Symbol:
Map3k3
Name:
mitogen activated protein kinase kinase kinase 3
RGD ID:
1304575
Description:
Predicted to enable protein kinase activity. Predicted to be involved in positive regulation of canonical NF-kappaB signal transduction. Predicted to act upstream of or within several processes, including blood vessel development; positive regulation of p38MAPK cascade; and protein autophosphorylation. Orthologous to human MAP3K3 (mitogen-activated protein kinase kinase kinase 3); PARTICIPATES IN c-Jun N-terminal kinases MAPK signaling pathway; Erk5 MAPK signaling pathway; interleukin-1 signaling pathway; INTERACTS WITH 2,6-dinitrotoluene; amphetamine; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC303604; mitogen-activated protein kinase kinase kinase 3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 91,519,976 - 91,588,651 (+) NCBI GRCr8 mRatBN7.2 10 91,020,174 - 91,088,852 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 91,020,174 - 91,088,848 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 96,075,116 - 96,143,482 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 95,538,287 - 95,606,652 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 90,949,010 - 91,017,411 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 94,280,703 - 94,349,372 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 94,280,703 - 94,349,368 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 94,029,306 - 94,098,042 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 95,482,303 - 95,551,065 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 95,496,690 - 95,565,451 (+) NCBI Celera 10 89,696,294 - 89,764,939 (+) NCBI Celera Cytogenetic Map 10 q32.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Map3k3 Rat 1,2-dimethylhydrazine affects expression ISO Map3k3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of MAP3K3 mRNA CTD PMID:22206623 Map3k3 Rat 17beta-estradiol increases expression ISO MAP3K3 (Homo sapiens) 6480464 Estradiol results in increased expression of MAP3K3 mRNA CTD PMID:23094148 Map3k3 Rat 2,3',4,4',5-Pentachlorobiphenyl decreases expression ISO Map3k3 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Map3k3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Map3k3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MAP3K3 mRNA CTD PMID:21570461 Map3k3 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of MAP3K3 mRNA CTD PMID:21346803 Map3k3 Rat 2-hydroxypropanoic acid increases expression ISO MAP3K3 (Homo sapiens) 6480464 Lactic Acid results in increased expression of MAP3K3 mRNA CTD PMID:30851411 Map3k3 Rat 2-palmitoylglycerol increases expression ISO MAP3K3 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of MAP3K3 mRNA CTD PMID:37199045 Map3k3 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Map3k3 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of MAP3K3 mRNA CTD PMID:20188158 Map3k3 Rat 4-vinylcyclohexene dioxide affects expression ISO Map3k3 (Mus musculus) 6480464 4-vinyl-1-cyclohexene dioxide affects the expression of MAP3K3 mRNA CTD PMID:20829426 Map3k3 Rat 5-aza-2'-deoxycytidine multiple interactions ISO MAP3K3 (Homo sapiens) 6480464 [Decitabine co-treated with Depsipeptides] results in increased expression of MAP3K3 mRNA CTD PMID:17064661 Map3k3 Rat all-trans-retinoic acid increases expression ISO MAP3K3 (Homo sapiens) 6480464 Tretinoin results in increased expression of MAP3K3 mRNA CTD PMID:33167477 Map3k3 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of MAP3K3 mRNA CTD PMID:30779732 Map3k3 Rat arsenite(3-) multiple interactions ISO MAP3K3 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to MAP3K3 mRNA] CTD PMID:32406909 Map3k3 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO MAP3K3 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of MAP3K3 gene CTD PMID:33872906 Map3k3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of MAP3K3 mRNA CTD PMID:25181051 Map3k3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MAP3K3 mRNA CTD PMID:30816183 Map3k3 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of MAP3K3 gene CTD PMID:28505145 Map3k3 Rat bufalin decreases expression ISO MAP3K3 (Homo sapiens) 6480464 bufalin results