Symbol:
Usp1
Name:
ubiquitin specific peptidase 1
RGD ID:
1306461
Description:
Predicted to enable cysteine-type deubiquitinase activity. Predicted to be involved in several processes, including monoubiquitinated protein deubiquitination; positive regulation of receptor signaling pathway via JAK-STAT; and regulation of protein stability. Predicted to act upstream of or within skeletal system development. Predicted to be located in nucleoplasm. Predicted to be active in cytosol and nucleus. Orthologous to human USP1 (ubiquitin specific peptidase 1); INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
deubiquitinating enzyme 1; LOC313387; MGC108773; ubiquitin carboxyl-terminal hydrolase 1; ubiquitin specific peptdiase 1; ubiquitin specific protease 1; ubiquitin thioesterase 1; ubiquitin thiolesterase 1; ubiquitin-specific-processing protease 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 118,703,056 - 118,714,426 (+) NCBI GRCr8 mRatBN7.2 5 113,587,564 - 113,598,934 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 113,587,564 - 113,598,932 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 116,161,227 - 116,172,610 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 117,886,562 - 117,897,946 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 117,949,094 - 117,960,477 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 117,583,502 - 117,594,872 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 117,583,502 - 117,594,870 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 121,525,009 - 121,536,379 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 119,364,515 - 119,375,885 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 119,369,740 - 119,381,109 (+) NCBI Celera 5 112,151,349 - 112,162,719 (+) NCBI Celera Cytogenetic Map 5 q33 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Usp1 Rat (-)-demecolcine decreases expression ISO RGD:1315093 6480464 Demecolcine results in decreased expression of USP1 mRNA CTD PMID:23649840 Usp1 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO RGD:1315094 6480464 o,p'-DDT results in increased expression of USP1 mRNA CTD PMID:24096037 Usp1 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression EXP 6480464 o,p'-DDT results in increased expression of USP1 mRNA CTD PMID:24096037 Usp1 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1315094 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of USP1 mRNA CTD PMID:22206623 Usp1 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1315094 6480464 1,2-Dimethylhydrazine results in decreased expression of USP1 mRNA CTD PMID:22206623 Usp1 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:1315094 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of USP1 mRNA CTD PMID:17942748 Usp1 Rat 17alpha-ethynylestradiol increases expression ISO RGD:1315094 6480464 Ethinyl Estradiol results in increased expression of USP1 mRNA CTD PMID:17942748|PMID:24096037 Usp1 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of USP1 mRNA CTD PMID:24096037 Usp1 Rat 17alpha-ethynylestradiol affects expression ISO RGD:1315094 6480464 Ethinyl Estradiol affects the expression of USP1 mRNA CTD PMID:17555576 Usp1 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO RGD:1315094 6480464 2,2',4,4'-tetrabromodiphenyl ether affects the expression of USP1 mRNA CTD PMID:30294300 Usp1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1315094 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of USP1 mRNA CTD PMID:17942748 Usp1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of USP1 mRNA CTD PMID:34747641 Usp1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1315094 6480464 Tetrachlorodibenzodioxin affects the expression of USP1 mRNA CTD PMID:21570461 Usp1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of USP1 mRNA CTD PMID:21346803 Usp1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of USP1 mRNA CTD PMID:21346803 Usp1 Rat 2-methylcholine affects expression ISO RGD:1315093 6480464 beta-methylcholine affects the expression of USP1 mRNA CTD PMID:21179406 Usp1 Rat 2-palmitoylglycerol increases expression ISO RGD:1315093 6480464 2-palmitoylglycerol results in increased expression of USP1 mRNA CTD PMID:37199045 Usp1 Rat aflatoxin M1 decreases expression ISO RGD:1315093 6480464 