD:731409 6480464 Trichloroethylene results in increased expression of IL6ST protein CTD PMID:34233590 Il6st Rat trichloroethene multiple interactions ISO RGD:731409 6480464 Curcumin inhibits the reaction [Trichloroethylene results in increased expression of IL6ST protein] CTD PMID:34233590 Il6st Rat trichloroethene increases expression ISO RGD:731410 6480464 Trichloroethylene results in increased expression of IL6ST mRNA CTD PMID:29669109 Il6st Rat trichloroethene multiple interactions ISO RGD:731410 6480464 Trichloroethylene promotes the reaction [Dietary Fats results in increased expression of IL6ST mRNA] CTD PMID:29669109 Il6st Rat trichostatin A increases expression ISO RGD:731409 6480464 trichostatin A results in increased expression of IL6ST mRNA CTD PMID:19223499 Il6st Rat trimethyltin increases expression ISO RGD:731410 6480464 trimethyltin results in increased expression of IL6ST mRNA CTD PMID:20833246 Il6st Rat triphenyl phosphate affects expression ISO RGD:731409 6480464 triphenyl phosphate affects the expression of IL6ST mRNA CTD PMID:37042841 Il6st Rat vancomycin decreases expression ISO RGD:731410 6480464 Vancomycin results in decreased expression of IL6ST mRNA CTD PMID:18930951 Il6st Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of IL6ST mRNA CTD PMID:19015723 Il6st Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of IL6ST mRNA CTD PMID:18629315 Il6st Rat zinc atom multiple interactions ISO RGD:731409 6480464 Zinc inhibits the reaction [TNF protein results in increased secretion of IL6ST protein] CTD PMID:16606632 Il6st Rat zinc sulfate multiple interactions ISO RGD:731409 6480464 Zinc Sulfate inhibits the reaction [TNF protein results in increased secretion of IL6ST protein] CTD PMID:16606632 Il6st Rat zinc sulfate decreases expression ISO RGD:731409 6480464 Zinc Sulfate results in decreased expression of IL6ST mRNA CTD PMID:16330358 Il6st Rat zinc(0) multiple interactions ISO RGD:731409 6480464 Zinc inhibits the reaction [TNF protein results in increased secretion of IL6ST protein] CTD PMID:16606632
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Il6st Rat ciliary neurotrophic factor receptor activity enables ISO RGD:731409 1624291 PMID:12643274 RGD PMID:12643274 Il6st Rat ciliary neurotrophic factor receptor activity enables IEA UniProtKB:P40189|ensembl:ENSP00000370698 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Il6st Rat ciliary neurotrophic factor receptor binding enables IEA UniProtKB:P40189|ensembl:ENSP00000370698 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Il6st Rat ciliary neurotrophic factor receptor binding enables ISO RGD:731409 1624291 UniProtKB:P26992 PMID:12707266 RGD PMID:12707266 Il6st Rat coreceptor activity enables ISO RGD:731409 1624291 PMID:8637716 RGD PMID:8637716 Il6st Rat coreceptor activity enables IEA UniProtKB:P40189|ensembl:ENSP00000370698 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Il6st Rat cytokine binding enables IBA MGI:105304|MGI:107426|MGI:1330819|MGI:2180511|MGI:96551|MGI:96560|PANTHER:PTN002745476|RGD:1303100|RGD:621431|UniProtKB:O75462|UniProtKB:P08887|UniProtKB:P26992|UniProtKB:P40189|UniProtKB:P42701|UniProtKB:Q5VWK5 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Il6st Rat cytokine receptor activity enables IEA InterPro:IPR003529 1600115 GO_REF:0000002 InterPro GO_REF:0000002 Il6st Rat cytokine receptor activity enables IBA MGI:104993|MGI:105304|MGI:107426|MGI:1330819|MGI:95708|MGI:96560|MGI:97763|MGI:99605|PANTHER:PTN002745476|RGD:1303100|RGD:2322532|RGD:2687|RGD:3407|RGD:621431|UniProtKB:P08887|UniProtKB:P10912|UniProtKB:P16471|UniProtKB:P26951|UniProtKB:P26992|UniProtKB:P31785|UniProtKB:P40189|UniProtKB:P42701|UniProtKB:P42702|UniProtKB:P48357|UniProtKB:Q01344|UniProtKB:Q14626|UniProtKB:Q14627|UniProtKB:Q5VWK5|UniProtKB:Q99650|UniProtKB:Q9HC73 