in decreased expression of MAP3K3 protein CTD PMID:23949904 Map3k3 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of MAP3K3 mRNA CTD PMID:19167457 Map3k3 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of MAP3K3 mRNA CTD PMID:33453195 Map3k3 Rat caffeine affects phosphorylation ISO MAP3K3 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of MAP3K3 protein CTD PMID:35688186 Map3k3 Rat cannabidiol increases expression ISO MAP3K3 (Homo sapiens) 6480464 Cannabidiol results in increased expression of MAP3K3 mRNA CTD PMID:31801206 Map3k3 Rat copper atom multiple interactions ISO MAP3K3 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of MAP3K3 mRNA CTD PMID:30911355 Map3k3 Rat copper(0) multiple interactions ISO MAP3K3 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of MAP3K3 mRNA CTD PMID:30911355 Map3k3 Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of MAP3K3 mRNA CTD PMID:23640034 Map3k3 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of MAP3K3 mRNA CTD PMID:23914054 Map3k3 Rat deguelin affects expression ISO MAP3K3 (Homo sapiens) 6480464 deguelin affects the expression of MAP3K3 protein CTD PMID:25322282 Map3k3 Rat depsipeptide increases expression ISO MAP3K3 (Homo sapiens) 6480464 Depsipeptides results in increased expression of MAP3K3 mRNA CTD PMID:17064661 Map3k3 Rat depsipeptide multiple interactions ISO MAP3K3 (Homo sapiens) 6480464 [decitabine co-treated with Depsipeptides] results in increased expression of MAP3K3 mRNA CTD PMID:17064661 Map3k3 Rat diallyl disulfide affects expression ISO MAP3K3 (Homo sapiens) 6480464 diallyl disulfide affects the expression of MAP3K3 protein CTD PMID:21695758 Map3k3 Rat Diallyl sulfide affects expression ISO MAP3K3 (Homo sapiens) 6480464 allyl sulfide affects the expression of MAP3K3 protein CTD PMID:21695758 Map3k3 Rat diallyl trisulfide affects expression ISO MAP3K3 (Homo sapiens) 6480464 diallyl trisulfide affects the expression of MAP3K3 protein CTD PMID:21695758 Map3k3 Rat Dibutyl phosphate affects expression ISO MAP3K3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MAP3K3 mRNA CTD PMID:37042841 Map3k3 Rat dibutyl phthalate increases expression ISO Map3k3 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of MAP3K3 mRNA CTD PMID:21266533 Map3k3 Rat diquat decreases expression ISO Map3k3 (Mus musculus) 6480464 Diquat results in decreased expression of MAP3K3 protein CTD PMID:36851058 Map3k3 Rat fenthion increases expression ISO Map3k3 (Mus musculus) 6480464 Fenthion results in increased expression of MAP3K3 mRNA CTD PMID:34813904 Map3k3 Rat FR900359 affects phosphorylation ISO MAP3K3 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of MAP3K3 protein CTD PMID:37730182 Map3k3 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of MAP3K3 mRNA CTD PMID:22061828 Map3k3 Rat glyphosate decreases expression ISO MAP3K3 (Homo sapiens) 6480464 Glyphosate results in decreased expression of MAP3K3 mRNA CTD PMID:31295307 Map3k3 Rat hyaluronic acid multiple interactions ISO Map3k3 (Mus musculus) 6480464 MAP3K3 protein promotes the reaction [TGFB2 protein results in increased abundance of Hyaluronic Acid] CTD PMID:20633555 Map3k3 Rat manganese atom multiple interactions ISO MAP3K3 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of MAP3K3 mRNA CTD PMID:39836092 Map3k3 Rat manganese(0) multiple interactions ISO MAP3K3 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of MAP3K3 mRNA CTD PMID:39836092 Map3k3 Rat manganese(II) chloride multiple interactions ISO MAP3K3 (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] which results in decreased expression of MAP3K3 mRNA CTD PMID:39836092 Map3k3 Rat mercury dichloride decreases expression ISO MAP3K3 (Homo sapiens) 6480464 Mercuric Chloride results in decreased expression of MAP3K3 mRNA CTD PMID:27188386 Map3k3 Rat methidathion increases expression ISO Map3k3 (Mus musculus) 6480464 methidathion results in increased expression of MAP3K3 mRNA CTD PMID:34813904 Map3k3 Rat methoxychlor affects expression ISO Map3k3 (Mus musculus) 6480464 Methoxychlor affects the expression of MAP3K3 mRNA CTD PMID:20829426 Map3k3 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO MAP3K3 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in increased methylation of MAP3K3 gene CTD PMID:33872906 Map3k3 Rat monosodium L-glutamate decreases expression EXP 6480464 Sodium Glutamate results in decreased expression of MAP3K3 mRNA CTD PMID:28954212 Map3k3 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of MAP3K3 mRNA CTD PMID:25729387 Map3k3 Rat ozone multiple interactions ISO Map3k3 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of MAP3K3 mRNA CTD PMID:34911549 Map3k3 Rat p-menthan-3-ol decreases expression ISO MAP3K3 (Homo sapiens) 6480464 Menthol results in decreased expression of MAP3K3 mRNA CTD PMID:26760959 Map3k3 Rat paracetamol affects expression ISO Map3k3 (Mus musculus) 6480464 Acetaminophen affects the expression of MAP3K3 mRNA CTD PMID:17562736 Map3k3 Rat paracetamol increases expression ISO MAP3K3 (Homo sapiens) 6480464 Acetaminophen results in increased expression of MAP3K3 mRNA CTD PMID:22230336 Map3k3 Rat pirinixic acid multiple interactions ISO MAP3K3 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of MAP3K3 mRNA CTD PMID:19710929 Map3k3 Rat quercetin decreases expression ISO MAP3K3 (Homo sapiens) 6480464 Quercetin results in decreased expression of MAP3K3 protein CTD PMID:23645742 Map3k3 Rat rac-lactic acid increases expression ISO MAP3K3 (Homo sapiens) 6480464 Lactic Acid results in increased expression of MAP3K3 mRNA CTD PMID:30851411 Map3k3 Rat retinyl acetate increases expression ISO Map3k3 (Mus musculus) 6480464 retinol acetate results in increased expression of MAP3K3 mRNA CTD PMID:16772331 Map3k3 Rat thimerosal decreases expression ISO MAP3K3 (Homo sapiens) 6480464 Thimerosal results in decreased expression of MAP3K3 mRNA CTD PMID:27188386 Map3k3 Rat titanium dioxide increases methylation ISO Map3k3 (Mus musculus) 6480464 titanium dioxide results in increased methylation of MAP3K3 gene CTD PMID:35295148 Map3k3 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of MAP3K3 mRNA CTD PMID:25729387 Map3k3 Rat trichloroethene multiple interactions ISO Map3k3 (Mus musculus) 6480464 PPARA protein inhibits the reaction [Trichloroethylene results in decreased expression of MAP3K3 mRNA] CTD PMID:15363585 Map3k3 Rat triphenyl phosphate affects expression ISO MAP3K3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MAP3K3 mRNA CTD PMID:37042841 Map3k3 Rat urethane increases expression ISO MAP3K3 (Homo sapiens) 6480464 Urethane results in increased expression of MAP3K3 mRNA CTD PMID:28818685 Map3k3 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of MAP3K3 mRNA CTD PMID:23034163 Map3k3 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of MAP3K3 gene CTD PMID:31682807 Map3k3 Rat vorinostat decreases expression ISO MAP3K3 (Homo sapiens) 6480464 vorinostat results in decreased expression of MAP3K3 mRNA CTD PMID:27188386 Map3k3 Rat vorinostat increases expression ISO MAP3K3 (Homo sapiens) 6480464 vorinostat results in increased expression of MAP3K3 mRNA CTD PMID:22083351
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 2-palmitoylglycerol (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4-vinylcyclohexene dioxide (ISO) 5-aza-2'-deoxycytidine (ISO) all-trans-retinoic acid (ISO) amphetamine (EXP) arsenite(3-) (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) bufalin (ISO) C60 fullerene (EXP) cadmium dichloride (EXP) caffeine (ISO) cannabidiol (ISO) copper atom (ISO) copper(0) (ISO) decabromodiphenyl ether (EXP) deguelin (ISO) depsipeptide (ISO) diallyl disulfide (ISO) Diallyl sulfide (ISO) diallyl trisulfide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) diquat (ISO) fenthion (ISO) FR900359 (ISO) gentamycin (EXP) glyphosate (ISO) hyaluronic acid (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) mercury dichloride (ISO) methidathion (ISO) methoxychlor (ISO) mono(2-ethylhexyl) phthalate (ISO) monosodium L-glutamate (EXP) oxaliplatin (EXP) ozone (ISO) p-menthan-3-ol (ISO) paracetamol (ISO) pirinixic acid (ISO) quercetin (ISO) rac-lactic acid (ISO) retinyl acetate (ISO) thimerosal (ISO) titanium dioxide (ISO) topotecan (EXP) trichloroethene (ISO) triphenyl phosphate (ISO) urethane (ISO) vinclozolin (EXP) vorinostat (ISO)
1.
