Symbol:
IGF1R
Name:
insulin like growth factor 1 receptor
RGD ID:
14131810
Description:
ENCODES a protein that exhibits G-protein alpha-subunit binding (ortholog); insulin receptor substrate binding (ortholog); insulin-like growth factor binding (ortholog); INVOLVED IN adrenal gland development (ortholog); animal organ morphogenesis (ortholog); axonogenesis (ortholog); PARTICIPATES IN E-cadherin signaling pathway; insulin-like growth factor signaling pathway; ASSOCIATED WITH acute kidney failure (ortholog); adrenocortical carcinoma (ortholog); alcoholic neuropathy (ortholog); FOUND IN axon (ortholog); caveola (ortholog); glutamatergic synapse (ortholog); INTERACTS WITH bisphenol A; dexamethasone; glycerol 2-phosphate
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
IGF-1 receptor; IGF-I receptor; insulin-like growth factor 1 receptor; insulin-like growth factor 1 receptor beta subunit; insulin-like growth factor receptor 1; insulin-like growth factor-I receptor
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
Sscrofa11.1 - Pig Sscrofa11.1 Assembly
Position:
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 137,387,825 - 137,691,058 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 137,383,623 - 137,691,038 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 153,523,944 - 153,853,776 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Pig Cytomap 1 q17-q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Annotations - PID (archival)
Biological Process
adrenal gland development (ISO) amyloid-beta clearance (IEA) animal organ morphogenesis (ISO) axonogenesis (ISO) brain development (ISO) cardiac atrium development (ISO) cell surface receptor protein tyrosine kinase signaling pathway (IEA) cellular response to aldosterone (ISO) cellular response to amyloid-beta (IEA) cellular response to angiotensin (ISO) cellular response to dexamethasone stimulus (ISO) cellular response to estradiol stimulus (ISO) cellular response to glucose stimulus (IBA,ISO) cellular response to insulin stimulus (ISO) cellular response to insulin-like growth factor stimulus (ISO) cellular response to mechanical stimulus (ISO) cellular response to progesterone stimulus (ISO) cellular response to testosterone stimulus (ISO) cellular response to transforming growth factor beta stimulus (ISO) cellular response to zinc ion starvation (ISO) cellular senescence (ISO) cerebellum development (ISO) dendritic spine maintenance (ISO) epidermis development (ISO) establishment of cell polarity (ISO) estrous cycle (ISO) exocrine pancreas development (ISO) hippocampus development (ISO) immune response (IEA) insulin receptor signaling pathway (IBA) insulin-like growth factor receptor signaling pathway (IBA,IEA) male sex determination (ISO) mammary gland development (ISO) MAPK cascade (ISO) mitotic nuclear division (ISO) negative regulation of apoptotic process (IEA,ISS) negative regulation of cholangiocyte apoptotic process (ISO) negative regulation of DNA-binding transcription factor activity (ISO) negative regulation of hepatocyte apoptotic process (ISO) negative regulation of MAPK cascade (IEA,ISO,ISS) negative regulation of muscle cell apoptotic process (ISO) negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (ISO) neuron projection development (ISO) peptidyl-tyrosine autophosphorylation (ISO) phosphatidylinositol 3-kinase/protein kinase B signal transduction (ISO) positive regulation of axon regeneration (ISO) positive regulation of cell migration (IEA) positive regulation of cell population proliferation (IEA) positive regulation of cold-induced thermogenesis (ISO) positive regulation of cytokinesis (ISO) positive regulation of developmental growth (ISO) positive regulation of DNA metabolic process (ISO) positive regulation of DNA-templated transcription (ISO) positive regulation of MAPK cascade (IBA,ISO) positive regulation of meiotic cell cycle (ISO) positive regulation of mitotic nuclear division (ISO) positive regulation of osteoblast proliferation (ISO) positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IBA,IEA,ISO) positive regulation of protein-containing complex disassembly (ISO) positive regulation of smooth muscle cell proliferation (ISO) positive regulation of steroid hormone biosynthetic process (ISO) postsynaptic modulation of chemical synaptic transmission (ISO) prostate gland epithelium morphogenesis (ISO) protein autophosphorylation (ISO) protein phosphorylation (ISO) regulation of JNK cascade (IBA,IEA,ISS) response to alkaloid (ISO) response to ethanol (ISO) response to hormone (ISO) response to insulin (ISO) response to L-glutamate (ISO) response to nicotine (ISO) response to nutrient levels (ISO) response to vitamin E (ISO) transcytosis (IEA)
IGF1R Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 137,387,825 - 137,691,058 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 137,383,623 - 137,691,038 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 153,523,944 - 153,853,776 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Pig Cytomap 1 q17-q21 NCBI
IGF1R Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 98,648,539 - 98,964,530 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 98,648,539 - 98,964,530 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 99,191,768 - 99,507,759 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 97,010,284 - 97,325,282 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 97,010,287 - 97,319,034 NCBI Celera 15 75,609,678 - 75,924,704 (+) NCBI Celera Cytogenetic Map 15 q26.3 NCBI HuRef 15 75,320,348 - 75,635,223 (+) NCBI HuRef CHM1_1 15 99,034,201 - 99,349,171 (+) NCBI CHM1_1 T2T-CHM13v2.0 15 96,412,912 - 96,728,919 (+) NCBI T2T-CHM13v2.0