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Il6st Rat growth factor binding contributes_to ISO RGD:731409 1624291 UniProtKB:P15018 PMID:8999038 RGD PMID:8999038 Il6st Rat growth factor binding enables IEA UniProtKB:P40189|ensembl:ENSP00000370698 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Il6st Rat growth factor binding enables ISO RGD:731409 1624291 UniProtKB:P13725 PMID:8999038 RGD PMID:8999038 Il6st Rat identical protein binding enables IEA UniProtKB:P40189|ensembl:ENSP00000370698 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Il6st Rat identical protein binding enables ISO RGD:731409 1624291 UniProtKB:P40189 PMID:24501689 RGD PMID:24501689 Il6st Rat interleukin-11 binding contributes_to ISO RGD:731410 1624291 PMID:7957045 RGD PMID:7957045 Il6st Rat interleukin-11 receptor activity contributes_to ISO RGD:731410 1624291 PMID:7957045 RGD PMID:7957045 Il6st Rat interleukin-27 receptor activity enables ISO RGD:731409 1624291 PMID:14764690 RGD PMID:14764690 Il6st Rat interleukin-27 receptor activity enables IEA UniProtKB:P40189|ensembl:ENSP00000370698 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Il6st Rat interleukin-6 binding contributes_to ISO RGD:731409 1624291 UniProtKB:P05231 PMID:12829785 RGD PMID:12829785 Il6st Rat interleukin-6 binding contributes_to IEA UniProtKB:P40189|ensembl:ENSP00000370698 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Il6st Rat interleukin-6 binding contributes_to IBA PANTHER:PTN008588113|UniProtKB:P40189 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Il6st Rat interleukin-6 receptor activity contributes_to ISO RGD:731409 1624291 PMID:12643274, PMID:2261637 RGD PMID:12643274|PMID:2261637 Il6st Rat interleukin-6 receptor activity contributes_to IEA UniProtKB:P40189|ensembl:ENSP00000370698 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Il6st Rat interleukin-6 receptor activity contributes_to IBA PANTHER:PTN008588113|UniProtKB:P40189 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Il6st Rat interleukin-6 receptor binding contributes_to ISO RGD:731409 1624291 UniProtKB:P08887 PMID:12829785 RGD PMID:12829785 Il6st Rat interleukin-6 receptor binding contributes_to IEA UniProtKB:P40189|ensembl:ENSP00000370698 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Il6st Rat leukemia inhibitory factor receptor activity contributes_to ISO RGD:731409 1624291 PMID:12643274, PMID:8999038 RGD PMID:12643274|PMID:8999038 Il6st Rat leukemia inhibitory factor receptor activity contributes_to IEA UniProtKB:P40189|ensembl:ENSP00000370698 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Il6st Rat oncostatin-M receptor activity contributes_to ISO RGD:731409 1624291 PMID:8999038 RGD PMID:8999038 Il6st Rat oncostatin-M receptor activity contributes_to IEA UniProtKB:P40189|ensembl:ENSP00000370698 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Il6st Rat protein binding enables ISO RGD:731409 1624291 UniProtKB:O43765|UniProtKB:P07947|UniProtKB:P12931|UniProtKB:P13725|UniProtKB:P15018|UniProtKB:P26441|UniProtKB:P42227|UniProtKB:P43364|UniProtKB:P43364-2|UniProtKB:Q2HRC7|UniProtKB:Q96EQ0|UniProtKB:Q99650|UniProtKB:Q9NZI2-2|UniProtKB:Q9ULZ3|UniProtKB:Q9UMX0|UniProtKB:Q9UMX0-2|UniProtKB:Q9Y2W7 PMID:10982829, PMID:11238858, PMID:14527405, PMID:16051226, PMID:18775332, PMID:24407287, PMID:24501689, PMID:25416956, PMID:25731159, PMID:28514442, PMID:29892012, PMID:32296183, PMID:33961781, more ... RGD PMID:10982829|PMID:11238858|PMID:14527405|PMID:16051226|PMID:18775332|PMID:24407287|PMID:24501689|PMID:25416956|PMID:25731159|PMID:28514442|PMID:29892012|PMID:32296183|PMID:33961781|PMID:8662591|PMID:8999038 Il6st Rat protein binding enables ISO RGD:731410 1624291 PR:P42703|UniProtKB:O35718 