Symbol:
Stat4 (Ensembl: Stat1)
Name:
signal transducer and activator of transcription 4 (Ensembl:signal transducer and activator of transcription 1)
RGD ID:
1305747
Description:
Enables sequence-specific DNA binding activity. Acts upstream of or within cellular response to cytokine stimulus. Predicted to be located in nuclear body. Predicted to be part of RNA polymerase II transcription regulator complex. Predicted to be active in nucleus. Used to study obesity. Biomarker of asthma; chronic obstructive pulmonary disease; and metabolic dysfunction and alcohol associated liver disease. Human ortholog(s) of this gene implicated in several diseases, including IgA glomerulonephritis; autoimmune disease (multiple); breast cancer (multiple); carcinoma (multiple); and scleroderma (multiple). Orthologous to several human genes including STAT1 (signal transducer and activator of transcription 1); PARTICIPATES IN interleukin-12 signaling pathway; interleukin-23 signaling pathway; interleukin-27 signaling pathway; INTERACTS WITH 7,12-dimethyltetraphene; acetamide; aconitine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC367264
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 56,964,617 - 57,080,523 (-) NCBI GRCr8 mRatBN7.2 9 49,472,660 - 49,588,540 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 49,419,340 - 49,588,540 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 58,021,896 - 58,130,745 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 63,144,732 - 63,253,572 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 61,440,716 - 61,549,562 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 54,340,649 - 54,457,753 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 54,287,541 - 54,484,533 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 54,051,154 - 54,167,491 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 46,510,251 - 46,650,076 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 46,511,665 - 46,651,490 (-) NCBI Celera 9 47,135,713 - 47,243,684 (-) NCBI Celera Cytogenetic Map 9 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Stat4 Rat asthma treatment IEP 2317290 RGD Stat4 Rat autoimmune hepatitis susceptibility ISO RGD:1313964 25671419 DNA:SNPs: intron 3, intron: (rs7574865, rs7582694) (human) RGD Stat4 Rat Behcet's disease ISO RGD:1313964 8661713 DNA:SNP: :rs7574865 (human) RGD Stat4 Rat Behcet's disease ISO RGD:1313964 8661718 DNA:SNPs: :rs897200, rs7572482, rs7574070 (human) RGD Stat4 Rat Chemical and Drug Induced Liver Injury severity ISO RGD:1313965 25671417 protein:increased phosphorylation:liver, inflammatory cell (mouse) RGD Stat4 Rat Chemical and Drug Induced Liver Injury ISO RGD:1313965 25671422 mRNA:increased expression:liver, macrophage (mouse) RGD Stat4 Rat cholesteatoma ISO RGD:1313964 8661722 RGD Stat4 Rat Chronic Hepatitis B susceptibility ISO RGD:1313964 25671420 DNA:SNPs, haplotypes:multiple RGD Stat4 Rat chronic obstructive pulmonary disease IEP 8661725 protein:increased expression:lung RGD Stat4 Rat cutaneous leishmaniasis ISO RGD:1313965 8661703 RGD Stat4 Rat Dermal Fibrosis ISO RGD:1313965 8661691 RGD Stat4 Rat dermatomyositis ISO RGD:1313964 8661693 DNA:SNP: :rs7574865 (human) RGD Stat4 Rat diffuse scleroderma susceptibility ISO RGD:1313964 8661701 DNA:SNP:introns: (rs7574865, rs10168266) (human) RGD Stat4 Rat diffuse scleroderma no_association ISO RGD:1313964 8661714 DNA:SNP:intron: (rs7574865) (human) RGD Stat4 Rat diffuse scleroderma no_association ISO RGD:1313964 8661701 DNA:SNP:intron: (rs3821236) (human) RGD Stat4 Rat Eczema ISO RGD:1313964 6893665 RGD Stat4 Rat Experimental Autoimmune Encephalomyelitis IEP 7207888 RGD Stat4 Rat Experimental Diabetes Mellitus ISO RGD:1313965 7207889 RGD Stat4 Rat gastric adenocarcinoma ISO RGD:1313964 9068941 mRNA:increased expression:stomach (human) RGD PMID:33042401|REF_RGD_ID:153298934 Stat4 Rat genital herpes severity ISO RGD:1313964 8661697 DNA:SNPs, haplotype: :multiple RGD Stat4 Rat genital herpes treatment ISO RGD:1313964 8661697 DNA:SNP:intron:rs7572482 (human) RGD Stat4 Rat Graves' disease ISO RGD:1313965 7207875 RGD Stat4 Rat hepatocellular carcinoma susceptibility ISO RGD:1313964 9068941 Hepatitis B, Chronic; DNA:SNP: intron 3: (rs7574865) (human) RGD PMID:26745093|REF_RGD_ID:11553302 Stat4 Rat Herpes Simplex Encephalitis susceptibility ISO RGD:1313965 8661706 RGD Stat4 Rat herpes simplex virus keratitis susceptibility ISO RGD:1313965 8661706 RGD Stat4 Rat IgA glomerulonephritis no_association ISO RGD:1313964 7207878 DNA:SNP:intron:c.274-28828C>G (rs10181656) (human) RGD Stat4 Rat IgA glomerulonephritis disease_progression ISO RGD:1313964 7207872 DNA:SNP: :rs7561832 (human) RGD Stat4 Rat limited scleroderma no_association ISO RGD:1313964 8661701 DNA:SNPs:introns: (rs10168266, rs3821236) (human) RGD Stat4 Rat limited scleroderma susceptibility ISO RGD:1313964 8661701 DNA:SNP:intron: (rs7574865) (human) RGD Stat4 Rat limited scleroderma susceptibility ISO RGD:1313964 8661714 DNA:SNP:intron: (rs7574865) (human) RGD Stat4 Rat lupus nephritis ISO RGD:1313965 6893449 RGD Stat4 Rat metabolic dysfunction and alcohol associated liver disease IEP 7207884 RGD Stat4 Rat Neointima treatment IDA 5509614 associated with Carotid Artery Injuries RGD Stat4 Rat obesity treatment IDA 5509594 RGD Stat4 Rat Oral Ulcer ISO RGD:1313964 5147916 associated with Lupus Erythematosus, Systemic;DNA:SNP:intron:c.274-23582A>C (rs7574865) (human) RGD Stat4 Rat polymyositis susceptibility ISO RGD:1313964 8661720 DNA:SNP:intron: (rs7582694) (human) RGD Stat4 Rat primary biliary cholangitis susceptibility ISO RGD:1313964 25671416 DNA:SNP: intron: (rs7574865) (human) RGD Stat4 Rat primary biliary cholangitis no_association