Advanced Search (OLGA)

Gene: Siah2 (siah E3 ubiquitin protein ligase 2) Rattus norvegicus

Analyze

Symbol:

Siah2

Name:

siah E3 ubiquitin protein ligase 2

RGD ID:

620778

Description:

Enables ubiquitin conjugating enzyme binding activity. Involved in regulation of protein ubiquitination. Located in early endosome and neuronal cell body. Orthologous to human SIAH2 (siah E3 ubiquitin protein ligase 2); PARTICIPATES IN estrogen signaling pathway; nuclear factor, erythroid 2 like 2 signaling pathway; INTERACTS WITH 1,2,4-trimethylbenzene; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

E3 ubiquitin-protein ligase SIAH2; RING-type E3 ubiquitin transferase SIAH2; seven in absentia 2; seven in absentia homolog 2; siah-2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SIAH2 (siah E3 ubiquitin protein ligase 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Siah2 (siah E3 ubiquitin protein ligase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Siah2 (siah E3 ubiquitin protein ligase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SIAH2 (siah E3 ubiquitin protein ligase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SIAH2 (siah E3 ubiquitin protein ligase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Siah2 (siah E3 ubiquitin protein ligase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SIAH2 (siah E3 ubiquitin protein ligase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SIAH2 (siah E3 ubiquitin protein ligase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Siah2 (siah E3 ubiquitin protein ligase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Siah2 (siah E3 ubiquitin protein ligase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SIAH1 (siah E3 ubiquitin protein ligase 1)	HGNC	OrthoDB
Homo sapiens (human):	ITIH1 (inter-alpha-trypsin inhibitor heavy chain 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SIAH2 (siah E3 ubiquitin protein ligase 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Siah2 (siah E3 ubiquitin protein ligase 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	siah2l (seven in absentia homolog 2 (Drosophila)-like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	siah-1	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	siah-1	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	sina	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	sina	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	siah2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	siah2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	145,063,847 - 145,081,675 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	145,063,857 - 145,081,873 (-)	Ensembl				GRCr8
mRatBN7.2	2	142,913,924 - 142,931,752 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	142,914,003 - 142,931,950 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	149,552,206 - 149,570,039 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	147,658,831 - 147,676,654 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	142,291,261 - 142,309,088 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	148,874,151 - 148,891,900 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	148,874,151 - 148,891,900 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	168,292,053 - 168,309,802 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	148,022,641 - 148,040,390 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	137,342,181 - 137,359,932 (-)	NCBI		Celera
RGSC_v3.1	2	147,972,605 - 147,990,353 (-)	NCBI
Cytogenetic Map	2	q26	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

lens disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO)

1,2,4-trimethylbenzene (EXP)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (ISO)

acetylsalicylic acid (ISO)

acrylamide (ISO)

afimoxifene (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bexarotene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Butylbenzyl phthalate (EXP)

Butylparaben (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

CGP 52608 (ISO)

chloroacetaldehyde (ISO)

cidofovir anhydrous (ISO)

ciguatoxin CTX1B (ISO)

cisplatin (ISO)

clodronic acid (ISO)

clomiphene (ISO)

cobalt dichloride (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

diazinon (EXP)

dibenz[a,h]anthracene (ISO)

Dibutyl phosphate (ISO)

diethylstilbestrol (EXP,ISO)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

erlotinib hydrochloride (ISO)

estrone (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

fenofibrate (EXP)

folic acid (ISO)

fulvestrant (ISO)

furan (EXP)

genistein (ISO)

gentamycin (EXP)

hexadecanoic acid (ISO)

hexestrol (ISO)

ICI-164384 (ISO)

ifosfamide (ISO)

Indeno[1,2,3-cd]pyrene (ISO)

lead(0) (ISO)

leflunomide (ISO)

manganese(II) chloride (EXP)

mestranol (ISO)

metformin (EXP)

methamphetamine (EXP)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

methylparaben (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-methyl-4-phenylpyridinium (EXP)

naphthalenes (EXP)

paracetamol (EXP)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phytoestrogen (ISO)

picene (ISO)

pirinixic acid (ISO)

quercetin (ISO)

raloxifene (ISO)

resveratrol (ISO)

S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

Soman (EXP)

sunitinib (ISO)

tamoxifen (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

Tributyltin oxide (ISO)

trichloroethene (EXP,ISO)

troglitazone (ISO)

trovafloxacin (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vincristine (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IEA)

canonical Wnt signaling pathway (IEA,ISO)

negative regulation of apoptotic process (IEA,ISO)

negative regulation of canonical Wnt signaling pathway (ISO)

negative regulation of extrinsic apoptotic signaling pathway (IEA,ISO)

proteasome-mediated ubiquitin-dependent protein catabolic process (IBA)

protein ubiquitination (IEA)

regulation of circadian rhythm (IEA,ISO,ISS)

regulation of protein ubiquitination (IDA)

rhythmic process (IEA)

ubiquitin-dependent protein catabolic process (IEA,ISO,ISS)