PMID:16452727, PMID:16905102, PMID:23454976 RGD PMID:16452727|PMID:16905102|PMID:23454976 Il6st Rat protein binding enables ISO RGD:731409,UniProtKB:P40189-1 1624291 UniProtKB:P23458 PMID:21220115 RGD PMID:21220115 Il6st Rat protein tyrosine kinase activator activity enables ISO RGD:731409,UniProtKB:P40189-2 1624291 PMID:19915009 RGD PMID:19915009 Il6st Rat protein tyrosine kinase activator activity enables IEA UniProtKB:P40189|ensembl:ENSP00000370698 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Il6st Rat protein tyrosine kinase activator activity enables ISO RGD:731409 1624291 PMID:12829785 RGD PMID:12829785 Il6st Rat scaffold protein binding enables ISO RGD:731409 1624291 UniProtKB:P40763 PMID:31145836 RGD PMID:31145836 Il6st Rat scaffold protein binding enables IEA UniProtKB:P40189|ensembl:ENSP00000370698 1600115 GO_REF:0000107 Ensembl GO_REF:0000107
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine (EXP) 1-octadec-9-enoylglycero-3-phosphate (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,5-diethoxycarbonyl-1,4-dihydrocollidine (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 5-aza-2'-deoxycytidine (ISO) 5-formyltetrahydrofolic acid (ISO) acetic acid (ISO) acetylsalicylic acid (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) aflatoxin M1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) arsenous acid (ISO) asperentin (ISO) auranofin (ISO) Azoxymethane (ISO) bazedoxifene (ISO) benzo[a]pyrene (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) Brevianamide A (ISO) bromochloroacetic acid (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) calcitriol (ISO) calcium atom (ISO) calcium(0) (ISO) cannabidiol (ISO) capsaicin (EXP) carbon nanotube (EXP,ISO) CGP 52608 (ISO) ciglitazone (ISO) ciguatoxin CTX1B (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) coumestrol (ISO) curcumin (ISO) cycloheximide (ISO) cyclosporin A (ISO) D-glucose (ISO) dexamethasone (ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) dicrotophos (ISO) dioxygen (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) ethanol (ISO) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) FR900359 (ISO) geldanamycin (ISO) glucose (ISO) hexachlorobenzene (EXP) hydrogen peroxide (ISO) hydroquinone O-beta-D-glucopyranoside (ISO) indometacin (ISO) kojic acid (ISO) leflunomide (ISO) lenalidomide (ISO) lipopolysaccharide (ISO) methapyrilene (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) mycophenolic acid (ISO) mycotoxin (ISO) neoechinulin A (ISO) nickel atom (ISO) obeticholic acid (ISO) oxaliplatin (EXP) ozone (EXP,ISO) paracetamol (ISO) paraquat (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) PhIP (EXP) pirinixic acid (EXP) progesterone (ISO) quercetin (ISO) quinolin-8-ol (ISO) raloxifene (ISO) resveratrol (ISO) SB 431542 (ISO) selenium atom (ISO) senecionine (ISO) serpentine asbestos (ISO) sodium arsenate (ISO) sodium arsenite (ISO) Soman (EXP) sterigmatocystin (ISO) streptozocin (ISO) succimer (ISO) sunitinib (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) testosterone enanthate (ISO) tetrachloromethane (ISO) thalidomide (ISO) thapsigargin (EXP) theophylline (ISO) thiram (ISO) titanium dioxide (ISO) TMC-120A (ISO) topotecan (EXP) torcetrapib (ISO) trichloroethene (ISO) trichostatin A (ISO) trimethyltin (ISO) triphenyl phosphate (ISO) vancomycin (ISO) vinclozolin (EXP) zinc atom (ISO) zinc sulfate (ISO) zinc(0) (ISO)
Biological Process