ISO RGD:1313964 25671415 DNA:SNPs:3'utr: (rs7574865, rs8179673, rs10181656) (human) RGD Stat4 Rat primary biliary cholangitis susceptibility ISO RGD:1313964 25671421 associated with Crohn���s disease; DNA:SNP:intron: (rs7574865) (human) RGD Stat4 Rat primary biliary cholangitis susceptibility ISO RGD:1313964 25671415 DNA:SNPs, haplotypes:multiple RGD Stat4 Rat psoriasis susceptibility ISO RGD:1313964 8661715 DNA:SNP:intron:IVS3 (rs7574865) (human) RGD Stat4 Rat psoriatic arthritis ISO RGD:1313964 8661724 DNA:SNP: :rs10181656 (human) RGD Stat4 Rat rectum adenocarcinoma ISO RGD:1313964 153323313 DNA:SNP:intron: (rs3024861) (human) RGD Stat4 Rat Sepsis ISO RGD:1313965 7207876 RGD Stat4 Rat Sezary's disease ISO RGD:1313964 8661723 RGD Stat4 Rat Sjogren's syndrome susceptibility ISO RGD:1313964 8661690 DNA:SNP:intron: (rs7582694) (human) RGD Stat4 Rat Sjogren's syndrome susceptibility ISO RGD:1313964 8661708 DNA:SNP:intron: (rs7574865) (human) RGD Stat4 Rat Sjogren's syndrome no_association ISO RGD:1313964 8661709 DNA:SNP:intron: (rs7574865) (human) RGD Stat4 Rat steatotic liver disease ISO RGD:1313965 25671424 RGD Stat4 Rat systemic lupus erythematosus treatment ISO RGD:1313965 7207874 RGD Stat4 Rat systemic lupus erythematosus ISO RGD:1313964 7207881 DNA:SNPs:intron:multiple (human) RGD Stat4 Rat systemic lupus erythematosus ISO RGD:1313965 7207867 RGD Stat4 Rat systemic lupus erythematosus onset ISO RGD:1313964 7207877 DNA:SNP:intron:c.274-23582A>C (rs7574865) (human) RGD Stat4 Rat systemic lupus erythematosus ISO RGD:1313964 7207879 DNA:SNPs:introns:c.274-23582A>C, c.274-2691G>A, c.466-1307G>A (rs7574865, rs11889341, rs10168266) (human) RGD Stat4 Rat systemic lupus erythematosus ISO RGD:1313964 7207869 DNA:SNP:intron:c.274-29069G>C (rs7582694) (human) RGD Stat4 Rat systemic lupus erythematosus ISO RGD:1313964 7207878 DNA:SNP:intron:c.274-28828C>G (rs10181656) (human) RGD Stat4 Rat systemic scleroderma susceptibility ISO RGD:1313964 8661700 DNA:SNP:intron: (rs7574865) (human) RGD Stat4 Rat systemic scleroderma susceptibility ISO RGD:1313964 8661711 DNA:SNP:intron: (rs11889341) (human) RGD Stat4 Rat Transplant Rejection ISO RGD:1313964 7207871 DNA:SNP: :rs7574865 (human) RGD Stat4 Rat viral hepatitis susceptibility ISO RGD:1313964 25671417 protein:increased phosphorylation:liver, inflammatory cell (human) RGD Stat4 Rat visceral leishmaniasis ISO RGD:1313965 8661696 RGD Stat4 Rat Vogt-Koyanagi-Harada disease ISO RGD:1313964 8661713 DNA:SNP: :rs7574865 (human) RGD
Only show annotations with direct experimental evidence (0 objects hidden)
Stat4 Rat (S)-amphetamine decreases expression ISO RGD:1313965 6480464 Dextroamphetamine results in decreased expression of STAT4 mRNA CTD PMID:12205029 Stat4 Rat (S)-amphetamine multiple interactions ISO RGD:1313965 6480464 SOD1 inhibits the reaction [Dextroamphetamine results in decreased expression of STAT4 mRNA] CTD PMID:12205029 Stat4 Rat 1,2-dimethylhydrazine increases expression ISO RGD:1313965 6480464 1,2-Dimethylhydrazine results in increased expression of STAT4 mRNA CTD PMID:22206623 Stat4 Rat 1-chloro-2,4-dinitrobenzene increases expression ISO RGD:1313964 6480464 Dinitrochlorobenzene results in increased expression of STAT4 mRNA CTD PMID:17374397 Stat4 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:1313965 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of STAT4 mRNA CTD PMID:17942748 Stat4 Rat 17alpha-ethynylestradiol affects expression ISO RGD:1313965 6480464 Ethinyl Estradiol affects the expression of STAT4 mRNA CTD PMID:17555576 Stat4 Rat 17beta-estradiol multiple interactions ISO RGD:1313964 6480464 [Estradiol binds to ESR2 protein] which results in increased expression of STAT4 mRNA; [Estradiol co-treated more ... CTD PMID:20404318|PMID:30165855 Stat4 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1313965 6480464 Tetrachlorodibenzodioxin affects the expression of STAT4 mRNA CTD PMID:24058054 Stat4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases phosphorylation ISO RGD:1313965 6480464 Tetrachlorodibenzodioxin results in increased phosphorylation of STAT4 protein CTD PMID:18684927 Stat4 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1313965 6480464 Tetrachlorodibenzodioxin results in increased expression of STAT4 mRNA CTD PMID:18684927|PMID:37172768 Stat4 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1313965 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of STAT4 mRNA CTD PMID:17942748 Stat4 Rat 6alpha-methylprednisolone decreases expression ISO RGD:1313964 6480464 Methylprednisolone results in decreased expression of STAT4 mRNA CTD PMID:19192274 Stat4 Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9,10-Dimethyl-1,2-benzanthracene results in increased expression of STAT4 mRNA CTD PMID:19480007 Stat4 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of STAT4 mRNA CTD PMID:31881176 Stat4 Rat aconitine increases expression EXP 6480464 Aconitine results in increased expression of STAT4 protein CTD PMID:33236894 Stat4 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of STAT4 mRNA CTD PMID:28959563 Stat4 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of STAT4 mRNA CTD PMID:16483693 Stat4 Rat antigen multiple interactions ISO RGD:1313965 6480464 [deoxynivalenol results in increased susceptibility to Antigens] which results in increased expression of STAT4 mRNA; more ... CTD PMID:28935500 Stat4 Rat antimycin A decreases expression ISO RGD:1313964 6480464 Antimycin A results in decreased expression of STAT4 mRNA CTD PMID:33512557 Stat4 Rat aristolochic acid A decreases expression ISO RGD:1313964 6480464 aristolochic acid I results in decreased expression of STAT4 mRNA CTD PMID:33212167 Stat4 Rat