Igf1r Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 67,601,486 - 67,883,416 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 67,602,575 - 67,883,416 (+) Ensembl GRCm39 Ensembl GRCm38 7 67,952,257 - 68,233,668 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 67,952,827 - 68,233,668 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 75,097,143 - 75,378,553 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 67,826,372 - 68,100,293 (+) NCBI MGSCv36 mm8 Celera 7 65,407,649 - 65,690,413 (+) NCBI Celera Cytogenetic Map 7 C NCBI cM Map 7 37.27 NCBI
Igf1r Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 130,959,787 - 131,248,664 (+) NCBI GRCr8 mRatBN7.2 1 121,549,831 - 121,838,548 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 121,550,743 - 121,831,777 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 129,548,259 - 129,834,935 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 136,718,334 - 137,005,027 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 129,519,288 - 129,805,989 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 128,924,921 - 129,213,816 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 128,924,966 - 129,206,516 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 129,985,761 - 130,272,589 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 122,704,976 - 122,990,007 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 122,783,318 - 123,068,350 (+) NCBI Celera 1 113,751,636 - 114,029,884 (+) NCBI Celera Cytogenetic Map 1 q22 NCBI
Igf1r Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955416 26,102,628 - 26,382,666 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955416 26,101,090 - 26,382,660 (-) NCBI ChiLan1.0 ChiLan1.0
IGF1R Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 88,195,825 - 88,510,506 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 91,892,588 - 92,207,137 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 77,332,926 - 77,648,474 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 96,576,930 - 96,832,974 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 96,535,164 - 96,832,974 (+) Ensembl panpan1.1 panPan2
IGF1R Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 41,795,337 - 42,096,255 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 41,794,623 - 42,090,387 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 44,494,039 - 44,797,005 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 42,203,106 - 42,506,274 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 42,203,091 - 42,501,470 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 41,727,974 - 42,030,799 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 41,958,900 - 42,261,698 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 42,179,556 - 42,481,580 (+) NCBI UU_Cfam_GSD_1.0
Igf1r Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 141,474,253 - 141,770,018 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936483 4,564,512 - 4,852,925 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936483 4,563,995 - 4,860,231 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
IGF1R Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 29 17,212,206 - 17,534,036 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 29 17,459,404 - 17,526,930 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666059 29,058,966 - 29,370,219 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Igf1r
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
10
4
23
3
2
5
14
12
23
3
6
3
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSSSCT00000005311 ⟹ ENSSSCP00000005181
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 Ensembl 1 137,387,825 - 137,691,058 (-) Ensembl
Ensembl Acc Id:
ENSSSCT00000005312 ⟹ ENSSSCP00000005182
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 Ensembl 1 137,387,925 - 137,690,666 (-) Ensembl
RefSeq Acc Id:
NM_214172 ⟹ NP_999337
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 1 137,390,085 - 137,690,433 (-) NCBI
Sequence:
AAAGGGAATTTCATCCCAAATAAAAGGAATGAAGTCTGGCTCCGGAGGAGGGTCCCCGACCTCGCTGTGGGGGCTCCTGTTTTTCTCCGCCGCGCTCTCGCTCTGGCCGACGAGTGGAGAAATCTGCG
hide sequence
RefSeq Acc Id:
XM_021082915 ⟹ XP_020938574
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 1 137,383,623 - 137,691,038 (-) NCBI
Sequence:
CGCGGCAGGAGTGCTGAGCGCGGCGCGGCCGGCCCGCCGCTTTGTGTGTGTCCTGGATTTGGGA
hide sequence
RefSeq Acc Id:
XM_021082918 ⟹ XP_020938577
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 1 137,383,623 - 137,689,849 (-) NCBI
Sequence:
GCAGCACCCTCGCTGCTTGGGCGGACTCTGTGCCCGGTAGCAGGAGTGGGCAGCCCACCAGCCTCAGGGGTGCCCGGCGGAGAGGCCCCGCAGTCCCCAGGACAGGTTACCAAATATCCTAGCGCGGC
hide sequence
RefSeq Acc Id:
XM_021082920 ⟹ XP_020938579
Type:
CODING
Position:
Pig Assembly Chr Position (strand) Source Sscrofa11.1 1 137,383,623 - 137,638,348 (-) NCBI
Sequence:
CTTCTACAACTACGCCCTGGTCATCTTCGAGATGACCAACCTCAAGGACATCGGGCTCTACAAC
hide sequence
RefSeq Acc Id:
XP_020938574 ⟸ XM_021082915
- Peptide Label:
isoform X1
- UniProtKB:
A0A8D1VS60 (UniProtKB/TrEMBL)
- Sequence:
MKSGSGGGSPTSLWGLLFFSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDI
hide sequence
RefSeq Acc Id:
XP_020938577 ⟸ XM_021082918
- Peptide Label:
isoform X2
- UniProtKB:
A0A8D0IK16 (UniProtKB/TrEMBL)
- Sequence:
MQSQNWGWERRGRVVCGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEK
hide sequence
RefSeq Acc Id:
XP_020938579 ⟸ XM_021082920
- Peptide Label:
isoform X3
- UniProtKB:
A0A8D0IFQ8 (UniProtKB/TrEMBL)
- Sequence:
MPCPITTSWATSPLRNAGTCAQGRWRRSRCVRRRPSTTSTTIAAGPRTAARKLQACLFVLIRRLARSPGPLQENLWVCPSVCGKRACTENHECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPSCP
hide sequence
RefSeq Acc Id:
NP_999337 ⟸ NM_214172
- Peptide Label:
precursor
- UniProtKB:
F1CK17 (UniProtKB/TrEMBL), A0A4X1UKG1 (UniProtKB/TrEMBL), A0A8D1VS60 (UniProtKB/TrEMBL), A0A8D0IGG5 (UniProtKB/TrEMBL)
- Sequence:
MKSGSGGGSPTSLWGLLFFSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDI
hide sequence
Ensembl Acc Id:
ENSSSCP00000005182 ⟸ ENSSSCT00000005312
Ensembl Acc Id:
ENSSSCP00000005181 ⟸ ENSSSCT00000005311