cell surface receptor signaling pathway via STAT (IEA,ISO) ciliary neurotrophic factor-mediated signaling pathway (IEA,ISO) cytokine-mediated signaling pathway (IBA,IEA,ISO) glycogen metabolic process (ISO) interleukin-11-mediated signaling pathway (IEA,ISO) interleukin-27-mediated signaling pathway (IEA,ISO) interleukin-6-mediated signaling pathway (IEA,IMP,ISO) intestinal epithelial cell development (IEA,ISO) leukemia inhibitory factor signaling pathway (IEA,ISO) negative regulation of cytosolic calcium ion concentration (IMP) negative regulation of interleukin-6-mediated signaling pathway (ISO) negative regulation of neuron apoptotic process (IEA,ISO) oncostatin-M-mediated signaling pathway (IEA,ISO) positive regulation of adaptive immune response (IEA,ISO) positive regulation of astrocyte differentiation (ISO) positive regulation of cell population proliferation (IBA,IEA,ISO) positive regulation of Notch signaling pathway (IEA,ISO) positive regulation of osteoblast differentiation (IEA,ISO) positive regulation of smooth muscle cell migration (IMP) positive regulation of T cell proliferation (IEA,ISO) regulation of Notch signaling pathway (ISO) response to cytokine (IEA,ISO) response to nutrient (IEP) signal transduction (ISO) triglyceride mobilization (IMP)
Molecular Function
ciliary neurotrophic factor receptor activity (IEA,ISO) ciliary neurotrophic factor receptor binding (IEA,ISO) coreceptor activity (IEA,ISO) cytokine binding (IBA) cytokine receptor activity (IBA,IEA) growth factor binding (IEA,ISO) identical protein binding (IEA,ISO) interleukin-11 binding (ISO) interleukin-11 receptor activity (ISO) interleukin-27 receptor activity (IEA,ISO) interleukin-6 binding (IBA,IEA,ISO) interleukin-6 receptor activity (IBA,IEA,ISO) interleukin-6 receptor binding (IEA,ISO) leukemia inhibitory factor receptor activity (IEA,ISO) oncostatin-M receptor activity (IEA,ISO) protein binding (ISO) protein tyrosine kinase activator activity (IEA,ISO) scaffold protein binding (IEA,ISO)
1.
Differential effects of locally and systemically administered soluble glycoprotein 130 on pain and inflammation in experimental arthritis.
Boettger MK, etal., Arthritis Res Ther. 2010;12(4):R140. Epub 2010 Jul 13.
2.
Reduced expression of the cytokine transducer gp130 inhibits hormone secretion, cell growth, and tumor development of pituitary lactosomatotrophic GH3 cells.
Castro CP, etal., Endocrinology 2003 Feb;144(2):693-700.
3.
Upregulation of gp130 and differential activation of STAT and p42/44 MAPK in the rat hippocampus following kainic acid-induced seizures.
Choi JS, etal., Brain Res Mol Brain Res. 2003 Nov 6;119(1):10-8.
4.
Upregulation of gp130 and STAT3 activation in the rat hippocampus following transient forebrain ischemia.
Choi JS, etal., Glia 2003 Feb;41(3):237-46.
5.
Role of interleukin-6 in chronic muscle hyperalgesic priming.
Dina OA, etal., Neuroscience. 2008 Mar 18;152(2):521-5. Epub 2008 Jan 12.
6.
Association of polymorphisms in the interleukin 6 receptor complex with obesity and hyperandrogenism.
Escobar-Morreale HF, etal., Obes Res. 2003 Aug;11(8):987-96.
7.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
9.
Involvement of the gp130 cytokine transducer in MtT/S pituitary somatotroph tumour development in an autocrine-paracrine model.
Graciarena M, etal., Eur J Endocrinol. 2004 Nov;151(5):595-604.
10.
Discriminant power of combined cerebrospinal fluid tau protein and of the soluble interleukin-6 receptor complex in the diagnosis of Alzheimer's disease.
Hampel H, etal., Brain Res. 1999 Mar 27;823(1-2):104-12.
11.
Loss of a gp130 cardiac muscle cell survival pathway is a critical event in the onset of heart failure during biomechanical stress.
Hirota H, etal., Cell 1999 Apr 16;97(2):189-98.
12.
Therapeutic strategies for the clinical blockade of IL-6/gp130 signaling.
Jones SA, etal., J Clin Invest. 2011 Sep 1;121(9):3375-83. doi: 10.1172/JCI57158. Epub 2011 Sep 1.
13.
Ischemic preconditioning-induced expression of gp130 and STAT3 in astrocytes of the rat hippocampus.
Kim SY, etal., Brain Res Mol Brain Res. 2004 Oct 22;129(1-2):96-103.