arsane increases methylation ISO RGD:1313964 6480464 Arsenic results in increased methylation of STAT4 promoter CTD PMID:21291286 Stat4 Rat arsenic atom increases methylation ISO RGD:1313964 6480464 Arsenic results in increased methylation of STAT4 promoter CTD PMID:21291286 Stat4 Rat arsenous acid multiple interactions ISO RGD:1313964 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to STAT4 protein] CTD PMID:26598702 Stat4 Rat azoxystrobin decreases expression ISO RGD:1313964 6480464 azoxystrobin results in decreased expression of STAT4 mRNA CTD PMID:33512557 Stat4 Rat benzene increases expression ISO RGD:1313964 6480464 Benzene results in increased expression of STAT4 mRNA CTD PMID:16188087|PMID:19162166|PMID:20036648 Stat4 Rat benzo[a]pyrene increases expression ISO RGD:1313965 6480464 Benzo(a)pyrene results in increased expression of STAT4 mRNA CTD PMID:22228805 Stat4 Rat benzo[a]pyrene decreases methylation ISO RGD:1313964 6480464 Benzo(a)pyrene results in decreased methylation of STAT4 promoter CTD PMID:27901495 Stat4 Rat benzo[a]pyrene increases expression ISO RGD:1313964 6480464 Benzo(a)pyrene results in increased expression of STAT4 mRNA CTD PMID:32234424 Stat4 Rat benzo[a]pyrene affects methylation ISO RGD:1313964 6480464 Benzo(a)pyrene affects the methylation of STAT4 3' UTR CTD PMID:27901495 Stat4 Rat benzo[a]pyrene affects response to substance ISO RGD:1313964 6480464 STAT4 gene SNP affects the susceptibility to Benzo(a)pyrene CTD PMID:28807506 Stat4 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of STAT4 mRNA CTD PMID:25181051|PMID:27178563 Stat4 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of STAT4 mRNA CTD PMID:34947998 Stat4 Rat bisphenol A affects methylation ISO RGD:1313965 6480464 bisphenol A affects the methylation of STAT4 promoter CTD PMID:27334623 Stat4 Rat buta-1,3-diene decreases expression ISO RGD:1313965 6480464 1,3-butadiene results in decreased expression of STAT4 mRNA CTD PMID:29038090 Stat4 Rat cadmium dichloride decreases expression ISO RGD:1313964 6480464 Cadmium Chloride results in decreased expression of STAT4 mRNA CTD PMID:38568856 Stat4 Rat carbon nanotube affects expression ISO RGD:1313965 6480464 Nanotubes, Carbon affects the expression of STAT4 mRNA CTD PMID:25554681 Stat4 Rat chlorophyllin multiple interactions ISO RGD:1313965 6480464 chlorophyllin inhibits the reaction [Lipopolysaccharides results in increased activity of STAT4 protein] CTD PMID:16275627 Stat4 Rat choline multiple interactions ISO RGD:1313965 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Stat4 Rat cisplatin increases expression ISO RGD:1313964 6480464 Cisplatin results in increased expression of STAT4 mRNA CTD PMID:27392435 Stat4 Rat cisplatin multiple interactions ISO RGD:1313964 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of STAT4 mRNA CTD PMID:27392435 Stat4 Rat crocidolite asbestos decreases expression ISO RGD:1313964 6480464 Asbestos, Crocidolite results in decreased expression of STAT4 mRNA CTD PMID:18687144 Stat4 Rat curcumin multiple interactions ISO RGD:1313964 6480464 Curcumin promotes the reaction [IFNB1 protein results in increased phosphorylation of STAT4 protein] CTD PMID:17979888 Stat4 Rat cyclosporin A increases expression ISO RGD:1313964 6480464 Cyclosporine results in increased expression of STAT4 mRNA CTD PMID:33631201 Stat4 Rat cyclosporin A decreases expression ISO RGD:1313964 6480464 Cyclosporine results in decreased expression of STAT4 mRNA CTD PMID:27989131 Stat4 Rat cypermethrin decreases expression EXP 6480464 cypermethrin results in decreased expression of STAT4 mRNA CTD PMID:22528246 Stat4 Rat cypermethrin decreases expression ISO RGD:1313965 6480464 cypermethrin results in decreased expression of STAT4 mRNA CTD PMID:31659573 Stat4 Rat cypermethrin multiple interactions ISO RGD:1313965 6480464 Sodium Selenite inhibits the reaction [cypermethrin results in decreased expression of STAT4 mRNA] CTD PMID:31659573 Stat4 Rat deguelin decreases expression ISO RGD:1313964 6480464 deguelin results in decreased expression of STAT4 mRNA CTD PMID:33512557 Stat4 Rat deoxynivalenol multiple interactions ISO RGD:1313965 6480464 [deoxynivalenol results in increased susceptibility to Antigens] which results in increased expression of STAT4 mRNA CTD PMID:28935500 Stat4 Rat diarsenic trioxide multiple interactions ISO RGD:1313964 6480464 Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to STAT4 protein] CTD PMID:26598702 Stat4 Rat diclofenac decreases expression ISO RGD:1313964 6480464 Diclofenac results in decreased expression of STAT4 mRNA CTD PMID:19192274 Stat4 Rat disodium selenite multiple interactions ISO RGD:1313965 6480464 Sodium Selenite inhibits the reaction [cypermethrin results in decreased expression of STAT4 mRNA] CTD PMID:31659573 Stat4 Rat disodium selenite increases expression ISO RGD:1313964 6480464 Sodium Selenite results in increased expression of STAT4 mRNA CTD PMID:18175754 Stat4 Rat dorsomorphin multiple interactions ISO RGD:1313964 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Stat4 Rat doxorubicin decreases expression ISO RGD:1313964 6480464 Doxorubicin results in decreased expression of STAT4 mRNA CTD PMID:29803840 Stat4 Rat doxorubicin increases expression ISO RGD:1313965 6480464 Doxorubicin results in increased expression of STAT4 mRNA CTD PMID:36227756 Stat4 Rat eugenol increases expression ISO RGD:1313964 6480464 Eugenol results in increased expression of STAT4 mRNA CTD PMID:17374397 Stat4 Rat folic acid multiple interactions ISO RGD:1313965 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Stat4 Rat genistein decreases expression ISO RGD:1313965 6480464 Genistein results in decreased expression of STAT4 