Mechanisms and functions of p38 MAPK signalling.
Cuadrado A and Nebreda AR, Biochem J. 2010 Aug 1;429(3):403-17. doi: 10.1042/BJ20100323.
2.
p38 MAP-kinases pathway regulation, function and role in human diseases.
Cuenda A and Rousseau S, Biochim Biophys Acta. 2007 Aug;1773(8):1358-75. Epub 2007 Mar 24.
3.
MEK kinases are regulated by EGF and selectively interact with Rac/Cdc42.
Fanger GR, etal., EMBO J. 1997 Aug 15;16(16):4961-72.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
The c-jun kinase/stress-activated pathway: regulation, function and role in human disease.
Johnson GL and Nakamura K, Biochim Biophys Acta. 2007 Aug;1773(8):1341-8. Epub 2007 Jan 4.
7.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
10.
GOA pipeline
RGD automated data pipeline
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Comprehensive gene review and curation
RGD comprehensive gene curation
13.
Regulation of cellular functions by the ERK5 signalling pathway.
Wang X and Tournier C, Cell Signal. 2006 Jun;18(6):753-60. Epub 2006 Jan 6.
Map3k3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 91,519,976 - 91,588,651 (+) NCBI GRCr8 mRatBN7.2 10 91,020,174 - 91,088,852 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 91,020,174 - 91,088,848 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 96,075,116 - 96,143,482 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 95,538,287 - 95,606,652 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 90,949,010 - 91,017,411 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 94,280,703 - 94,349,372 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 94,280,703 - 94,349,368 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 94,029,306 - 94,098,042 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 95,482,303 - 95,551,065 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 95,496,690 - 95,565,451 (+) NCBI Celera 10 89,696,294 - 89,764,939 (+) NCBI Celera Cytogenetic Map 10 q32.1 NCBI
MAP3K3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 63,622,417 - 63,696,305 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 63,622,415 - 63,696,305 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 61,699,777 - 61,773,665 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 59,053,533 - 59,127,402 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 59,053,532 - 59,127,401 NCBI Celera 17 56,087,919 - 56,161,790 (+) NCBI Celera Cytogenetic Map 17 q23.3 NCBI HuRef 17 57,077,975 - 57,141,816 (+) NCBI HuRef CHM1_1 17 61,764,216 - 61,838,082 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 64,493,028 - 64,567,209 (+) NCBI T2T-CHM13v2.0
Map3k3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 105,975,358 - 106,047,482 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 105,975,439 - 106,046,272 (+) Ensembl GRCm39 Ensembl GRCm38 11 106,084,587 - 106,156,656 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 106,084,613 - 106,155,446 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 105,946,216 - 106,016,760 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 105,900,992 - 105,971,536 (+) NCBI MGSCv36 mm8 Celera 11 117,815,382 - 117,885,664 (+) NCBI Celera Cytogenetic Map 11 E1 NCBI cM Map 11 68.89 NCBI
Map3k3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955478 8,125,436 - 8,199,253 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955478 8,122,999 - 8,185,138 (-) NCBI ChiLan1.0 ChiLan1.0
MAP3K3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 79,794,119 - 79,868,489 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 84,611,585 - 84,685,943 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 57,702,242 - 57,776,601 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 62,858,655 - 62,922,874 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 62,858,635 - 62,922,874 (+) Ensembl panpan1.1 panPan2
MAP3K3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 11,612,527 - 11,678,407 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 11,612,994 - 11,675,838 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 12,572,499 - 12,638,395 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 13,276,493 - 13,339,186 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 13,276,310 - 13,338,713 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 12,220,815 - 12,286,279 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 15,245,905 - 15,311,520 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 15,248,794 - 15,314,683 (-) NCBI UU_Cfam_GSD_1.0
Map3k3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 14,849,361 - 14,918,227 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936541 4,276,371 - 4,344,008 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936541 4,276,371 - 4,345,239 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MAP3K3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 12 15,230,182 - 15,298,784 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 12 15,228,979 - 15,298,784 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 12 15,215,673 - 15,285,409 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MAP3K3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 57,594,770 - 57,670,047 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 57,597,288 - 57,669,720 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 28,205,915 - 28,279,700 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Map3k3
.