Aflatoxin M1 results in decreased expression of USP1 mRNA CTD PMID:30928695 Usp1 Rat all-trans-retinoic acid decreases expression ISO RGD:1315093 6480464 Tretinoin results in decreased expression of USP1 mRNA CTD PMID:16249480|PMID:33167477 Usp1 Rat aristolochic acid A decreases expression ISO RGD:1315093 6480464 aristolochic acid I results in decreased expression of USP1 mRNA CTD PMID:33212167 Usp1 Rat Aroclor 1254 decreases expression ISO RGD:1315094 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of USP1 mRNA CTD PMID:23650126 Usp1 Rat arsenite(3-) decreases expression ISO RGD:1315094 6480464 arsenite results in decreased expression of USP1 mRNA CTD PMID:33053406 Usp1 Rat benzo[a]pyrene decreases expression ISO RGD:1315094 6480464 Benzo(a)pyrene results in decreased expression of USP1 mRNA CTD PMID:22228805 Usp1 Rat benzo[a]pyrene increases expression ISO RGD:1315093 6480464 Benzo(a)pyrene results in increased expression of USP1 mRNA CTD PMID:32234424 Usp1 Rat benzo[a]pyrene increases expression ISO RGD:1315094 6480464 Benzo(a)pyrene results in increased expression of USP1 mRNA CTD PMID:22228805 Usp1 Rat benzo[a]pyrene decreases expression ISO RGD:1315093 6480464 Benzo(a)pyrene results in decreased expression of USP1 mRNA CTD PMID:22316170 Usp1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1315093 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of USP1 mRNA CTD PMID:20382639 Usp1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of USP1 mRNA CTD PMID:25181051|PMID:32145629 Usp1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of USP1 mRNA CTD PMID:34947998 Usp1 Rat bisphenol A decreases expression ISO RGD:1315094 6480464 bisphenol A results in decreased expression of USP1 mRNA CTD PMID:33221593 Usp1 Rat bisphenol A decreases expression ISO RGD:1315093 6480464 bisphenol A results in decreased expression of USP1 mRNA CTD PMID:29275510 Usp1 Rat bisphenol F increases expression ISO RGD:1315094 6480464 bisphenol F results in increased expression of USP1 mRNA CTD PMID:38685157 Usp1 Rat caffeine decreases phosphorylation ISO RGD:1315093 6480464 Caffeine results in decreased phosphorylation of USP1 protein CTD PMID:35688186 Usp1 Rat calcitriol multiple interactions ISO RGD:1315093 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of USP1 mRNA CTD PMID:21592394 Usp1 Rat calcitriol decreases expression ISO RGD:1315093 6480464 Calcitriol results in decreased expression of USP1 mRNA CTD PMID:21592394 Usp1 Rat carbamazepine affects expression ISO RGD:1315093 6480464 Carbamazepine affects the expression of USP1 mRNA CTD PMID:25979313 Usp1 Rat CGP 52608 multiple interactions ISO RGD:1315093 6480464 CGP 52608 promotes the reaction [RORA protein binds to USP1 gene] CTD PMID:28238834 Usp1 Rat cisplatin decreases expression ISO RGD:1315093 6480464 Cisplatin results in decreased expression of USP1 mRNA CTD PMID:27392435 Usp1 Rat copper atom increases expression ISO RGD:1315094 6480464 Copper results in increased expression of USP1 mRNA CTD PMID:16629173 Usp1 Rat copper(0) increases expression ISO RGD:1315094 6480464 Copper results in increased expression of USP1 mRNA CTD PMID:16629173 Usp1 Rat copper(II) sulfate decreases expression ISO RGD:1315093 6480464 Copper Sulfate results in decreased expression of USP1 mRNA CTD PMID:19549813 Usp1 Rat coumarin increases phosphorylation ISO RGD:1315093 6480464 coumarin results in increased phosphorylation of USP1 protein CTD PMID:35688186 Usp1 Rat coumestrol multiple interactions ISO RGD:1315093 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of USP1 mRNA; [Coumestrol co-treated with resveratrol] more ... CTD PMID:19167446 Usp1 Rat coumestrol increases expression ISO RGD:1315093 6480464 Coumestrol results in increased expression of USP1 mRNA CTD PMID:19167446 Usp1 Rat cyclosporin A increases expression ISO RGD:1315093 6480464 Cyclosporine results in increased expression of USP1 mRNA CTD PMID:20106945|PMID:27989131 Usp1 Rat Dibutyl phosphate affects expression ISO RGD:1315093 6480464 di-n-butylphosphoric acid affects the expression of USP1 mRNA CTD PMID:37042841 Usp1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of USP1 mRNA CTD PMID:21266533 Usp1 Rat dibutyl phthalate decreases expression ISO RGD:1315094 6480464 Dibutyl Phthalate