mRNA CTD PMID:32186404 Stat4 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of STAT4 mRNA CTD PMID:22061828 Stat4 Rat L-methionine multiple interactions ISO RGD:1313965 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression more ... CTD PMID:20938992 Stat4 Rat leptomycin B affects localization ISO RGD:1313964 6480464 leptomycin B affects the localization of STAT4 protein CTD PMID:15004198 Stat4 Rat lipopolysaccharide multiple interactions ISO RGD:1313965 6480464 [Quercetin co-treated with Lipopolysaccharides] results in decreased expression of STAT4 mRNA; chlorophyllin inhibits the reaction more ... CTD PMID:16275627|PMID:38823456 Stat4 Rat lipopolysaccharide increases phosphorylation ISO RGD:1313965 6480464 Lipopolysaccharides results in increased phosphorylation of STAT4 protein CTD PMID:38823456 Stat4 Rat lipopolysaccharide increases expression ISO RGD:1313964 6480464 Lipopolysaccharides results in increased expression of STAT4 mRNA CTD PMID:35811015 Stat4 Rat lipopolysaccharide multiple interactions ISO RGD:1313964 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of STAT4 mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Stat4 Rat maneb multiple interactions ISO RGD:1313965 6480464 [Maneb co-treated with Paraquat] results in decreased expression of STAT4 mRNA; Melatonin inhibits the reaction more ... CTD PMID:23963992 Stat4 Rat melatonin multiple interactions ISO RGD:1313965 6480464 Melatonin inhibits the reaction [[Maneb co-treated with Paraquat] results in decreased expression of STAT4 mRNA] CTD PMID:23963992 Stat4 Rat methotrexate increases expression ISO RGD:1313964 6480464 Methotrexate results in increased expression of STAT4 mRNA CTD PMID:17400583 Stat4 Rat N-methyl-N-nitrosourea increases response to substance ISO RGD:1313965 6480464 STAT4 gene mutant form results in increased susceptibility to Methylnitrosourea CTD PMID:11418001 Stat4 Rat nickel atom increases expression ISO RGD:1313964 6480464 Nickel results in increased expression of STAT4 mRNA CTD PMID:25583101 Stat4 Rat nickel sulfate increases expression ISO RGD:1313964 6480464 nickel sulfate results in increased expression of STAT4 mRNA CTD PMID:16780908|PMID:17374397 Stat4 Rat ochratoxin A multiple interactions ISO RGD:1313965 6480464 [ochratoxin A results in increased susceptibility to Antigens] which results in increased expression of STAT4 more ... CTD PMID:28935500 Stat4 Rat okadaic acid increases expression ISO RGD:1313964 6480464 Okadaic Acid results in increased expression of STAT4 mRNA CTD PMID:38832940 Stat4 Rat ozone multiple interactions ISO RGD:1313965 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ... CTD PMID:34911549 Stat4 Rat paracetamol increases expression ISO RGD:1313964 6480464 Acetaminophen results in increased expression of STAT4 mRNA CTD PMID:26690555 Stat4 Rat paraquat multiple interactions ISO RGD:1313965 6480464 [Maneb co-treated with Paraquat] results in decreased expression of STAT4 mRNA; Melatonin inhibits the reaction more ... CTD PMID:23963992 Stat4 Rat perfluorooctanoic acid increases expression ISO RGD:1313964 6480464 perfluorooctanoic acid results in increased expression of STAT4 mRNA CTD PMID:36326898 Stat4 Rat perfluorooctanoic acid increases expression ISO RGD:1313965 6480464 perfluorooctanoic acid results in increased expression of STAT4 protein CTD PMID:36214631|PMID:37422089 Stat4 Rat perfluorooctanoic acid increases activity ISO RGD:1313964 6480464 perfluorooctanoic acid results in increased activity of STAT4 protein CTD PMID:27589886 Stat4 Rat phenytoin decreases expression ISO RGD:1313964 6480464 Phenytoin results in decreased expression of STAT4 mRNA CTD PMID:14741686 Stat4 Rat picoxystrobin decreases expression ISO RGD:1313964 6480464 picoxystrobin results in decreased expression of STAT4 mRNA CTD PMID:33512557 Stat4 Rat piroxicam decreases expression ISO RGD:1313964 6480464 Piroxicam results in decreased expression of STAT4 mRNA CTD PMID:19192274 Stat4 Rat prednisolone decreases expression ISO RGD:1313964 6480464 Prednisolone results in decreased expression of STAT4 mRNA CTD PMID:19192274 Stat4 Rat propanal increases expression ISO RGD:1313964 6480464 propionaldehyde results in increased expression of STAT4 mRNA CTD PMID:26079696 Stat4 Rat quercetin multiple interactions ISO RGD:1313965 6480464 [Quercetin co-treated with Lipopolysaccharides] results in decreased expression of STAT4 mRNA; Quercetin inhibits the reaction more ... CTD PMID:38823456 Stat4 Rat rotenone decreases expression ISO RGD:1313964 6480464 Rotenone results in decreased expression of STAT4 mRNA CTD PMID:33512557 Stat4 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:1313964 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of STAT4 mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Stat4 Rat SB 431542 multiple interactions ISO RGD:1313964 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Stat4 Rat serpentine asbestos increases expression ISO RGD:1313964 6480464 Asbestos, Serpentine results in increased expression of STAT4 mRNA CTD PMID:24160326 Stat4 Rat silicon dioxide increases expression ISO RGD:1313965 6480464 Silicon Dioxide results in increased expression of STAT4 mRNA CTD PMID:29341224 Stat4 Rat silicon dioxide decreases expression ISO RGD:1313964 6480464 Silicon Dioxide analog results in decreased expression of STAT4 mRNA CTD PMID:25895662 Stat4 Rat sodium arsenite increases expression ISO RGD:1313964 6480464 sodium arsenite results in increased expression of STAT4 mRNA CTD PMID:29301061 Stat4 Rat sunitinib decreases expression ISO RGD:1313964 6480464 Sunitinib results in decreased expression of STAT4 mRNA CTD PMID:31533062 Stat4 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of