Symbol:
Zmpste24
Name:
zinc metallopeptidase STE24
RGD ID:
1305570
Description:
Predicted to enable double-stranded DNA binding activity and metalloendopeptidase activity. Predicted to be involved in CAAX-box protein processing. Predicted to act upstream of or within several processes, including heart development; regulation of intracellular signal transduction; and regulation of primary metabolic process. Predicted to be located in membrane and nuclear envelope. Predicted to be part of protein-containing complex. Predicted to be active in endoplasmic reticulum membrane. Human ortholog(s) of this gene implicated in mandibuloacral dysplasia type B lipodystrophy; restrictive dermopathy; and restrictive dermopathy 1. Orthologous to human ZMPSTE24 (zinc metallopeptidase STE24); INTERACTS WITH acetamide; bisphenol A; gentamycin.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
CAAX prenyl protease 1 homolog; LOC313564; zinc metallopeptidase, STE24 homolog; zinc metallopeptidase, STE24 homolog (S. cerevisiae); zinc metalloproteinase, STE24 homolog; zinc metalloproteinase, STE24 homolog (S. cerevisiae)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ZMPSTE24 (zinc metallopeptidase STE24)
HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Zmpste24 (zinc metallopeptidase, STE24)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Zmpste24 (zinc metallopeptidase STE24)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ZMPSTE24 (zinc metallopeptidase STE24)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ZMPSTE24 (zinc metallopeptidase STE24)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Zmpste24 (zinc metallopeptidase STE24)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ZMPSTE24 (zinc metallopeptidase STE24)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ZMPSTE24 (zinc metallopeptidase STE24)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Zmpste24 (zinc metallopeptidase STE24)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
RGMA (repulsive guidance molecule BMP co-receptor a)
HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
ZMPSTE24 (zinc metallopeptidase STE24)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Zmpste24 (zinc metallopeptidase, STE24)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
zmpste24 (zinc metallopeptidase, STE24 homolog)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
fce-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG7573
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):
STE24
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
ste24a
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
ste24c
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
ste24b
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
zmpste24
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 139,912,395 - 139,945,532 (-) NCBI GRCr8 mRatBN7.2 5 134,627,218 - 134,660,360 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 134,627,229 - 134,660,110 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 137,355,779 - 137,387,791 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 139,112,274 - 139,144,282 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 139,132,865 - 139,164,877 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 139,982,404 - 140,015,541 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 139,983,680 - 140,015,541 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 143,777,121 - 143,808,982 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 141,644,119 - 141,677,211 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 141,649,218 - 141,682,222 (-) NCBI Celera 5 133,182,210 - 133,213,802 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Zmpste24 Rat (1->4)-beta-D-glucan multiple interactions ISO Zmpste24 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ZMPSTE24 mRNA CTD PMID:36331819 Zmpste24 Rat 1,2-dimethylhydrazine decreases