results in decreased expression of USP1 mRNA CTD PMID:17361019|PMID:21266533 Usp1 Rat dicrotophos decreases expression ISO RGD:1315093 6480464 dicrotophos results in decreased expression of USP1 mRNA CTD PMID:28302478 Usp1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of USP1 mRNA CTD PMID:29391264 Usp1 Rat Enterolactone multiple interactions ISO RGD:1315093 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of USP1 mRNA CTD PMID:19167446 Usp1 Rat fenofibrate increases expression ISO RGD:1315094 6480464 Fenofibrate results in increased expression of USP1 mRNA CTD PMID:21318169 Usp1 Rat fenofibrate multiple interactions ISO RGD:1315094 6480464 PPARA protein affects the reaction [Fenofibrate results in increased expression of USP1 mRNA] CTD PMID:21318169 Usp1 Rat folic acid multiple interactions ISO RGD:1315094 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of USP1 mRNA CTD PMID:22206623 Usp1 Rat FR900359 decreases phosphorylation ISO RGD:1315093 6480464 FR900359 results in decreased phosphorylation of USP1 protein CTD PMID:37730182 Usp1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of USP1 mRNA CTD PMID:22061828 Usp1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of USP1 mRNA CTD PMID:33387578 Usp1 Rat gold atom decreases expression ISO RGD:1315093 6480464 Gold results in decreased expression of USP1 mRNA CTD PMID:25523186 Usp1 Rat gold(0) decreases expression ISO RGD:1315093 6480464 Gold results in decreased expression of USP1 mRNA CTD PMID:25523186 Usp1 Rat hexadecanoic acid increases phosphorylation ISO RGD:1315093 6480464 Palmitic Acid results in increased phosphorylation of USP1 protein CTD PMID:28073184 Usp1 Rat hydrogen peroxide affects expression ISO RGD:1315093 6480464 Hydrogen Peroxide affects the expression of USP1 mRNA CTD PMID:21179406 Usp1 Rat kojic acid decreases expression ISO RGD:1315093 6480464 kojic acid results in decreased expression of USP1 mRNA CTD PMID:16595896 Usp1 Rat methidathion increases expression ISO RGD:1315094 6480464 methidathion results in increased expression of USP1 mRNA CTD PMID:34813904 Usp1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of USP1 mRNA CTD PMID:25729387 Usp1 Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of USP1 mRNA CTD PMID:25729387 Usp1 Rat paracetamol affects expression ISO RGD:1315094 6480464 Acetaminophen affects the expression of USP1 mRNA CTD PMID:17562736 Usp1 Rat phenobarbital decreases expression ISO RGD:1315094 6480464 Phenobarbital results in decreased expression of USP1 mRNA CTD PMID:23091169 Usp1 Rat phlorizin increases expression ISO RGD:1315094 6480464 Phlorhizin results in increased expression of USP1 mRNA CTD PMID:22538082 Usp1 Rat pirinixic acid multiple interactions ISO RGD:1315094 6480464 PPARA protein affects the reaction [pirinixic acid results in increased expression of USP1 mRNA] CTD PMID:21318169 Usp1 Rat pirinixic acid increases expression ISO RGD:1315094 6480464 pirinixic acid results in increased expression of USP1 mRNA CTD PMID:18301758|PMID:21318169 Usp1 Rat piroxicam decreases expression ISO RGD:1315093 6480464 Piroxicam results in decreased expression of USP1 mRNA CTD PMID:21858171 Usp1 Rat quercetin decreases phosphorylation ISO RGD:1315093 6480464 Quercetin results in decreased phosphorylation of USP1 protein CTD PMID:35688186 Usp1 Rat resveratrol multiple interactions ISO RGD:1315093 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of USP1 mRNA CTD PMID:19167446 Usp1 Rat sodium arsenite decreases expression ISO RGD:1315093 6480464 sodium arsenite results in decreased expression of USP1 mRNA CTD PMID:38568856 Usp1 Rat sodium arsenite increases expression ISO RGD:1315093 6480464 sodium arsenite results in increased expression of USP1 protein CTD PMID:30528433 Usp1 Rat sodium dichromate affects expression EXP 6480464 sodium bichromate affects the expression of USP1 mRNA CTD PMID:22110744 Usp1 Rat succimer multiple interactions ISO RGD:1315094 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of USP1 mRNA; [Succimer co-treated more ... CTD PMID:21641980|PMID:26378955 Usp1 Rat succimer multiple interactions ISO RGD:1315093 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of USP1 mRNA CTD PMID:26378955 Usp1 Rat tamoxifen affects expression ISO RGD:1315094 6480464 