STAT4 mRNA CTD PMID:34492290 Stat4 Rat titanium dioxide decreases expression ISO RGD:1313965 6480464 titanium dioxide results in decreased expression of STAT4 mRNA CTD PMID:29264374|PMID:32333507 Stat4 Rat toluene increases expression ISO RGD:1313965 6480464 Toluene results in increased expression of STAT4 mRNA CTD PMID:21601613 Stat4 Rat trichostatin A increases expression ISO RGD:1313964 6480464 trichostatin A results in increased expression of STAT4 mRNA CTD PMID:24935251 Stat4 Rat trimellitic anhydride increases expression ISO RGD:1313965 6480464 trimellitic anhydride results in increased expression of STAT4 mRNA CTD PMID:19042947 Stat4 Rat triphenyl phosphate affects expression ISO RGD:1313964 6480464 triphenyl phosphate affects the expression of STAT4 mRNA CTD PMID:37042841 Stat4 Rat valproic acid decreases expression ISO RGD:1313964 6480464 Valproic Acid results in decreased expression of STAT4 mRNA CTD PMID:26272509 Stat4 Rat valproic acid increases expression ISO RGD:1313964 6480464 Valproic Acid results in increased expression of STAT4 mRNA CTD PMID:24935251 Stat4 Rat valproic acid multiple interactions ISO RGD:1313964 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Stat4 Rat valproic acid affects expression ISO RGD:1313964 6480464 Valproic Acid affects the expression of STAT4 mRNA CTD PMID:25979313 Stat4 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of STAT4 gene CTD PMID:31682807 Stat4 Rat zinc atom increases activity ISO RGD:1313964 6480464 Zinc deficiency results in increased activity of STAT4 protein CTD PMID:18356318 Stat4 Rat zinc(0) increases activity ISO RGD:1313964 6480464 Zinc deficiency results in increased activity of STAT4 protein CTD PMID:18356318
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(S)-amphetamine (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 6alpha-methylprednisolone (ISO) 7,12-dimethyltetraphene (EXP) acetamide (EXP) aconitine (EXP) acrylamide (EXP) ammonium chloride (EXP) antigen (ISO) antimycin A (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) azoxystrobin (ISO) benzene (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) buta-1,3-diene (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) chlorophyllin (ISO) choline (ISO) cisplatin (ISO) crocidolite asbestos (ISO) curcumin (ISO) cyclosporin A (ISO) cypermethrin (EXP,ISO) deguelin (ISO) deoxynivalenol (ISO) diarsenic trioxide (ISO) diclofenac (ISO) disodium selenite (ISO) dorsomorphin (ISO) doxorubicin (ISO) eugenol (ISO) folic acid (ISO) genistein (ISO) gentamycin (EXP) L-methionine (ISO) leptomycin B (ISO) lipopolysaccharide (ISO) maneb (ISO) melatonin (ISO) methotrexate (ISO) N-methyl-N-nitrosourea (ISO) nickel atom (ISO) nickel sulfate (ISO) ochratoxin A (ISO) okadaic acid (ISO) ozone (ISO) paracetamol (ISO) paraquat (ISO) perfluorooctanoic acid (ISO) phenytoin (ISO) picoxystrobin (ISO) piroxicam (ISO) prednisolone (ISO) propanal (ISO) quercetin (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) serpentine asbestos (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sunitinib (ISO) thioacetamide (EXP) titanium dioxide (ISO) toluene (ISO) trichostatin A (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) valproic acid (ISO) vinclozolin (EXP) zinc atom (ISO) zinc(0) (ISO)
1.
Disease susceptibility genes shared by primary biliary cirrhosis and Crohn's disease in the Japanese population.
Aiba Y, etal., J Hum Genet. 2015 Sep;60(9):525-31. doi: 10.1038/jhg.2015.59. Epub 2015 Jun 18.
2.
Further evidence of subphenotype association with systemic lupus erythematosus susceptibility loci: a European cases only study.
Alonso-Perez E, etal., PLoS One. 2012;7(9):e45356. doi: 10.1371/journal.pone.0045356. Epub 2012 Sep 26.
3.
Simvastatin treatment ameliorates autoimmune disease associated with accelerated atherosclerosis in a murine lupus model.
Aprahamian T, etal., J Immunol. 2006 Sep 1;177(5):3028-34.
4.
Inactivation of the transcription factor STAT-4 prevents inflammation-driven fibrosis in animal models of systemic sclerosis.
Avouac J, etal., Arthritis Rheum. 2011 Mar;63(3):800-9. doi: 10.1002/art.30171.
5.
Role of Stat4-mediated signal transduction events in the generation of aggressor CD4+ T cells in herpetic stromal keratitis pathogenesis.
Banerjee K, etal., J Interferon Cytokine Res. 2007 Jan;27(1):65-75.
6.
Comprehensive assessment of rheumatoid arthritis susceptibility loci in a large psoriatic arthritis cohort.
Bowes J, etal., Ann Rheum Dis. 2012 Aug;71(8):1350-4. doi: 10.1136/annrheumdis-2011-200802. Epub 2012 Feb 10.
7.
Evidence for activation of inflammatory lipoxygenase pathways in visceral adipose tissue of obese Zucker rats.
Chakrabarti SK, etal., Am J Physiol Endocrinol Metab. 2011 Jan;300(1):E175-87. Epub 2010 Oct 26.
8.
Chronic exposure to staphylococcal superantigen elicits a systemic inflammatory disease mimicking lupus.
Chowdhary VR, etal., J Immunol. 2012 Aug 15;189(4):2054-62. doi: 10.4049/jimmunol.1201097. Epub 2012 Jul 13.
9.
STAT4 is a genetic risk factor for systemic sclerosis having additive effects with IRF5 on disease susceptibility and related pulmonary fibrosis.
Dieude P, etal., Arthritis Rheum. 2009 Aug;60(8):2472-9. doi: 10.1002/art.24688.
10.
Jak-Stat signaling pathway may play a role in the pathogenesis of cholesteatoma.
Eskiizmir G, etal., Am J Otolaryngol. 2014 Mar-Apr;35(2):130-6. doi: 10.1016/j.amjoto.2013.10.005. Epub 2013 Oct 30.
11.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
12.
STAT4 is a confirmed genetic risk factor for Sjogren's syndrome and could be involved in type 1 interferon pathway signaling.
Gestermann N, etal., Genes Immun. 2010 Jul;11(5):432-8. doi: 10.1038/gene.2010.29. Epub 2010 Jun 10.