expression ISO Zmpste24 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of ZMPSTE24 mRNA CTD PMID:22206623 Zmpste24 Rat 1,2-dimethylhydrazine multiple interactions ISO Zmpste24 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ZMPSTE24 mRNA CTD PMID:22206623 Zmpste24 Rat 17alpha-ethynylestradiol multiple interactions ISO Zmpste24 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ZMPSTE24 mRNA CTD PMID:17942748 Zmpste24 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Zmpste24 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ZMPSTE24 mRNA CTD PMID:17942748 Zmpste24 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Zmpste24 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ZMPSTE24 mRNA CTD PMID:31961203 Zmpste24 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Zmpste24 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ZMPSTE24 mRNA CTD PMID:20702594 and PMID:21570461 Zmpste24 Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO Zmpste24 (Mus musculus) 6480464 2 more ... CTD PMID:20702594 Zmpste24 Rat 4,4'-sulfonyldiphenol decreases expression ISO Zmpste24 (Mus musculus) 6480464 bisphenol S results in decreased expression of ZMPSTE24 mRNA CTD PMID:39298647 Zmpste24 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of ZMPSTE24 mRNA CTD PMID:31881176 Zmpste24 Rat acrylamide increases expression ISO ZMPSTE24 (Homo sapiens) 6480464 Acrylamide results in increased expression of ZMPSTE24 mRNA CTD PMID:32763439 Zmpste24 Rat aflatoxin B1 increases methylation ISO ZMPSTE24 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of ZMPSTE24 gene CTD PMID:27153756 Zmpste24 Rat arsane multiple interactions ISO ZMPSTE24 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ZMPSTE24 mRNA CTD PMID:39836092 Zmpste24 Rat arsenic atom multiple interactions ISO ZMPSTE24 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ZMPSTE24 mRNA CTD PMID:39836092 Zmpste24 Rat arsenous acid increases expression ISO ZMPSTE24 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ZMPSTE24 mRNA CTD PMID:20458559 Zmpste24 Rat atrazine decreases expression ISO ZMPSTE24 (Homo sapiens) 6480464 Atrazine results in decreased expression of ZMPSTE24 mRNA CTD PMID:22378314 Zmpste24 Rat benzo[a]pyrene increases expression ISO Zmpste24 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ZMPSTE24 mRNA CTD PMID:22228805 Zmpste24 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ZMPSTE24 mRNA CTD PMID:25181051 Zmpste24 Rat bisphenol A increases expression ISO ZMPSTE24 (Homo sapiens) 6480464 bisphenol A results in increased expression of ZMPSTE24 protein CTD PMID:34186270 Zmpste24 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ZMPSTE24 mRNA CTD PMID:34947998 Zmpste24 Rat bisphenol A increases methylation ISO Zmpste24 (Mus musculus) 6480464 bisphenol A results in increased methylation of ZMPSTE24 promoter CTD PMID:27312807 Zmpste24 Rat Bisphenol B increases expression ISO ZMPSTE24 (Homo sapiens) 6480464 bisphenol B results in increased expression of ZMPSTE24 protein CTD PMID:34186270 Zmpste24 Rat cadmium atom multiple interactions ISO ZMPSTE24 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ZMPSTE24 mRNA CTD PMID:35301059 Zmpste24 Rat cadmium atom multiple interactions ISO Zmpste24 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ZMPSTE24 mRNA CTD PMID:37325564 Zmpste24 Rat cadmium dichloride multiple interactions ISO ZMPSTE24 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ZMPSTE24 mRNA CTD PMID:35301059 Zmpste24 Rat cadmium dichloride multiple interactions ISO Zmpste24 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ZMPSTE24 mRNA CTD PMID:37325564 Zmpste24 Rat CGP 52608 multiple interactions ISO ZMPSTE24 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ZMPSTE24 gene] CTD PMID:28238834 Zmpste24 Rat copper(II) sulfate decreases expression ISO ZMPSTE24 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of ZMPSTE24 