14.
Evidence that IL-6-type cytokine signaling in cardiomyocytes is inhibited by oxidative stress: parthenolide targets JAK1 activation by generating ROS.
Kurdi M and Booz GW, J Cell Physiol. 2007 Aug;212(2):424-31.
15.
[Determination of serum soluble interleukin-6 receptor and soluble gp130 levels in patient with pregnancy induced hypertension and its significance]
Li Y, etal., Zhonghua Fu Chan Ke Za Zhi. 2001 Jan;36(1):18-9.
16.
Effects of protein malnutrition on IL-6-mediated signaling in the liver and the systemic acute-phase response in rats.
Ling PR, etal., Am J Physiol Regul Integr Comp Physiol. 2004 Oct;287(4):R801-8.
17.
Signal transducer of inflammation gp130 modulates atherosclerosis in mice and man.
Luchtefeld M, etal., J Exp Med. 2007 Aug 6;204(8):1935-44. Epub 2007 Jul 30.
18.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
19.
IL-6/IL-6 receptor system and its role in physiological and pathological conditions.
Mihara M, etal., Clin Sci (Lond). 2012 Feb;122(4):143-59. doi: 10.1042/CS20110340.
20.
Interleukin-6 inhibits cell proliferation in a rat model of hepatocellular carcinoma.
Moran DM, etal., Liver Int. 2005 Apr;25(2):445-57.
21.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
22.
LIF and CNTF, which share the gp130 transduction system, stimulate hepatic lipid metabolism in rats.
Nonogaki K, etal., Am J Physiol. 1996 Sep;271(3 Pt 1):E521-8.
23.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
24.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
25.
GOA pipeline
RGD automated data pipeline
26.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
27.
Comprehensive gene review and curation
RGD comprehensive gene curation
28.
Spatiotemporal distribution of gp130 cytokines and their receptors after status epilepticus: comparison with neuronal degeneration and microglial activation.
Rosell DR, etal., Neuroscience. 2003;122(2):329-48.
29.
Reciprocal regulation of gastrointestinal homeostasis by SHP2 and STAT-mediated trefoil gene activation in gp130 mutant mice.
Tebbutt NC, etal., Nat Med 2002 Oct;8(10):1089-97.
30.
Preconditioning-induced protection of photoreceptors requires activation of the signal-transducing receptor gp130 in photoreceptors.
Ueki Y, etal., Proc Natl Acad Sci U S A. 2009 Dec 15;106(50):21389-94. doi: 10.1073/pnas.0906156106. Epub 2009 Nov 30.
31.
An essential role for gp130 in neointima formation following arterial injury.
Wang D, etal., Circ Res. 2007 Mar 30;100(6):807-16. Epub 2007 Feb 22.
32.
Interleukin-6 protects cerebellar granule neurons from NMDA-induced neurotoxicity.
Wang XC, etal., Sheng Li Xue Bao. 2007 Apr 25;59(2):150-156.
33.
Molecular cloning and characterization of the rat liver IL-6 signal transducing molecule, gp130.
Wang Y, etal., Genomics 1992 Nov;14(3):666-72.
34.
Characteristic localization of gp130 (the signal-transducing receptor component used in common for IL-6/IL-11/CNTF/LIF/OSM) in the rat brain.
Watanabe D, etal., Eur J Neurosci. 1996 Aug;8(8):1630-40.