Predicted Target Of
Count of predictions: 369 Count of miRNA genes: 190 Interacting mature miRNAs: 257 Transcripts: ENSRNOT00000011406 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
1549846 Scl47 Serum cholesterol level QTL 47 3.6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 50574707 95574707 Rat 1298069 Bp168 Blood pressure QTL 168 5.5 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 10 26521957 98003205 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 631555 Bp134 Blood pressure QTL 134 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 80515287 91230079 Rat 61325 Aia5 Adjuvant induced arthritis QTL 5 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1298078 Stresp5 Stress response QTL 5 2.99 0.00025 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 10 42045676 104670812 Rat 1549831 Bss6 Bone structure and strength QTL 6 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 10 57576521 102576521 Rat 1579915 Bp280 Blood pressure QTL 280 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90404397 107211142 Rat 70164 Bw21 Body weight QTL 21 4.36 0.00005 body mass (VT:0001259) body weight (CMO:0000012) 10 53797494 98952626 Rat 4889948 Bss91 Bone structure and strength QTL 91 4 tibia area (VT:1000281) tibia midshaft total cross-sectional area (CMO:0001715) 10 82564856 92369470 Rat 2298548 Neuinf7 Neuroinflammation QTL 7 3.4 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 10 72224939 107211142 Rat 1579919 Bp281 Blood pressure QTL 281 0.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 74372084 94965338 Rat 1302404 Cia27 Collagen induced arthritis QTL 27 2.6 0.0045 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 10 76452683 107211142 Rat 1300107 Rf18 Renal function QTL 18 3.41 urine output (VT:0003620) timed urine volume (CMO:0000260) 10 78775516 98279596 Rat 2300218 Hpcl2 Hepatic cholesterol level QTL 2 liver cholesterol amount (VT:0010498) liver cholesterol level (CMO:0001597) 10 45029650 95600334 Rat 2317754 Glom25 Glomerulus QTL 25 3.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 82685200 107211142 Rat 1554317 Bmd4 Bone mineral density QTL 4 9.4 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 10 19816042 99406971 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 10450495 Bp383 Blood pressure QTL 383 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 94965338 Rat 2313856 Bp342 Blood pressure QTL 342 4.4 0.0001 life span trait (VT:0005372) age at time of death (CMO:0001193) 10 87307617 96121100 Rat 61354 Pia10 Pristane induced arthritis QTL 10 0.01 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 2292617 Ept18 Estrogen-induced pituitary tumorigenesis QTL 18 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2303118 Mamtr7 Mammary tumor resistance QTL 7 0.003 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 10 9658275 104670812 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 70193 Mcs7 Mammary carcinoma susceptibility QTL 7 2.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 72224939 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 61363 Oia3 Oil induced arthritis QTL 3 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87307617 107211142 Rat 1357344 Bp249 Blood pressure QTL 249 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 66743655 98003205 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2306970 Anxrr22 Anxiety related response QTL 22 5.95 fear/anxiety-related behavior trait (VT:1000241) number of periods of voluntary immobility (CMO:0001045) 10 61345276 98211570 Rat 724530 Bp149 Blood pressure QTL 149 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90627439 107211142 Rat 1300137 Bp186 Blood pressure QTL 186 3.57 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 10 90627439 107057807 Rat 1359017 Hrtrt21 Heart rate QTL 21 2.4 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 10 51772940 96772940 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 2312672 Insul15 Insulin level QTL 15 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 10 57134272 102134272 Rat 6893357 Bw102 Body weight QTL 102 0.5 0.36 body mass (VT:0001259) body weight (CMO:0000012) 10 80515287 101325465 Rat 12880384 Cm107 Cardiac mass QTL 107 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 90404397 107211142 Rat 12880385 Cm108 Cardiac mass QTL 108 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 90404397 107211142 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 2303589 Bw87 Body weight QTL 87 2 body mass (VT:0001259) body weight (CMO:0000012) 10 81285008 107211142 Rat 12880396 Am13 Aortic mass QTL 13 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 90404397 107211142 Rat 2306793 Ean5 Experimental allergic neuritis QTL 5 4.7 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 72552416 93995749 Rat 12880398 Kidm67 Kidney mass QTL 67 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 10 90404397 107211142 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2306792 Ean4 Experimental allergic neuritis QTL 4 4 nervous system integrity trait (VT:0010566) IFNG-secreting splenocyte count (CMO:0002122) 10 84022321 93995963 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 12880395 Cm109 Cardiac mass QTL 109 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 10 90404397 107211142 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 634320 Niddm49 Non-insulin dependent diabetes mellitus QTL 49 4.41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 10 88539139 107211142 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 70364 Bp72 Blood pressure QTL 72 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 51121100 96121100 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 4889492 Pancm2 Pancreatic morphology QTL 2 3.2 pancreatic beta cell morphology trait (VT:0005217) ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814) 10 76748906 107211142 Rat 6893366 Bw106 Body weight QTL 106 0.3 0.47 body mass (VT:0001259) body weight (CMO:0000012) 10 70199100 107211142 Rat 2293698 Bss43 Bone structure and strength QTL 43 5.33 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 10 59209888 104209888 Rat 631530 Tls3 T-lymphoma susceptibility QTL 3 0 0.0001 thymus integrity trait (VT:0010555) percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911) 10 51774612 95600334 Rat 1354608 Cm33 Cardiac mass QTL 33 2.8 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 10 54809292 99809292 Rat 1558643 Cm44 Cardiac mass QTL 44 4.8 0.0000368 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 61345276 99703528 Rat 631535 Cm51 Cardiac mass QTL 51 3 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 10 51786282 91669536 Rat 631267 Cia20 Collagen induced arthritis QTL 20 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 23444813 104060283 Rat 1576308 Schws1 Schwannoma susceptibility QTL 1 0.0041 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 10 40035094 102359817 Rat 631269 Cia22 Collagen induced arthritis QTL 22 8.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 631268 Cia21 Collagen induced arthritis QTL 21 3.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 14487011 104060283 Rat 631270 Cia23 Collagen induced arthritis QTL 23 3.9 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 40035094 104060283 Rat 6893336 Cm75 Cardiac mass QTL 75 0.1 0.87 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 10 61345276 99703528 Rat 631547 Bp87 Blood pressure QTL 87 4.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 47369470 92369470 Rat 61427 Cia16 Collagen induced arthritis QTL 16 3.2 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 6357896 96121100 Rat 12880055 Am11 Aortic mass QTL 11 0.004 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 84007272 95933025 Rat 2292438 Bp311 Blood pressure QTL 311 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 107211142 Rat 2312662 Slep8 Serum leptin concentration QTL 8 0.05 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 10 57134272 102134272 Rat 2301398 Kidm38 Kidney mass QTL 38 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 10 84007272 95933025 Rat 1600367 Mcs15 Mammary carcinoma susceptibility QTL 15 4.5 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 85565469 103884409 Rat 1358188 Ept9 Estrogen-induced pituitary tumorigenesis QTL 9 3.9 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 10 73453136 96120911 Rat 631538 Oia5 Oil induced arthritis QTL 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87055121 107211142 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 631542 Bp82 Blood pressure QTL 82 6.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 26521957 98952741 Rat 2312668 Scl65 Serum cholesterol level QTL 65 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 10 57134272 102134272 Rat