mRNA CTD PMID:19549813 Zmpste24 Rat cyclosporin A decreases expression ISO ZMPSTE24 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ZMPSTE24 mRNA CTD PMID:25562108 Zmpste24 Rat dextran sulfate multiple interactions ISO Zmpste24 (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of ZMPSTE24 protein] CTD PMID:35362542 Zmpste24 Rat dextran sulfate increases expression ISO Zmpste24 (Mus musculus) 6480464 Dextran Sulfate results in increased expression of ZMPSTE24 protein CTD PMID:35362542 Zmpste24 Rat diarsenic trioxide increases expression ISO ZMPSTE24 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of ZMPSTE24 mRNA CTD PMID:20458559 Zmpste24 Rat dicrotophos decreases expression ISO ZMPSTE24 (Homo sapiens) 6480464 dicrotophos results in decreased expression of ZMPSTE24 mRNA CTD PMID:28302478 Zmpste24 Rat dioxygen decreases expression ISO ZMPSTE24 (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of ZMPSTE24 mRNA CTD PMID:24236059 Zmpste24 Rat ethanol affects splicing ISO Zmpste24 (Mus musculus) 6480464 Ethanol affects the splicing of ZMPSTE24 mRNA CTD PMID:30319688 Zmpste24 Rat Evodiamine multiple interactions ISO Zmpste24 (Mus musculus) 6480464 evodiamine inhibits the reaction [Dextran Sulfate results in increased expression of ZMPSTE24 protein] CTD PMID:35362542 Zmpste24 Rat folic acid multiple interactions ISO Zmpste24 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of ZMPSTE24 mRNA CTD PMID:22206623 Zmpste24 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of ZMPSTE24 mRNA CTD PMID:33387578 Zmpste24 Rat gold atom decreases expression ISO ZMPSTE24 (Homo sapiens) 6480464 Gold results in decreased expression of ZMPSTE24 mRNA CTD PMID:25523186 Zmpste24 Rat gold(0) decreases expression ISO ZMPSTE24 (Homo sapiens) 6480464 Gold results in decreased expression of ZMPSTE24 mRNA CTD PMID:25523186 Zmpste24 Rat hydralazine multiple interactions ISO ZMPSTE24 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of ZMPSTE24 mRNA CTD PMID:17183730 Zmpste24 Rat hydrogen peroxide affects expression ISO ZMPSTE24 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of ZMPSTE24 mRNA CTD PMID:20044591 Zmpste24 Rat ivermectin decreases expression ISO ZMPSTE24 (Homo sapiens) 6480464 Ivermectin results in decreased expression of ZMPSTE24 protein CTD PMID:32959892 Zmpste24 Rat lead(0) affects expression ISO ZMPSTE24 (Homo sapiens) 6480464 Lead affects the expression of ZMPSTE24 mRNA CTD PMID:28903495 Zmpste24 Rat lopinavir decreases activity ISO ZMPSTE24 (Homo sapiens) 6480464 Lopinavir results in decreased activity of ZMPSTE24 protein CTD PMID:18230615 Zmpste24 Rat okadaic acid increases expression ISO ZMPSTE24 (Homo sapiens) 6480464 Okadaic Acid results in increased expression of ZMPSTE24 mRNA CTD PMID:38832940 Zmpste24 Rat ozone multiple interactions ISO ZMPSTE24 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of ZMPSTE24 mRNA CTD PMID:35430440 Zmpste24 Rat paracetamol affects expression ISO Zmpste24 (Mus musculus) 6480464 Acetaminophen affects the expression of ZMPSTE24 mRNA CTD PMID:17562736 Zmpste24 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Zmpste24 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of ZMPSTE24 mRNA CTD PMID:36331819 Zmpste24 Rat phenobarbital affects expression ISO Zmpste24 (Mus musculus) 6480464 Phenobarbital affects the expression of ZMPSTE24 mRNA CTD PMID:19136022 Zmpste24 Rat pirinixic acid affects expression ISO Zmpste24 (Mus musculus) 6480464 pirinixic acid affects the expression of ZMPSTE24 mRNA CTD PMID:19136022 Zmpste24 Rat pirinixic acid decreases expression ISO Zmpste24 (Mus musculus) 6480464 pirinixic acid results in decreased expression of ZMPSTE24 mRNA CTD PMID:17426115 and PMID:17950772 Zmpste24 Rat pirinixic acid multiple interactions ISO Zmpste24 (Mus musculus) 6480464 PPARA protein promotes the reaction [pirinixic acid results in decreased expression of ZMPSTE24 mRNA] CTD