13.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
14.
Polymorphisms in TBX21 and STAT4 increase the risk of systemic sclerosis: evidence of possible gene-gene interaction and alterations in Th1/Th2 cytokines.
Gourh P, etal., Arthritis Rheum. 2009 Dec;60(12):3794-806. doi: 10.1002/art.24958.
15.
Polymorphisms of signal transducers and activators of transcription 1 and 4 (STAT1 and STAT4) contribute to progression of childhood IgA nephropathy.
Hahn WH, etal., Cytokine. 2010 Apr;50(1):69-74. doi: 10.1016/j.cyto.2009.12.004. Epub 2010 Jan 4.
16.
Disruption of the STAT4 signaling pathway protects from autoimmune diabetes while retaining antiviral immune competence.
Holz A, etal., J Immunol. 1999 Nov 15;163(10):5374-82.
17.
Identification of a susceptibility locus in STAT4 for Behcet's disease in Han Chinese in a genome-wide association study.
Hou S, etal., Arthritis Rheum. 2012 Dec;64(12):4104-13. doi: 10.1002/art.37708.
18.
STAT4 polymorphism in a Chinese Han population with Vogt-Koyanagi-Harada syndrome and Behcet's disease.
Hu K, etal., Hum Immunol. 2010 Jul;71(7):723-6. doi: 10.1016/j.humimm.2010.04.007. Epub 2010 May 14.
19.
STAT expression and localization in the central nervous system during autoimmune encephalomyelitis in Lewis rats.
Jee Y, etal., J Neuroimmunol. 2001 Mar 1;114(1-2):40-7.
20.
STAT4 gene polymorphisms are associated with susceptibility and ANA status in primary biliary cirrhosis.
Joshita S, etal., Dis Markers. 2014;2014:727393. doi: 10.1155/2014/727393. Epub 2014 Feb 4.
21.
Role of STAT4 polymorphisms in systemic lupus erythematosus in a Japanese population: a case-control association study of the STAT1-STAT4 region.
Kawasaki A, etal., Arthritis Res Ther. 2008;10(5):R113. doi: 10.1186/ar2516. Epub 2008 Sep 19.
22.
Signaling through the JAK/STAT pathway, recent advances and future challenges.
Kisseleva T, etal., Gene 2002 Feb 20;285(1-2):1-24.
23.
Variant form of STAT4 is associated with primary Sjogren's syndrome.
Korman BD, etal., Genes Immun. 2008 Apr;9(3):267-70. doi: 10.1038/gene.2008.1. Epub 2008 Feb 14.
24.
Favored T helper 1 response in a mouse model of hepatosteatosis is associated with enhanced T cell-mediated hepatitis.
Kremer M, etal., Hepatology. 2006 Jul;44(1):216-27. doi: 10.1002/hep.21221.
25.
Differential requirement of signal transducer and activator of transcription-4 (Stat4) and Stat6 in a thyrotropin receptor-289-adenovirus-induced model of Graves' hyperthyroidism.
Land KJ, etal., Endocrinology. 2006 Jan;147(1):111-9. Epub 2005 Sep 29.
26.
[Effect of Radix Astragali on signal transducer and activator of transcription activator-4 and its mRNA expression in a rat model of asthma]
Li CC, etal., Zhonghua Er Ke Za Zhi. 2007 Oct;45(10):727-31.
27.
Association of STAT4 and PTPN22 polymorphisms and their interactions with type-1 autoimmune hepatitis susceptibility in Chinese Han children.
Li X, etal., Oncotarget. 2017 Apr 27;8(37):60933-60940. doi: 10.18632/oncotarget.17458. eCollection 2017 Sep 22.
28.
STAT4 genetic polymorphisms association with spontaneous clearance of hepatitis B virus infection.
Lu Y, etal., Immunol Res. 2015 Jun;62(2):146-52. doi: 10.1007/s12026-015-8645-1.
29.
JANEX-1, a JAK3 inhibitor, protects pancreatic islets from cytokine toxicity through downregulation of NF-kappaB activation and the JAK/STAT pathway.
Lv N, etal., Exp Cell Res. 2009 Jul 15;315(12):2064-71. doi: 10.1016/j.yexcr.2009.04.021. Epub 2009 May 3.
30.
Pivotal role of signal transducer and activator of transcription (Stat)4 and Stat6 in the innate immune response during sepsis.
Matsukawa A, etal., J Exp Med. 2001 Mar 19;193(6):679-88.
31.
Targeting transcription factor Stat4 uncovers a role for interleukin-18 in the pathogenesis of severe lupus nephritis in mice.
Menke J, etal., Kidney Int. 2011 Feb;79(4):452-63. Epub 2010 Oct 27.
32.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
33.
The JAK-STAT signaling pathway: input and output integration.
Murray PJ J Immunol. 2007 Mar 1;178(5):2623-9.
34.
Quantitative PCR on 5 genes reliably identifies CTCL patients with 5% to 99% circulating tumor cells with 90% accuracy.
Nebozhyn M, etal., Blood. 2006 Apr 15;107(8):3189-96. Epub 2006 Jan 10.
35.
STAT4 is critical for immunity but not for antileishmanial activity of antimonials in experimental visceral leishmaniasis.
Oghumu S, etal., Eur J Immunol. 2014 Feb;44(2):450-9. doi: 10.1002/eji.201343477. Epub 2013 Nov 15.
36.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
37.
Influence of STAT4 polymorphism in primary Sjogren's syndrome.
Palomino-Morales RJ, etal., J Rheumatol. 2010 May;37(5):1016-9. doi: 10.3899/jrheum.091007. Epub 2010 Apr 1.
38.
Activation of the 12-lipoxygenase and signal transducer and activator of transcription pathway during neointima formation in a model of the metabolic syndrome.
Pei H, etal., Am J Physiol Endocrinol Metab. 2006 Jan;290(1):E92-E102. Epub 2005 Aug 23.
39.
Contribution of STAT4 gene single-nucleotide polymorphism to systemic lupus erythematosus in the Polish population.
Piotrowski P, etal., Mol Biol Rep. 2012 Sep;39(9):8861-6. doi: 10.1007/s11033-012-1752-3. Epub 2012 Jun 24.
40.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
41.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
42.
GOA pipeline
RGD automated data pipeline
43.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
44.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
45.
Comprehensive gene review and curation
RGD comprehensive gene curation
46.
Peptide YY attenuates STAT1 and STAT3 activation induced by TNF-alpha in acinar cell line AR42J.