Il6st Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 45,798,872 - 45,839,501 (+) NCBI GRCr8 mRatBN7.2 2 44,065,979 - 44,106,255 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 44,066,130 - 44,109,936 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 51,196,571 - 51,225,818 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 49,255,007 - 49,284,254 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 44,122,946 - 44,152,152 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 44,279,199 - 44,319,427 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 44,289,393 - 44,314,944 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 63,320,957 - 63,361,404 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 43,806,301 - 43,842,365 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 43,736,911 - 43,762,480 (+) NCBI Celera 2 39,857,022 - 39,886,283 (+) NCBI Celera Cytogenetic Map 2 q14 NCBI
IL6ST Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 55,935,095 - 55,994,963 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 55,935,095 - 55,995,022 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 55,230,923 - 55,290,791 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 55,272,451 - 55,326,520 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 55,272,451 - 55,326,520 NCBI Celera 5 52,184,738 - 52,244,652 (-) NCBI Celera Cytogenetic Map 5 q11.2 NCBI HuRef 5 52,204,630 - 52,264,547 (-) NCBI HuRef CHM1_1 5 55,234,877 - 55,294,748 (-) NCBI CHM1_1 T2T-CHM13v2.0 5 56,763,505 - 56,823,387 (-) NCBI T2T-CHM13v2.0
Il6st Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 112,600,604 - 112,643,394 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 112,600,604 - 112,646,620 (+) Ensembl GRCm39 Ensembl GRCm38 13 112,464,070 - 112,506,860 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 112,464,070 - 112,510,086 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 113,254,278 - 113,297,068 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 113,584,987 - 113,627,719 (+) NCBI MGSCv36 mm8 Celera 13 116,768,393 - 116,811,051 (+) NCBI Celera Cytogenetic Map 13 D2.2 NCBI cM Map 13 63.73 NCBI
Il6st Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955446 11,790,444 - 11,835,001 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955446 11,790,636 - 11,837,734 (+) NCBI ChiLan1.0 ChiLan1.0
IL6ST Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 57,932,421 - 57,993,400 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 56,088,793 - 56,147,032 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 58,023,704 - 58,081,895 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 59,650,833 - 59,708,817 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 59,669,606 - 59,708,817 (+) Ensembl panpan1.1 panPan2
IL6ST Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 43,214,050 - 43,273,014 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 43,214,050 - 43,248,124 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 40,260,413 - 40,306,615 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 43,679,923 - 43,738,936 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 43,679,928 - 43,738,942 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 40,758,131 - 40,804,315 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 41,560,510 - 41,606,926 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 42,380,727 - 42,426,940 (-) NCBI UU_Cfam_GSD_1.0
Il6st Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 202,931,083 - 202,977,366 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936480 11,884,582 - 11,909,635 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936480 11,867,573 - 11,913,563 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
IL6ST Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 16 35,101,306 - 35,192,220 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 16 35,101,304 - 35,151,832 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 16 37,476,140 - 37,522,638 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
IL6ST Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 4 52,174,893 - 52,232,475 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 4 52,174,312 - 52,214,584 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666049 1,050,897 - 1,108,503 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Il6st
.
Assembly: Rnor_6.0
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
2
44314661
44314662
T
A
snv
WKY/N (MCW) View more Information
Predicted Target Of
Count of predictions: 569 Count of miRNA genes: 281 Interacting mature miRNAs: 371 Transcripts: ENSRNOT00000018877 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