PMID:17950772 Zmpste24 Rat piroxicam decreases expression ISO ZMPSTE24 (Homo sapiens) 6480464 Piroxicam results in decreased expression of ZMPSTE24 mRNA CTD PMID:21858171 Zmpste24 Rat quercetin decreases expression ISO ZMPSTE24 (Homo sapiens) 6480464 Quercetin results in decreased expression of ZMPSTE24 mRNA CTD PMID:21632981 Zmpste24 Rat resveratrol multiple interactions ISO Zmpste24 (Mus musculus) 6480464 Resveratrol inhibits the reaction [ZMPSTE24 gene mutant form results in increased acetylation of FOXO3 protein] more ... CTD PMID:23217256 Zmpste24 Rat ritonavir decreases activity ISO ZMPSTE24 (Homo sapiens) 6480464 Ritonavir results in decreased activity of ZMPSTE24 protein CTD PMID:18230615 Zmpste24 Rat sodium arsenite multiple interactions ISO ZMPSTE24 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ZMPSTE24 mRNA CTD PMID:39836092 Zmpste24 Rat sodium fluoride decreases expression ISO Zmpste24 (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of ZMPSTE24 protein CTD PMID:28918527 Zmpste24 Rat thiram decreases expression ISO ZMPSTE24 (Homo sapiens) 6480464 Thiram results in decreased expression of ZMPSTE24 mRNA CTD PMID:38568856 Zmpste24 Rat valproic acid multiple interactions ISO ZMPSTE24 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of ZMPSTE24 mRNA CTD PMID:17183730 Zmpste24 Rat valproic acid increases expression ISO ZMPSTE24 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ZMPSTE24 mRNA CTD PMID:23179753 Zmpste24 Rat valproic acid affects expression ISO ZMPSTE24 (Homo sapiens) 6480464 Valproic Acid affects the expression of ZMPSTE24 mRNA CTD PMID:25979313
Biological Process
adult walking behavior (IEA,ISO) biological_process (ND) bone mineralization (IEA,ISO) CAAX-box protein processing (IBA,IEA) calcium ion import into sarcoplasmic reticulum (IEA,ISO) CAMKK-AMPK signaling cascade (IEA,ISO) cardiac conduction (IEA,ISO) cardiac muscle cell development (IEA,ISO) cardiac ventricle development (IEA,ISO) cellular response to gamma radiation (IEA,ISO) chromatin organization (IEA,ISO) chromosome organization (IEA,ISO) determination of adult lifespan (IEA,ISO) DNA damage response (IEA,ISO) DNA repair (IEA,ISO) epidermis development (IEA,ISO) epigenetic regulation of gene expression (IEA,ISO) growth plate cartilage development (IEA,ISO) hair follicle development (IEA,ISO) heart morphogenesis (IEA,ISO) inflammatory cell apoptotic process (IEA,ISO) kidney morphogenesis (IEA,ISO) lipid metabolic process (IEA,ISO) liver development (IEA,ISO) maintenance of rDNA (IEA,ISO) multicellular organism growth (IEA,ISO) negative regulation of gene expression (IEA,ISO) negative regulation of miRNA processing (IEA,ISO) neuromuscular process (IEA,ISO) nuclear envelope organization (IEA,ISO) nucleus organization (IEA,ISO) positive regulation of gene expression (IEA,ISO) positive regulation of gene expression via chromosomal CpG island demethylation (IEA,ISO) prenylated protein catabolic process (IEA,ISO) protein maturation (IEA,ISO) protein processing (IEA,ISO) proteolysis (IEA) regulation of autophagy (IEA,ISO) regulation of blood circulation (IEA,ISO) regulation of bone mineralization (IEA,ISO) regulation of cell shape (IEA,ISO) regulation of cellular senescence (IEA,ISO) regulation of defense response to virus (IEA,ISO) regulation of DNA damage response, signal transduction by p53 class mediator (IEA,ISO) regulation of DNA-templated transcription (IEA,ISO) regulation of fibroblast proliferation (IEA,ISO) regulation of glucose metabolic process (IEA,ISO) regulation of heart contraction (IEA,ISO) regulation of hormone metabolic process (IEA,ISO) regulation of lipid metabolic process (IEA,ISO) regulation of mitotic cell cycle (IEA,ISO) regulation of mitotic cell cycle DNA replication (IEA,ISO) regulation of multicellular organism growth (IEA,ISO) regulation of stress-activated protein kinase signaling cascade (IEA,ISO) regulation of termination of RNA polymerase I transcription (IEA,ISO) regulation of TOR signaling (IEA,ISO) regulation of ventricular cardiac muscle cell membrane repolarization (IEA,ISO) response to DNA damage checkpoint signaling (IEA,ISO) thymus development (IEA,ISO) ventricular cardiac muscle tissue development (IEA,ISO)