RH129350
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 91,088,537 - 91,088,753 (+) MAPPER mRatBN7.2 Rnor_6.0 10 94,349,058 - 94,349,273 NCBI Rnor6.0 Rnor_5.0 10 94,097,728 - 94,097,943 UniSTS Rnor5.0 RGSC_v3.4 10 95,550,767 - 95,550,982 UniSTS RGSC3.4 Celera 10 89,764,625 - 89,764,840 UniSTS RH 3.4 Map 10 979.2 UniSTS Cytogenetic Map 10 q32.1 UniSTS
RH133214
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 91,082,543 - 91,082,731 (+) MAPPER mRatBN7.2 Rnor_6.0 10 94,343,064 - 94,343,251 NCBI Rnor6.0 Rnor_5.0 10 94,091,734 - 94,091,921 UniSTS Rnor5.0 RGSC_v3.4 10 95,544,773 - 95,544,960 UniSTS RGSC3.4 Celera 10 89,758,631 - 89,758,818 UniSTS RH 3.4 Map 10 979.5 UniSTS Cytogenetic Map 10 q32.1 UniSTS
AW548911
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 91,086,805 - 91,086,912 (+) MAPPER mRatBN7.2 Rnor_6.0 10 94,347,326 - 94,347,432 NCBI Rnor6.0 Rnor_5.0 10 94,095,996 - 94,096,102 UniSTS Rnor5.0 RGSC_v3.4 10 95,549,035 - 95,549,141 UniSTS RGSC3.4 Celera 10 89,762,893 - 89,762,999 UniSTS Cytogenetic Map 10 q32.1 UniSTS
RH124538
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 91,086,008 - 91,086,440 (+) MAPPER mRatBN7.2 Rnor_6.0 10 94,346,529 - 94,346,960 NCBI Rnor6.0 Rnor_5.0 10 94,095,199 - 94,095,630 UniSTS Rnor5.0 RGSC_v3.4 10 95,548,238 - 95,548,669 UniSTS RGSC3.4 Celera 10 89,762,096 - 89,762,527 UniSTS Cytogenetic Map 10 q32.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000088656 ⟹ ENSRNOP00000074780
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 91,020,174 - 91,088,848 (+) Ensembl Rnor_6.0 Ensembl 10 94,280,703 - 94,349,368 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095570 ⟹ ENSRNOP00000085202
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 91,032,107 - 91,088,848 (+) Ensembl
RefSeq Acc Id:
NM_001107058 ⟹ NP_001100528
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 91,519,976 - 91,588,651 (+) NCBI mRatBN7.2 10 91,020,174 - 91,088,852 (+) NCBI Rnor_6.0 10 94,280,703 - 94,349,372 (+) NCBI Rnor_5.0 10 94,029,306 - 94,098,042 (+) NCBI RGSC_v3.4 10 95,482,303 - 95,551,065 (+) RGD Celera 10 89,696,294 - 89,764,939 (+) NCBI
Sequence:
CTTCTGGACTTCAAGACTGGCAGGCGGGCCAGCCGAGTGGCGCCGCCGAGGCCGGGTTGGGCCGAGCCTGGGAGCGCCGGGGATGTAGCGGGCCACCCTGCTCATGCCACAGCGCCCGGCCCGGGCCG
hide sequence
RefSeq Acc Id:
XM_063269201 ⟹ XP_063125271
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 91,520,334 - 91,588,651 (+) NCBI
RefSeq Acc Id:
NP_001100528 ⟸ NM_001107058
- UniProtKB:
B5DF98 (UniProtKB/TrEMBL), A6HK01 (UniProtKB/TrEMBL), A0A8I6A3I3 (UniProtKB/TrEMBL), A0A0G2K8Y1 (UniProtKB/TrEMBL)
- Sequence:
MDEQEALDSIMKDLVALQMSRRPRVSGYETMKNKDTGHPNRQSDVRIKFEHNGERRIIAFSRPVRYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSASMKSLRILLLSQDRNHT
hide sequence
Ensembl Acc Id:
ENSRNOP00000074780 ⟸ ENSRNOT00000088656
Ensembl Acc Id:
ENSRNOP00000085202 ⟸ ENSRNOT00000095570
RefSeq Acc Id:
XP_063125271 ⟸ XM_063269201
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A3I3 (UniProtKB/TrEMBL)
RGD ID: 13697833 Promoter ID: EPDNEW_R8358 Type: multiple initiation site Name: Map3k3_1 Description: mitogen activated protein kinase kinase kinase 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 10 94,280,662 - 94,280,722 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-04-30
Map3k3
mitogen activated protein kinase kinase kinase 3
Map3k3_predicted
mitogen activated protein kinase kinase kinase 3 (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Map3k3_predicted
mitogen activated protein kinase kinase kinase 3 (predicted)
Symbol and Name status set to approved
70820 APPROVED