10755430 Coatc6 Coat color QTL 6 0.02576 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 11591100 56591100 Rat 2293671 Bss44 Bone structure and strength QTL 44 10.97 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 2 43162366 148478373 Rat 7387318 Stl32 Serum triglyceride level QTL 32 3.2 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 22384627 67384627 Rat 10755436 Coatc8 Coat color QTL 8 0.02431 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 35023117 80023117 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 10755434 Coatc7 Coat color QTL 7 0.04794 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 2 30648065 75648065 Rat 2293676 Bmd19 Bone mineral density QTL 19 10.7 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 43162366 111362592 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 2293682 Bmd24 Bone mineral density QTL 24 8.9 0.0001 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 2 43162366 111362592 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300160 Hrtrt3 Heart rate QTL 3 3.62 heart pumping trait (VT:2000009) absolute change in heart rate (CMO:0000534) 2 29971593 51729300 Rat 731167 Glom4 Glomerulus QTL 4 2.4 0.0082 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 2 20304672 65304672 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 152025242 Bw191 Body weight QTL 191 3.62 body mass (VT:0001259) 2 38573329 122609194 Rat 738012 Anxrr3 Anxiety related response QTL 3 3.8 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 2 9023519 54023519 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 9685065 Swd6 Spike wave discharge measurement QTL 6 5.8 0.01 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge rate (CMO:0001739) 2 39223937 48793699 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 10402051 Gdil2 Gastrointestinal dilation QTL 2 enteric ganglion morphology trait (VT:0001045) length of intestine affected by colonic aganglionosis to total length of colon ratio (CMO:0001836) 2 24903853 74786777 Rat 9590095 Sffal3 Serum free fatty acids level QTL 3 6.78 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 2 27157160 72157160 Rat 70174 BpQTLCluster2 Blood pressure QTL cluster 2 4.24 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 2 40067944 102785628 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 631208 Bw1 Body weight QTL1 5.09 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 2 43171017 83575226 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1643006 Pain1 Pain QTL 1 3.63 0.005 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 2 26999571 48268661 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1300155 Bp174 Blood pressure QTL 174 4.09 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 2 42804607 60653831 Rat 2293835 Kiddil5 Kidney dilation QTL 5 3.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 157142209 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 61355 Bp36 Blood pressure QTL 36 2.9 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 2 5873687 102844969 Rat 2300168 Bmd47 Bone mineral density QTL 47 6.6 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 2 20662448 65662448 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1354617 Bp240 Blood pressure QTL 240 4 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 81754745 Rat 1578664 Bmd9 Bone mineral QTL density 9 5 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 2 11852062 49003364 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 1357990 Ael1 Aortic elastin QTL 1 3.1 0.00091 aorta elastin amount (VT:0003905) aortic elastin 2 19076825 64076825 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 12879863 Bp402 Blood pressure QTL 402 0.003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 41125789 56532139 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 2290453 Scl55 Serum cholesterol level QTL 55 2.83 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 26917817 136917119 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 731184 Mamtr4 Mammary tumor resistance QTL 4 0.0003 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 2 16491740 61491740 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 61371 Edpm1 Estrogen-dependent pituitary mass QTL 1 4 0.05 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 35134841 88029593 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat 1354603 Bp243 Blood pressure QTL 243 3.9 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 26917817 127469484 Rat
AI171807
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 44,103,374 - 44,103,597 (+) MAPPER mRatBN7.2 Rnor_6.0 2 44,316,547 - 44,316,769 NCBI Rnor6.0 Rnor_5.0 2 63,358,524 - 63,358,746 UniSTS Rnor5.0 RGSC_v3.4 2 43,835,804 - 43,836,026 UniSTS RGSC3.4 Celera 2 39,883,403 - 39,883,625 UniSTS RH 3.4 Map 2 278.9 UniSTS Cytogenetic Map 2 q14-q16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000018877 ⟹ ENSRNOP00000018877
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 44,079,652 - 44,109,936 (+) Ensembl Rnor_6.0 Ensembl 2 44,289,393 - 44,314,944 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000105192 ⟹ ENSRNOP00000077391