1.
Zinc metalloproteinase, ZMPSTE24, is mutated in mandibuloacral dysplasia.
Agarwal AK, etal., Hum Mol Genet. 2003 Aug 15;12(16):1995-2001.
2.
Microcephalia with mandibular and dental dysplasia in adult Zmpste24-deficient mice.
de Carlos F, etal., J Anat. 2008 Nov;213(5):509-19. doi: 10.1111/j.1469-7580.2008.00970.x.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Homozygous and compound heterozygous mutations in ZMPSTE24 cause the laminopathy restrictive dermopathy.
Moulson CL, etal., J Invest Dermatol. 2005 Nov;125(5):913-9.
7.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
8.
Proteomic profiling of adipose tissue from Zmpste24-/- mice, a model of lipodystrophy and premature aging, reveals major changes in mitochondrial function and vimentin processing.
Peinado JR, etal., Mol Cell Proteomics. 2011 Nov;10(11):M111.008094. doi: 10.1074/mcp.M111.008094. Epub 2011 Aug 9.
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Comprehensive gene review and curation
RGD comprehensive gene curation
Zmpste24 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 139,912,395 - 139,945,532 (-) NCBI GRCr8 mRatBN7.2 5 134,627,218 - 134,660,360 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 134,627,229 - 134,660,110 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 137,355,779 - 137,387,791 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 139,112,274 - 139,144,282 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 139,132,865 - 139,164,877 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 139,982,404 - 140,015,541 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 139,983,680 - 140,015,541 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 143,777,121 - 143,808,982 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 141,644,119 - 141,677,211 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 141,649,218 - 141,682,222 (-) NCBI Celera 5 133,182,210 - 133,213,802 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
ZMPSTE24 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 40,258,236 - 40,294,180 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 40,258,041 - 40,294,180 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 40,723,908 - 40,759,852 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 40,496,320 - 40,532,443 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 40,392,871 - 40,428,944 NCBI Celera 1 39,006,122 - 39,042,251 (+) NCBI Celera Cytogenetic Map 1 p34.2 NCBI HuRef 1 38,842,523 - 38,878,354 (+) NCBI HuRef CHM1_1 1 40,839,331 - 40,875,788 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 40,127,713 - 40,163,687 (+) NCBI T2T-CHM13v2.0
Zmpste24 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 120,916,434 - 120,955,452 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 120,916,434 - 120,955,438 (-) Ensembl GRCm39 Ensembl GRCm38 4 121,059,237 - 121,098,249 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 121,059,237 - 121,098,241 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 120,731,843 - 120,770,848 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 120,556,873 - 120,595,878 (-) NCBI MGSCv36 mm8 Celera 4 119,770,178 - 119,809,143 (-) NCBI Celera Cytogenetic Map 4 D2.2 NCBI cM Map 4 56.8 NCBI
Zmpste24 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955537 81,920 - 134,609 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955537 82,724 - 134,609 (+) NCBI ChiLan1.0 ChiLan1.0