Tamoxifen affects the expression of USP1 mRNA CTD PMID:17555576 Usp1 Rat testosterone multiple interactions ISO RGD:1315093 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of USP1 mRNA CTD PMID:21592394 Usp1 Rat testosterone decreases expression ISO RGD:1315093 6480464 Testosterone results in decreased expression of USP1 mRNA CTD PMID:21592394 Usp1 Rat testosterone enanthate affects expression ISO RGD:1315093 6480464 testosterone enanthate affects the expression of USP1 mRNA CTD PMID:17440010 Usp1 Rat tetrachloromethane increases expression ISO RGD:1315094 6480464 Carbon Tetrachloride results in increased expression of USP1 mRNA CTD PMID:31919559 Usp1 Rat thimerosal decreases expression ISO RGD:1315093 6480464 Thimerosal results in decreased expression of USP1 mRNA CTD PMID:27188386 Usp1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of USP1 mRNA CTD PMID:34492290 Usp1 Rat titanium dioxide decreases methylation ISO RGD:1315094 6480464 titanium dioxide results in decreased methylation of USP1 promoter CTD PMID:35295148 Usp1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of USP1 mRNA CTD PMID:25729387 Usp1 Rat triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of USP1 mRNA CTD PMID:30589522 Usp1 Rat triphenyl phosphate affects expression ISO RGD:1315093 6480464 triphenyl phosphate affects the expression of USP1 mRNA CTD PMID:37042841 Usp1 Rat trovafloxacin decreases expression ISO RGD:1315094 6480464 trovafloxacin results in decreased expression of USP1 mRNA CTD PMID:35537566 Usp1 Rat valproic acid affects expression ISO RGD:1315094 6480464 Valproic Acid affects the expression of USP1 mRNA CTD PMID:17963808
(-)-demecolcine (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP,ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-methylcholine (ISO) 2-palmitoylglycerol (ISO) aflatoxin M1 (ISO) all-trans-retinoic acid (ISO) aristolochic acid A (ISO) Aroclor 1254 (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) caffeine (ISO) calcitriol (ISO) carbamazepine (ISO) CGP 52608 (ISO) cisplatin (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) coumarin (ISO) coumestrol (ISO) cyclosporin A (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dicrotophos (ISO) endosulfan (EXP) Enterolactone (ISO) fenofibrate (ISO) folic acid (ISO) FR900359 (ISO) gentamycin (EXP) gold atom (ISO) gold(0) (ISO) hexadecanoic acid (ISO) hydrogen peroxide (ISO) kojic acid (ISO) methidathion (ISO) oxaliplatin (EXP) paracetamol (ISO) phenobarbital (ISO) phlorizin (ISO) pirinixic acid (ISO) piroxicam (ISO) quercetin (ISO) resveratrol (ISO) sodium arsenite (ISO) sodium dichromate (EXP) succimer (ISO) tamoxifen (ISO) testosterone (ISO) testosterone enanthate (ISO) tetrachloromethane (ISO) thimerosal (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) triphenyl phosphate (EXP,ISO) trovafloxacin (ISO) valproic acid (ISO)
Biological Process
DNA damage response (IEA) DNA repair (IEA) monoubiquitinated protein deubiquitination (IEA,ISO,ISS) positive regulation of receptor signaling pathway via JAK-STAT (IEA,ISO) protein deubiquitination (IEA,ISO,ISS) proteolysis (IEA) regulation of DNA repair (IEA,ISO,ISS) regulation of protein stability (IBA) response to UV (IEA,ISO,ISS) skeletal system development (IEA,ISO)
Usp1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 118,703,056 - 118,714,426 (+) NCBI GRCr8 mRatBN7.2 5 113,587,564 - 113,598,934 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 113,587,564 - 113,598,932 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 116,161,227 - 116,172,610 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 117,886,562 - 117,897,946 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 117,949,094 - 117,960,477 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 117,583,502 - 117,594,872 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 117,583,502 - 117,594,870 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 121,525,009 - 121,536,379 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 119,364,515 - 119,375,885 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 119,369,740 - 119,381,109 (+) NCBI Celera 5 112,151,349 - 112,162,719 (+) NCBI Celera Cytogenetic Map 5 q33 NCBI