Robinson K, etal., J Am Coll Surg. 2006 May;202(5):788-96.
47.
Cytokine and chemokine expression associated with steatohepatitis and hepatocyte proliferation in rats fed ethanol via total enteral nutrition.
Ronis MJ, etal., Exp Biol Med (Maywood). 2008 Mar;233(3):344-55. doi: 10.3181/0707-RM-203.
48.
The STAT4 gene influences the genetic predisposition to systemic sclerosis phenotype.
Rueda B, etal., Hum Mol Genet. 2009 Jun 1;18(11):2071-7. doi: 10.1093/hmg/ddp119. Epub 2009 Mar 13.
49.
Phenotypic associations of genetic susceptibility loci in systemic lupus erythematosus.
Sanchez E, etal., Ann Rheum Dis. 2011 Jun 30.
50.
Association of variants in innate immune genes with asthma and eczema.
Sharma S, etal., Pediatr Allergy Immunol. 2012 Jun;23(4):315-23. doi: 10.1111/j.1399-3038.2011.01243.x. Epub 2011 Dec 23.
51.
JAK/STAT/SOCS-signaling pathway and colon and rectal cancer.
Slattery ML, etal., Mol Carcinog. 2013 Feb;52(2):155-66. doi: 10.1002/mc.21841. Epub 2011 Nov 28.
52.
STAT-4 mediated IL-12 signaling pathway is critical for the development of protective immunity in cutaneous leishmaniasis.
Stamm LM, etal., Eur J Immunol. 1999 Aug;29(8):2524-9.
53.
Positive association between STAT4 polymorphisms and polymyositis/dermatomyositis in a Japanese population.
Sugiura T, etal., Ann Rheum Dis. 2012 Oct;71(10):1646-50. doi: 10.1136/annrheumdis-2011-200839. Epub 2012 Mar 8.
54.
Association between a C8orf13-BLK polymorphism and polymyositis/dermatomyositis in the Japanese population: an additive effect with STAT4 on disease susceptibility.
Sugiura T, etal., PLoS One. 2014 Mar 14;9(3):e90019. doi: 10.1371/journal.pone.0090019. eCollection 2014.
55.
STAT4 regulates antiviral gamma interferon responses and recurrent disease during herpes simplex virus 2 infection.
Svensson A, etal., J Virol. 2012 Sep;86(17):9409-15. doi: 10.1128/JVI.00947-12. Epub 2012 Jun 20.
56.
Specificity of the STAT4 genetic association for severe disease manifestations of systemic lupus erythematosus.
Taylor KE, etal., PLoS Genet. 2008 May 30;4(5):e1000084. doi: 10.1371/journal.pgen.1000084.
57.
Genetic risk factors in lupus nephritis and IgA nephropathy--no support of an overlap.
Vuong MT, etal., PLoS One. 2010 May 10;5(5):e10559. doi: 10.1371/journal.pone.0010559.
58.
[Relationship of reduced lung function with Th1/Th2 polarization, STAT4/6 expression in rats of chronic obstructive pulmonary disease].
Wang C and Li Z, Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi. 2013 Dec;29(12):1233-6.
59.
STAT4 knockout mice are more susceptible to concanavalin A-induced T-cell hepatitis.
Wang Y, etal., Am J Pathol. 2014 Jun;184(6):1785-94. doi: 10.1016/j.ajpath.2014.02.023. Epub 2014 Apr 13.
60.
Polymorphisms in STAT4 increase the risk of acute renal allograft rejection in the Chinese population.
Yang H, etal., Transpl Immunol. 2011 May;24(4):216-9. doi: 10.1016/j.trim.2011.01.001. Epub 2011 Jan 13.
61.
STAT4 is a genetic risk factor for systemic sclerosis in a Chinese population.
Yi L, etal., Int J Immunopathol Pharmacol. 2013 Apr-Jun;26(2):473-8.
62.
Role of hepatic resident and infiltrating macrophages in liver repair after acute injury.
You Q, etal., Biochem Pharmacol. 2013 Sep 15;86(6):836-43. doi: 10.1016/j.bcp.2013.07.006. Epub 2013 Jul 19.
63.
STAT4 gene polymorphism is associated with psoriasis in the genetically homogeneous population of Crete, Greece.
Zervou MI, etal., Hum Immunol. 2009 Sep;70(9):738-41. doi: 10.1016/j.humimm.2009.05.008. Epub 2009 Jun 17.
64.
[Single nucleotide polymorphism of STAT4 rs7574865 is associated with the susceptibility of primary biliary cirrhosis in Han population of partial regions of Jiangsu province].
Zheng L and Zhou H, Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi. 2017 Apr;33(4):521-525.
Stat4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 56,964,617 - 57,080,523 (-) NCBI GRCr8 mRatBN7.2 9 49,472,660 - 49,588,540 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 49,419,340 - 49,588,540 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 58,021,896 - 58,130,745 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 63,144,732 - 63,253,572 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 61,440,716 - 61,549,562 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 54,340,649 - 54,457,753 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 54,287,541 - 54,484,533 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 54,051,154 - 54,167,491 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 46,510,251 - 46,650,076 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 46,511,665 - 46,651,490 (-) NCBI Celera 9 47,135,713 - 47,243,684 (-) NCBI Celera Cytogenetic Map 9 q22 NCBI
STAT4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 191,029,576 - 191,151,596 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 191,029,576 - 191,178,435 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 191,894,302 - 192,016,322 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 191,602,551 - 191,724,170 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 191,719,811 - 191,841,431 NCBI Celera 2 185,488,908 - 185,610,548 (-) NCBI Celera Cytogenetic Map 2 q32.2-q32.3 NCBI HuRef 2 183,753,956 - 183,875,743 (-) NCBI HuRef CHM1_1 2 191,900,128 - 192,022,113 (-) NCBI CHM1_1 T2T-CHM13v2.0 2 191,518,699 - 191,663,236 (-) NCBI T2T-CHM13v2.0
Stat4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 52,026,265 - 52,146,348 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 52,026,307 - 52,146,348 (+) Ensembl GRCm39 Ensembl GRCm38 1 51,987,106 - 52,107,189 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 51,987,148 - 52,107,189 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 52,065,088 - 52,164,028 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 51,952,789 - 52,051,729 (+) NCBI MGSCv36 mm8 Celera 1 52,546,764 - 52,645,629 (+) NCBI Celera Cytogenetic Map 1 C1.1 NCBI cM Map 1 26.67 NCBI
Stat4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955403 8,061,471 - 8,144,276 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955403 8,061,471 - 8,144,252 (+) NCBI ChiLan1.0 ChiLan1.0
STAT4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 93,711,969 - 93,930,627 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 93,727,052 - 93,945,611 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 78,331,402 - 78,549,231 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 196,247,617 - 196,394,154 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 196,247,881 - 196,366,011 (-) Ensembl panpan1.1 panPan2
STAT4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 37 1,566,563 - 1,685,378 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 37 1,566,585 - 1,829,894 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 37 2,514,598 - 2,633,404 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 37 1,453,968 - 1,572,676 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 37 1,453,990 - 1,550,821 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 37 1,463,313 - 1,581,898 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 37 1,431,241 - 1,549,848 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 37 1,459,885 - 1,578,875 (-) NCBI UU_Cfam_GSD_1.0
Stat4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 149,652,139 - 149,767,224 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936506 7,095,009 - 7,184,689 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936506 7,091,982 - 7,185,938 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
STAT4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 95,656,077 - 95,763,472 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 95,656,206 - 95,764,099 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 106,914,582 - 106,960,243 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Sscrofa10.2 15 107,069,138 - 107,073,997 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
STAT4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 76,553,626 - 76,708,540 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 76,553,606 - 76,674,928 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 122,773,405 - 122,923,766 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Stat4
.