ZMPSTE24 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 186,522,556 - 186,570,943 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 185,660,166 - 185,708,577 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 39,545,264 - 39,589,721 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 40,869,076 - 40,912,747 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 40,869,076 - 40,912,747 (+) Ensembl panpan1.1 panPan2
ZMPSTE24 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 2,669,546 - 2,708,480 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 2,670,326 - 2,709,160 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 2,927,171 - 2,965,754 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 2,756,132 - 2,794,814 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 2,756,136 - 2,794,865 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 2,663,629 - 2,702,258 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 2,723,834 - 2,762,460 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 2,739,878 - 2,778,521 (-) NCBI UU_Cfam_GSD_1.0
Zmpste24 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 56,210,295 - 56,253,058 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 22,034,801 - 22,077,986 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 22,035,059 - 22,077,846 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ZMPSTE24 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 96,008,455 - 96,062,951 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 96,008,307 - 96,057,131 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 89,129,860 - 89,133,461 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ZMPSTE24 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 92,605,495 - 92,648,110 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 92,605,309 - 92,648,114 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 24,227,800 - 24,273,781 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Zmpste24 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 39 Count of miRNA genes: 38 Interacting mature miRNAs: 38 Transcripts: ENSRNOT00000016410 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 1300122 Wbc1 White blood cell count QTL 1 2.75 leukocyte quantity (VT:0000217) total white blood cell count (CMO:0000365) 5 125392826 139989768 Rat 7365049 Bp359 Blood pressure QTL 359 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128071929 134724733 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 1331803 Rf32 Renal function QTL 32 2.798 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 129132428 143070159 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
RH135308
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 134,628,889 - 134,629,104 (+) MAPPER mRatBN7.2 Rnor_6.0 5 139,984,076 - 139,984,290 NCBI Rnor6.0 Rnor_5.0 5 143,777,517 - 143,777,731 UniSTS Rnor5.0 RGSC_v3.4 5 141,644,515 - 141,644,729 UniSTS RGSC3.4 Celera 5 133,182,606 - 133,182,820 UniSTS RH 3.4 Map 5 877.1 UniSTS Cytogenetic Map 5 q36 UniSTS
AI175477
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 134,627,279 - 134,627,383 (+) MAPPER mRatBN7.2 Rnor_6.0 5 139,982,466 - 139,982,569 NCBI Rnor6.0 Rnor_5.0 5 143,775,907 - 143,776,010 UniSTS Rnor5.0 RGSC_v3.4 5 141,642,905 - 141,643,008 UniSTS RGSC3.4 Celera 5 133,180,996 - 133,181,099 UniSTS RH 3.4 Map 5 888.9 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016410 ⟹ ENSRNOP00000016410
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 134,627,229 - 134,660,110 (-) Ensembl Rnor_6.0 Ensembl 5 139,983,680 - 140,015,541 (-) Ensembl
RefSeq Acc Id:
NM_001107974 ⟹ NP_001101444
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 139,913,671 - 139,945,532 (-) NCBI mRatBN7.2 5 134,628,494 - 134,660,360 (-) NCBI Rnor_6.0 5 139,983,680 - 140,015,541 (-) NCBI Rnor_5.0 5 143,777,121 - 143,808,982 (-) NCBI RGSC_v3.4 5 141,644,119 - 141,677,211 (-) RGD Celera 5 133,182,210 - 133,213,802 (-) RGD
Sequence:
CCCAGGAAGAAGTCCCGGAACCTTTGAGTTTGAGTCCCGCGCGCAGAATCCGGAGTGATGTTTCAGGTGCACCGCCGCTCAGTCTTCGGGCCGGAAATGGGAAAGGTGGGGCAAGTCTTATTCTAGCA GAATATATAGGTCCTTGAGAAGCCGGAGGGGGAAGAGTGTCTTTGTGACACTGCTGGCAAAGCTAAGGGGATGGGCGTCTGAAGAAGCCTTCGGAAAGGACCCGTATCGTGGTGACACCACTGGCACT TTCTGAGGGACGCGTGTCGGTGTGGCACCGGTGCTAGCCGAAGGAGCGGGTCAGATTGGGTGACCATGGGGATGTGGGCATCGGTGGACGCTATGTGGGACTTCCCTGCGGAGAAGCGAATCTTCGGG GCGGTGTTGCTCTTTTCCTGGACCGTGTATCTTTGGGAGACCTTCCTAGCACAGCGGCAGAGAAGGATATACAAAACAACGACTCATGTACCACCAGAGTTAGAACAGATCATGGATTCGGACACATT TGAGAAATCACGACTGTATCAACTGGATAAAAGTACATTCAGCTTCTGGTCAGGACTCTATTCAGAGGTGGAAGGCACTTTTATTCTTCTCTTTGGAGGAATCCCTTACCTCTGGAGACTTTCTGGAC GGTTCTGTAGTTCTGCTGGCTTCGGACCAGAATATGAGATCATTCAGTCGTTGGTGTTCCTGCTGTTGGCTACACTCTTCAGTGCACTGACTGGCTTGCCATGGAGTCTGTACAATACTTTCGTGATA GAAGAAAAGCATGGCTTCAATCACCAGACTTTGGAGTTTTTTATGAAAGATGCAATCAAAAAATTTATTGTGACTCAGTGTATTTTATTGCCTGTGTCTTCCCTTCTGCTTTACATTATTAAAATCGG AGGTGACTACTTTTTTATCTATGCCTGGCTGTTCACATTAGTTGTTTCTCTGGTTCTTGTCACAATTTATGCTGATTATATTGCCCCTTTGTTTGACAAGTTCACACCTCTACCGGAGGGGAAACTTA AGCAGGAAATCGAAGTGATGGCGAAGAGTATTGACTTCCCCCTGACTAAGGTGTATGTCGTTGAAGGATCTAAGCGCTCCTCCCACAGCAATGCTTACTTTTATGGCTTCTTCAAGAACAAGAGAATA GTTTTGTTTGACACTCTACTAGAAGAGTACTCTGTACCAAACAAAGACAACCAGGAGGAGCCTGGCCTGGAGCCCCGCAATGAAGGCGAAGGGGACAGTGAAGAAGTAAAGTCTAAAGTGAAAAATAA GAAACAAGGATGTAAAAATGAGGAGGTACTAGCTGTACTTGGCCATGAACTGGGGCACTGGAAGTTGGGACACACAGTAAAAAATATCATTATTAGTCAGATGAATTCTTTCCTGTGTTTTTTCTTGT TTGCTGTATTAATTGGTCGAAGGGAACTTTTTGCCGCCTTTGGTTTTTATGACAGCCAACCCACTCTGATCGGACTTTTGATCATCTTTCAGTTTATTTTCTCACCTTACAATGAGGTTCTGTCTTTC TGCCTAACAGTCCTGAGCCGCAGATTTGAATTTCAAGCCGACGCTTTTGCCAAGAAACTTGGGAAGGCTAAAGACTTATATTCTGCTTTGATCAAGCTAAACAAAGATAACCTGGGCTTCCCAGTCTC TGACTGGCTGTTCTCAACATGGCACTATTCTCACCCTCCGCTTCTGGAGAGGCTTCAGGCTCTGAAAAATGCAAAACGAGACTGAGCCGCTCAGGCCCCATGACTGGACACACTTCTGGTTATTTCTG TCCTGGCAGCATGTTCCAGCTCTTGATGTTTTTAATTTTTTAAGAAAAATGATTACGTACATAAAGGTCCAGATTTAAATACATTTACTATCTCATTTCAAAAATGATTTTAATAATCCATTTCTTAA AACACTGGATAAAATTTTGAGGCTTAATATTTTTAAAGCATAGTTTTATCTAGCATCTGATTTGCCATCAATTTGTAAATGATTTAAGGAAATGCACAACTTGTTTGATTTCTGCACTATGTGGAATC TGCGTAGAGGGTTTTTAGGTCGTACGTTTAAAGGTGGAAACACCGCCTCCAAGCACTTTCTGCGGGGCAGAAACAAAAAGTGGTCCCAGATCACTGTGCTTGTGCCTACACAGGCTTCGCTTTTACCG TCACGCTGTTATGATTTAAC
hide sequence
RefSeq Acc Id:
XM_017593398 ⟹ XP_017448887
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 139,912,395 - 139,945,502 (-) NCBI mRatBN7.2 5 134,627,218 - 134,660,296 (-) NCBI Rnor_6.0 5 139,982,404 - 140,015,449 (-) NCBI
Sequence:
GGAAATGGGAAAGGTGGGGCAAGTCTTATTCTAGCAGAATATATAGGTCCTTGAGAAGCCGGAG GGGGAAGAGTGTCTTTGTGACACTGCTGGCAAAGCTAAGGGGATGGGCGTCTGAAGAAGCCTTCGGAAAGGACCCGTATCGTGGTGACACCACTGGCACTTTCTGAGGGACGCGTGTCGGTGTGGCAC CGGTGCTAGCCGAAGGAGCGGGTCAGATTGGGTGACCATGGGGATGTGGGCATCGGTGGACGCTATGTGGGACTTCCCTGCGGAGAAGCGAATCTTCGGGGCGGTGTTGCTCTTTTCCTGGACCGTGT ATCTTTGGGAGACCTTCCTAGCACAGCGGCAGTTTATTCTTCTCTTTGGAGGAATCCCTTACCTCTGGAGACTTTCTGGACGGTTCTGTAGTTCTGCTGGCTTCGGACCAGAATATGAGATCATTCAG TCGTTGGTGTTCCTGCTGTTGGCTACACTCTTCAGTGCACTGACTGGCTTGCCATGGAGTCTGTACAATACTTTCGTGATAGAAGAAAAGCATGGCTTCAATCACCAGACTTTGGAGTTTTTTATGAA AGATGCAATCAAAAAATTTATTGTGACTCAGTGTATTTTATTGCCTGTGTCTTCCCTTCTGCTTTACATTATTAAAATCGGAGGTGACTACTTTTTTATCTATGCCTGGCTGTTCACATTAGTTGTTT CTCTGGTTCTTGTCACAATTTATGCTGATTATATTGCCCCTTTGTTTGACAAGTTCACACCTCTACCGGAGGGGAAACTTAAGCAGGAAATCGAAGTGATGGCGAAGAGTATTGACTTCCCCCTGACT AAGGTGTATGTCGTTGAAGGATCTAAGCGCTCCTCCCACAGCAATGCTTACTTTTATGGCTTCTTCAAGAACAAGAGAATAGTTTTGTTTGACACTCTACTAGAAGAGTACTCTGTACCAAACAAAGA CAACCAGGAGGAGCCTGGCCTGGAGCCCCGCAATGAAGGCGAAGGGGACAGTGAAGAAGTAAAGTCTAAAGTGAAAAATAAGAAACAAGGATGTAAAAATGAGGAGGTACTAGCTGTACTTGGCCATG AACTGGGGCACTGGAAGTTGGGACACACAGTAAAAAATATCATTATTAGTCAGATGAATTCTTTCCTGTGTTTTTTCTTGTTTGCTGTATTAATTGGTCGAAGGGAACTTTTTGCCGCCTTTGGTTTT TATGACAGCCAACCCACTCTGATCGGACTTTTGATCATCTTTCAGTTTATTTTCTCACCTTACAATGAGGTTCTGTCTTTCTGCCTAACAGTCCTGAGCCGCAGATTTGAATTTCAAGCCGACGCTTT TGCCAAGAAACTTGGGAAGGCTAAAGACTTATATTCTGCTTTGATCAAGCTAAACAAAGATAACCTGGGCTTCCCAGTCTCTGACTGGCTGTTCTCAACATGGCACTATTCTCACCCTCCGCTTCTGG AGAGGCTTCAGGCTCTGAAAAATGCAAAACGAGACTGAGCCGCTCAGGCCCCATGACTGGACACACTTCTGGTTATTTCTGTCCTGGCAGCATGTTCCAGCTCTTGATGTTTTTAATTTTTTAAGAAA