USP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 62,436,395 - 62,451,804 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 62,436,297 - 62,451,804 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 62,902,066 - 62,917,475 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 62,674,563 - 62,690,063 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 62,614,699 - 62,629,430 NCBI Celera 1 61,191,184 - 61,206,684 (+) NCBI Celera Cytogenetic Map 1 p31.3 NCBI HuRef 1 61,014,014 - 61,029,515 (+) NCBI HuRef CHM1_1 1 63,017,306 - 63,032,808 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 62,314,982 - 62,330,391 (+) NCBI T2T-CHM13v2.0
Usp1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 98,812,047 - 98,823,780 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 98,812,047 - 98,823,780 (+) Ensembl GRCm39 Ensembl GRCm38 4 98,923,810 - 98,935,543 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 98,923,810 - 98,935,543 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 98,590,501 - 98,602,224 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 98,415,828 - 98,427,551 (+) NCBI MGSCv36 mm8 Celera 4 97,290,878 - 97,302,597 (+) NCBI Celera Cytogenetic Map 4 C6 NCBI cM Map 4 45.6 NCBI
Usp1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955423 27,237,003 - 27,251,892 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955423 27,236,242 - 27,254,064 (-) NCBI ChiLan1.0 ChiLan1.0
USP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 164,400,198 - 164,427,944 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 163,549,851 - 163,577,601 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 61,694,775 - 61,710,216 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 63,509,781 - 63,525,446 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 63,510,196 - 63,525,446 (+) Ensembl panpan1.1 panPan2
USP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 47,655,533 - 47,666,767 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 47,656,039 - 47,666,210 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 47,709,417 - 47,728,116 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 47,832,714 - 47,851,368 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 47,839,987 - 47,850,507 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 47,787,677 - 47,806,321 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 47,734,051 - 47,752,692 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 47,996,113 - 48,014,814 (-) NCBI UU_Cfam_GSD_1.0
Usp1
USP1
USP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 70,602,300 - 70,617,280 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 70,603,056 - 70,614,069 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 46,836,799 - 46,851,713 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Usp1
.
Predicted Target Of
Count of predictions: 84 Count of miRNA genes: 63 Interacting mature miRNAs: 80 Transcripts: ENSRNOT00000010933 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 7794743 Bp373 Blood pressure QTL 373 0.0058 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 112175546 116047089 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1298070 Scl18 Serum cholesterol level QTL 18 3.7 blood LDL cholesterol amount (VT:0000181) calculated plasma low density lipoprotein cholesterol level (CMO:0001245) 5 79584860 124584860 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 7411582 Foco3 Food consumption QTL 3 7.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 1598859 Cm66 Cardiac mass QTL 66 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 79584860 124584860 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 1582212 Livw2 Liver weight QTL 2 3.5 0.0004 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 5 99016066 119085810 Rat 7411564 Bw135 Body weight QTL 135 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 87468046 132468046 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 7411601 Foco12 Food consumption QTL 12 19.