Predicted Target Of
Count of predictions: 82 Count of miRNA genes: 66 Interacting mature miRNAs: 72 Transcripts: ENSRNOT00000020032 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
7411571 Bw138 Body weight QTL 138 14.3 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 9 32535505 77535505 Rat 1300180 Bw14 Body weight QTL 14 3.776 body mass (VT:0001259) body weight (CMO:0000012) 9 23754024 61381613 Rat 11353957 Bmd92 Bone mineral density QTL 92 0.01 tibia mineral mass (VT:1000283) volumetric bone mineral density (CMO:0001553) 9 46114199 91114199 Rat 631680 Cm11 Cardiac mass QTL 11 3.1 0.00089 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 9 20430519 65430519 Rat 70218 Cm28 Cardiac mass QTL 28 8.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 9 25268044 79271759 Rat 724544 Uae9 Urinary albumin excretion QTL 9 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 9 25268044 114175309 Rat 7207805 Bmd88 Bone mineral density QTL 88 4 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 9 23754024 58157242 Rat 631643 Bp120 Blood pressure QTL 120 3 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 22071200 67071200 Rat 12879506 Pur33 Proteinuria QTL 33 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 44649921 89649921 Rat 731164 Uae25 Urinary albumin excretion QTL 25 3.5 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 25661188 100929786 Rat 10058949 Gmadr5 Adrenal mass QTL 5 2 0.014 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 9 42791513 87976209 Rat 9589133 Insul26 Insulin level QTL 26 17.96 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 9 8952560 53952560 Rat 631656 Bp108 Blood pressure QTL 108 5.97 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 48598251 93598251 Rat 631211 Bw4 Body weight QTL4 5.31 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 9 5109826 50109826 Rat 7411609 Foco16 Food consumption QTL 16 25.6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 8952560 53952560 Rat 8662828 Vetf6 Vascular elastic tissue fragility QTL 6 3.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 9 36962359 92058970 Rat 61352 Bp34 Blood pressure QTL 34 5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 42495343 79271511 Rat 6903937 Bp356 Blood pressure QTL 356 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 47902208 52283252 Rat 1598834 Memor11 Memory QTL 11 2.5 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 9 36962359 77814038 Rat 70186 Niddm26 Non-insulin dependent diabetes mellitus QTL 26 3.87 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 9 22071169 86369743 Rat 7207814 Bmd91 Bone mineral density QTL 91 3.5 femur size trait (VT:1000369) femoral neck cross-sectional area (CMO:0001697) 9 23754144 83851531 Rat 6903941 Pur31 Proteinuria QTL 31 0.036 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 9 40194188 85194188 Rat 2290450 Scl57 Serum cholesterol level QTL 57 4.15 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 9 36962359 95410867 Rat 11353949 Bp393 Blood pressure QTL 393 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 40194188 85194188 Rat 11353951 Bp394 Blood pressure QTL 394 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 44649921 89649921 Rat 10054125 Srcrt7 Stress Responsive Cort QTL 7 3.33 0.0011 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 9 1 87073594 Rat 11353947 Bp392 Blood pressure QTL 392 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 7283252 52283252 Rat 1331757 Cdexp1 CD45RC expression in CD8 T cells QTL 1 4.3 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 9 1024537 67509080 Rat 7411656 Foco26 Food consumption QTL 26 9.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 32535505 77535505 Rat 1598823 Memor16 Memory QTL 16 1.9 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) 9 22133322 49968732 Rat 1641894 Alcrsp12 Alcohol response QTL 12 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 9 27468639 72468639 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
6
6
31
34
30
18
6
18
6
58
24
19
10
19
12
Too many to show, limit is 500. Download them if you would like to view them all.
RefSeq Acc Id:
NM_001012226 ⟹ NP_001012226
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 56,964,617 - 57,080,523 (-) NCBI mRatBN7.2 9 49,472,660 - 49,588,540 (-) NCBI Rnor_6.0 9 54,340,649 - 54,457,753 (-) NCBI Rnor_5.0 9 54,051,154 - 54,167,491 (-) NCBI RGSC_v3.4 9 46,510,251 - 46,650,076 (-) RGD Celera 9 47,135,713 - 47,243,684 (-) RGD
Sequence:
CCGGAAAGGGCAGACACTGGGAACCTTCACAGGAGTTGGCCCAAACCTGAGTAAGGCTGTCCTCTCATAAGAGAGCAGACCCTGCTGGAGGTTGGTGTGTTGATCCTGGTTCCCTGGTCTCTCTTTCC
hide sequence
RefSeq Acc Id:
NP_001012226 ⟸ NM_001012226
- UniProtKB:
Q66HB2 (UniProtKB/TrEMBL), F7FAC1 (UniProtKB/TrEMBL)
- Sequence:
MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIETQDWEVASNNETMATILLQNLLIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAANMPIQGPLE
hide sequence
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-12-06
Stat4
signal transducer and activator of transcription 4
Stat4_predicted
signal transducer and activator of transcription 4 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Stat4_predicted
signal transducer and activator of transcription 4 (predicted)
Symbol and Name status set to approved
70820 APPROVED