AATGATTACGTACATAAAGGTCCAGATTTAAATACATTTACTATCTCATTTCAAAAATGATTTTAATAATCCATTTCTTAAAACACTGGATAAAATTTTGAGGCTTAATATTTTTAAAGCATAGTTTT ATCTAGCATCTGATTTGCCATCAATTTGTAAATGATTTAAGGAAATGCACAACTTGTTTGATTTCTGCACTATGTGGAATCTGCGTAGAGGGTTTTTAGGTCGTACGTTTAAAGGTGGAAACACCGCC TCCAAGCACTTTCTGCGGGGCAGAAACAAAAAGTGGTCCCAGATCACTGTGCTTGTGCCTACACAGGCTTCGCTTTTACCGTCACGCTGTTATGATTTAACCGGCCAATCAGTGTTTTAAATAAGAAA GAAGAGTAAAAATTAGTAAGGCTAATGCTACTGAAATGAGTTGTTAGGCATGCTATACTGTTCCCTTTCTTGCCACAAATCAGGAATCCCTTCCCTCCTTCCTCTCTTCCTTCTTTTTTTTTTTTTTA ATTGACATAAGGTCTCACTCTAGTCCTTGCTGGCCCCAAACTCATTCTTTAGCACAAGGTGGCCTAGAACCCATGCCTCCTGCCTCAGTCTTCCTAATGTTGGGATTGCAGGTGTGAGCCACCACATA CAGCTTAGGAATTGTTAATAGTGCTTGAAATTAGAAACCTTTTAAATCACTGAGTTTGGGTTTGCTTTGAAGAAGGTCTTCATTTTAAACCAGGCTGGCAACACCTACATTTAATCTCAGCGGTTGAG GCAGAGGCAGGTGGACCTGTGAGCTGAGGCCAAGCCTGCCCTACAGAGCGAGTTCCAGGCCAGCCAGGACTCTGAGATGCTGTCTCAAAGGAGGGGAGTAGCAGTCAGTCACAGTTTTCATCCTCCTT CCACCAGCCTTATCAGGAACAATCTAGCCTTTCCTCATTCATTTTTTCCCAGTAAATAATAGTACATCCTTTTACTCCACAGAAGTTGCCATAGTGTATACATCTCCCAATGTGAATTATGGCAGAAT ATAAAAAAAAGAAGAGATGACGTTTGAAAAGACATAAAGGTGAAATATTCATGATTTTCTTATTACAGGAAAATCTAGTTTTCTATCTCTTTTTTCAAGGACAGAAGTCTCTGCTTTTATTTTTGTAA TTTTTTTATTCACAAATTATAATTAGACCCAACTCCATTTTTTAAAATTATAATTCTCGGTAGGCAGACAGTTGTTTACTTGCAGAGAAAGTGATTTCTGGTAGGAAAAGGTATGTGCTTGACTGCTT CGAATGTCTGTCCACGTCCTGAATGAGGACCACACTGCGCCTGCAGCTCCTGGTCACTGGCATCGAGCACCTCCTGGGCATTCACTCCACAGTGATCGACTGTGCACTGTGGTATCTGCGCTCTGCCG ACTGACGTGTGAGCGATGCCTGCACTTGGACCACAGTAGCGCCAGCTCTCATTCGGCACCGCATTGTTCATTTCCTACAGCTACGCAGAGCAGCCCACGGTTTCTCTCCAGCACCCTTTCCCGTGACT TCATGCTCAGACAACTGCCTTTCCTTCCTTCTGTGCCTTTAAAAACACATTTCAGTTCTGCACAAGTGAGACATTAAAAATTGCCAATGCAGATTTA
hide sequence
RefSeq Acc Id:
NP_001101444 ⟸ NM_001107974
- UniProtKB:
D4A5K6 (UniProtKB/TrEMBL), A6IS04 (UniProtKB/TrEMBL)
- Sequence:
MGMWASVDAMWDFPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELEQIMDSDTFEKSRLYQLDKSTFSFWSGLYSEVEGTFILLFGGIPYLWRLSGRFCSSAGFGPEYEIIQSLVFLL LATLFSALTGLPWSLYNTFVIEEKHGFNHQTLEFFMKDAIKKFIVTQCILLPVSSLLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKQEIEVMAKSIDFPLTKVYVVE GSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVPNKDNQEEPGLEPRNEGEGDSEEVKSKVKNKKQGCKNEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRRELFAAFGFYDSQPT LIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSTWHYSHPPLLERLQALKNAKRD
hide sequence
RefSeq Acc Id:
XP_017448887 ⟸ XM_017593398
- Peptide Label:
isoform X1
- Sequence:
MGMWASVDAMWDFPAEKRIFGAVLLFSWTVYLWETFLAQRQFILLFGGIPYLWRLSGRFCSSAGFGPEYEIIQSLVFLLLATLFSALTGLPWSLYNTFVIEEKHGFNHQTLEFFMKDAIKKFIVTQCI LLPVSSLLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKQEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVPNKDNQEEPGLEPRNE GEGDSEEVKSKVKNKKQGCKNEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRRELFAAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYS ALIKLNKDNLGFPVSDWLFSTWHYSHPPLLERLQALKNAKRD
hide sequence
Ensembl Acc Id:
ENSRNOP00000016410 ⟸ ENSRNOT00000016410
RGD ID: 13693995
Promoter ID: EPDNEW_R4520
Type: initiation region
Name: Zmpste24_1
Description: zinc metallopeptidase STE24
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 140,015,429 - 140,015,489 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-12-18
Zmpste24
zinc metallopeptidase STE24
Zmpste24
zinc metallopeptidase, STE24 homolog (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-04-30
Zmpste24
zinc metallopeptidase, STE24 homolog (S. cerevisiae)
Zmpste24_predicted
zinc metallopeptidase, STE24 homolog (S. cerevisiae) (predicted)
'predicted' is removed
2292626
APPROVED
2006-03-30
Zmpste24_predicted
zinc metallopeptidase, STE24 homolog (S. cerevisiae) (predicted)
zinc metalloproteinase, STE24 homolog (S. cerevisiae) (predicted)
Name updated
1299863
APPROVED
2005-01-12
Zmpste24_predicted
zinc metalloproteinase, STE24 homolog (S. cerevisiae) (predicted)
Symbol and Name status set to approved
70820
APPROVED