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 1598846 Bp293 Blood pressure QTL 293 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 79584860 124584860 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 1358909 Kidm25 Kidney mass QTL 25 1.87 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 5 90067849 128034027 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298086 Bp156 Blood pressure QTL 156 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 84132602 129132602 Rat 2306971 Anxrr21 Anxiety related response QTL 21 9.47 fear/anxiety-related behavior trait (VT:1000241) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 5 66174080 124160948 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1358895 Bp254 Blood pressure QTL 254 3.6 0.0003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 58829236 128034027 Rat 6903316 Bw113 Body weight QTL 113 2 0.0103 body mass (VT:0001259) body weight (CMO:0000012) 5 87765973 132765973 Rat 1358889 Bp261 Blood pressure QTL 261 2.86 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 90067849 128034027 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
BF386522
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 113,597,258 - 113,597,409 (+) MAPPER mRatBN7.2 Rnor_6.0 5 117,593,197 - 117,593,347 NCBI Rnor6.0 Rnor_5.0 5 121,534,704 - 121,534,854 UniSTS Rnor5.0 RGSC_v3.4 5 119,374,210 - 119,374,360 UniSTS RGSC3.4 Celera 5 112,161,044 - 112,161,194 UniSTS RH 3.4 Map 5 792.0 UniSTS Cytogenetic Map 5 q33 UniSTS
RH129697
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 113,598,647 - 113,598,830 (+) MAPPER mRatBN7.2 Rnor_6.0 5 117,594,586 - 117,594,768 NCBI Rnor6.0 Rnor_5.0 5 121,536,093 - 121,536,275 UniSTS Rnor5.0 RGSC_v3.4 5 119,375,599 - 119,375,781 UniSTS RGSC3.4 Celera 5 112,162,433 - 112,162,615 UniSTS RH 3.4 Map 5 791.3 UniSTS Cytogenetic Map 5 q33 UniSTS
RH142394
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 113,598,233 - 113,598,414 (+) MAPPER mRatBN7.2 Rnor_6.0 5 117,594,172 - 117,594,352 NCBI Rnor6.0 Rnor_5.0 5 121,535,679 - 121,535,859 UniSTS Rnor5.0 RGSC_v3.4 5 119,375,185 - 119,375,365 UniSTS RGSC3.4 Celera 5 112,162,019 - 112,162,199 UniSTS Cytogenetic Map 5 q33 UniSTS
BE106944
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 113,596,852 - 113,597,009 (+) MAPPER mRatBN7.2 Rnor_6.0 5 117,592,791 - 117,592,947 NCBI Rnor6.0 Rnor_5.0 5 121,534,298 - 121,534,454 UniSTS Rnor5.0 RGSC_v3.4 5 119,373,804 - 119,373,960 UniSTS RGSC3.4 Celera 5 112,160,638 - 112,160,794 UniSTS RH 3.4 Map 5 798.9 UniSTS Cytogenetic Map 5 q33 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000010933 ⟹ ENSRNOP00000010935
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 113,587,564 - 113,598,932 (+) Ensembl Rnor_6.0 Ensembl 5 117,583,502 - 117,594,870 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000084640 ⟹ ENSRNOP00000069155
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 117,586,103 - 117,594,335 (+) Ensembl
RefSeq Acc Id:
NM_001015015 ⟹ NP_001015015
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 118,703,056 - 118,714,426 (+) NCBI mRatBN7.2 5 113,587,564 - 113,598,934 (+) NCBI Rnor_6.0 5 117,583,502 - 117,594,872 (+) NCBI Rnor_5.0 5 121,525,009 - 121,536,379 (+) NCBI RGSC_v3.4 5 119,364,515 - 119,375,885 (+) RGD Celera 5 112,151,349 - 112,162,719 (+) RGD
Sequence:
CGGCACTTTCCGTGGACGCCACCTCCAGCCGCGACGCTGGCGCGGGCGGGGGTTCACTCGCGGGGGTCCTGAGACTGAGGAAAACGCGCCAAGTTCCCCTCGGCAGCTGAGCGGGGACCCTGCGGCTC
hide sequence
RefSeq Acc Id:
NP_001015015 ⟸ NM_001015015
- UniProtKB:
Q569C3 (UniProtKB/Swiss-Prot), A6JRL2 (UniProtKB/TrEMBL), A6JRL1 (UniProtKB/TrEMBL)
- Sequence:
MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQEDEEKASEYRGSEIDQVVPAAQSSPVSCEKRENLLPFVGLNNLGNTCYLNSILQVLYFCPGFKAGVKHLFNIISRKKEALKDDSI
hide sequence
Ensembl Acc Id:
ENSRNOP00000069155 ⟸ ENSRNOT00000084640
Ensembl Acc Id:
ENSRNOP00000010935 ⟸ ENSRNOT00000010933
RGD ID: 13693852 Promoter ID: EPDNEW_R4377 Type: initiation region Name: Usp1_1 Description: ubiquitin specific peptidase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 117,583,593 - 117,583,653 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-12-15
Usp1
ubiquitin specific peptidase 1
Usp1
ubiquitin specific peptdiase 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Usp1
ubiquitin specific peptdiase 1
ubiquitin specific protease 1
Name updated
1299863 APPROVED
2005-12-06
Usp1
ubiquitin specific protease 1
Usp1_predicted
ubiquitin specific protease 1 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Usp1_predicted
ubiquitin specific protease 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