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 44,066,141 - 44,103,846 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000106583 ⟹ ENSRNOP00000083772
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 44,066,141 - 44,103,846 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000109781 ⟹ ENSRNOP00000090692
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 44,076,423 - 44,106,255 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000111915 ⟹ ENSRNOP00000097802
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 44,074,604 - 44,109,936 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000113764 ⟹ ENSRNOP00000086828
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 44,066,164 - 44,102,036 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114610 ⟹ ENSRNOP00000081709
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 44,066,130 - 44,091,441 (+) Ensembl
RefSeq Acc Id:
NM_001008725 ⟹ NP_001008725
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 45,810,232 - 45,839,501 (+) NCBI mRatBN7.2 2 44,076,984 - 44,106,255 (+) NCBI Rnor_6.0 2 44,290,075 - 44,319,427 (+) NCBI Rnor_5.0 2 63,320,957 - 63,361,404 (+) NCBI RGSC_v3.4 2 43,806,301 - 43,842,365 (+) RGD Celera 2 39,857,022 - 39,886,283 (+) NCBI
Sequence:
GAGCATCCCTTGCAAGATGTCCGCACTAAGGATCTGGCTAATGCAAGCTTTGCTTATTTTCCTCACTACTGAGTCTATAGGTCAACTTGTGGAACCATGTGGTTATATCTACCCTGAGTTTCCAGTTG
hide sequence
RefSeq Acc Id:
XM_006231928 ⟹ XP_006231990
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 45,798,872 - 45,837,095 (+) NCBI mRatBN7.2 2 44,065,979 - 44,106,253 (+) NCBI Rnor_6.0 2 44,279,199 - 44,319,425 (+) NCBI Rnor_5.0 2 63,320,957 - 63,361,404 (+) NCBI
Sequence:
TGGGGTGGAGCTAGGAGAGCCCAGGTCAGCGGCGGACGGAGGGTGGCGTGTGCGGTCAGGAGGC
hide sequence
RefSeq Acc Id:
XM_008760736 ⟹ XP_008758958
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 45,800,775 - 45,837,095 (+) NCBI mRatBN7.2 2 44,069,544 - 44,103,854 (+) NCBI Rnor_6.0 2 44,281,697 - 44,317,935 (+) NCBI
Sequence:
CCCTGGGTTCAACCTTCATCACTGCATACATGCACATATTCTGTCAGTAGCACTTAACTTATGTAATACATGCGCAAACTAATTGTTCTTTTAGTTGTTCCCTAAATTCGTCAAGATTCTCAGCACGT
hide sequence
RefSeq Acc Id:
XM_039101766 ⟹ XP_038957694
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 45,802,811 - 45,837,095 (+) NCBI mRatBN7.2 2 44,069,659 - 44,103,854 (+) NCBI
RefSeq Acc Id:
XM_039101767 ⟹ XP_038957695
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 45,820,139 - 45,837,095 (+) NCBI mRatBN7.2 2 44,086,891 - 44,106,253 (+) NCBI
RefSeq Acc Id:
XM_063281320 ⟹ XP_063137390
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 45,800,272 - 45,837,095 (+) NCBI
RefSeq Acc Id:
NP_001008725 ⟸ NM_001008725
- Peptide Label:
precursor
- UniProtKB:
P40190 (UniProtKB/Swiss-Prot), H9BFG4 (UniProtKB/TrEMBL)
- Sequence:
MSALRIWLMQALLIFLTTESIGQLVEPCGYIYPEFPVVQRGSNFTATCVLKEKCLQVYSVNATYIVWKTNHVAVPKEQVTVINRTASSVTFTDVVFQNVQLTCNILSFGQIEQNVYGITILSGYPPDI
hide sequence
RefSeq Acc Id:
XP_006231990 ⟸ XM_006231928
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5Y7Q5 (UniProtKB/TrEMBL), A6I5P1 (UniProtKB/TrEMBL), A0A8I6AAL6 (UniProtKB/TrEMBL)
- Sequence:
MPYQFLGLCIGSIPCKMSALRIWLMQALLIFLTTESIGQLVEPCGYIYPEFPVVQRGSNFTATC
hide sequence
RefSeq Acc Id:
XP_008758958 ⟸ XM_008760736
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5Y7Q5 (UniProtKB/TrEMBL), A6I5P1 (UniProtKB/TrEMBL), A0A8I6AAL6 (UniProtKB/TrEMBL)
- Sequence:
MPYQFLGLCIGSIPCKMSALRIWLMQALLIFLTTESIGQLVEPCGYIYPEFPVVQRGSNFTATCVLKEKCLQVYSVNATYIVWKTNHVAVPKEQVTVINRTASSVTFTDVVFQNVQLTCNILSFGQIE
hide sequence
Ensembl Acc Id:
ENSRNOP00000018877 ⟸ ENSRNOT00000018877
RefSeq Acc Id:
XP_038957694 ⟸ XM_039101766
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5Y7Q5 (UniProtKB/TrEMBL), A6I5P1 (UniProtKB/TrEMBL), A0A8I6AAL6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038957695 ⟸ XM_039101767
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSRNOP00000090692 ⟸ ENSRNOT00000109781
Ensembl Acc Id:
ENSRNOP00000077391 ⟸ ENSRNOT00000105192
Ensembl Acc Id:
ENSRNOP00000083772 ⟸ ENSRNOT00000106583
Ensembl Acc Id:
ENSRNOP00000086828 ⟸ ENSRNOT00000113764
Ensembl Acc Id:
ENSRNOP00000081709 ⟸ ENSRNOT00000114610
Ensembl Acc Id:
ENSRNOP00000097802 ⟸ ENSRNOT00000111915
RefSeq Acc Id:
XP_063137390 ⟸ XM_063281320
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AAL6 (UniProtKB/TrEMBL), A0A8I5Y7Q5 (UniProtKB/TrEMBL), A6I5P1 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-02-18
Il6st
interleukin 6 cytokine family signal transducer
Il6st
interleukin 6 signal transducer
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Il6st
Interleukin 6 signal transducer
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
expressed in hepatocytes, astrocytes, fibroblasts, and endothelial cells
728912
gene_physical_interaction
interacts with the Il6 receptor
728912
gene_regulation
activated by interaction with the activated Il6 receptor
728912