Cellular Component

cytoplasm (IBA,IEA)

cytosol (IEA,ISO)

early endosome (IDA,IEA)

neuronal cell body (IDA)

nucleoplasm (IEA,ISO)

nucleus (IEA)

Molecular Function

metal ion binding (IEA)

protein binding (IPI,ISO)

transferase activity (IEA)

ubiquitin conjugating enzyme binding (IBA,IDA)

ubiquitin protein ligase activity (IBA,IEA,ISO,ISS)

ubiquitin-protein transferase activity (IEA,ISO,ISS,NAS)

zinc ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

estrogen signaling pathway (ISO)

nuclear factor, erythroid 2 like 2 signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Coregulators in nuclear estrogen receptor action: from concept to therapeutic targeting.	Hall JM and McDonnell DP, Mol Interv. 2005 Dec;5(6):343-57.
4.	The Nrf2 regulatory network provides an interface between redox and intermediary metabolism.	Hayes JD and Dinkova-Kostova AT, Trends Biochem Sci. 2014 Apr;39(4):199-218. doi: 10.1016/j.tibs.2014.02.002. Epub 2014 Mar 16.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Regulation of synaptophysin degradation by mammalian homologues of seven in absentia.	Wheeler TC, etal., J Biol Chem 2002 Mar 22;277(12):10273-82.

Additional References at PubMed

PMID:12952940	PMID:19028597	PMID:19224863	PMID:21586138	PMID:26070566	PMID:26392558

Genomics

Comparative Map Data

Siah2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	145,063,847 - 145,081,675 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	2	145,063,857 - 145,081,873 (-)	Ensembl				GRCr8
mRatBN7.2	2	142,913,924 - 142,931,752 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	142,914,003 - 142,931,950 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	2	149,552,206 - 149,570,039 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	147,658,831 - 147,676,654 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	142,291,261 - 142,309,088 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	148,874,151 - 148,891,900 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	148,874,151 - 148,891,900 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	2	168,292,053 - 168,309,802 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	2	148,022,641 - 148,040,390 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	2	137,342,181 - 137,359,932 (-)	NCBI		Celera
RGSC_v3.1	2	147,972,605 - 147,990,353 (-)	NCBI
Cytogenetic Map	2	q26	NCBI

SIAH2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	150,741,125 - 150,763,169 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	150,741,125 - 150,763,477 (-)	Ensembl			hg38	GRCh38
GRCh37	3	150,458,912 - 150,480,956 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	151,941,600 - 151,963,953 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	151,941,608 - 151,963,961	NCBI
Celera	3	148,871,981 - 148,894,332 (-)	NCBI		Celera
Cytogenetic Map	3	q25.1	NCBI
HuRef	3	147,832,386 - 147,876,859 (-)	NCBI		HuRef
CHM1_1	3	150,421,938 - 150,444,291 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	153,492,334 - 153,514,363 (-)	NCBI		T2T-CHM13v2.0

Siah2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	58,582,370 - 58,599,857 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	58,582,359 - 58,599,821 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	3	58,674,949 - 58,692,439 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	58,674,938 - 58,692,400 (-)	Ensembl			mm10	GRCm38
MGSCv37	3	58,478,871 - 58,496,310 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	3	58,762,878 - 58,780,317 (-)	NCBI		MGSCv36	mm8
Celera	3	58,369,358 - 58,387,000 (-)	NCBI		Celera
Cytogenetic Map	3	D	NCBI
cM Map	3	28.68	NCBI

Siah2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955448	1,907,401 - 1,926,445 (-)	Ensembl
ChiLan1.0	NW_004955448	1,907,478 - 1,926,445 (-)	NCBI	ChiLan1.0	ChiLan1.0

SIAH2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	148,630,486 - 148,652,743 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	148,635,203 - 148,657,271 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	147,759,375 - 147,781,639 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	155,332,751 - 155,354,135 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	155,332,751 - 155,354,139 (-)	Ensembl			panPan2	panpan1.1

SIAH2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	23	45,366,343 - 45,418,960 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	23	45,341,199 - 45,385,546 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	23	45,233,446 - 45,252,449 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	23	45,995,112 - 46,014,122 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	23	45,996,108 - 46,014,111 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	23	45,585,094 - 45,604,128 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	23	45,637,159 - 45,656,202 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	23	45,913,240 - 45,932,290 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Siah2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	90,635,588 - 90,651,834 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936758	1,116,056 - 1,213,442 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936758	1,115,980 - 1,132,225 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SIAH2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	90,949,021 - 90,971,411 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	90,951,798 - 90,971,538 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	99,076,306 - 99,096,119 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SIAH2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	39,939,209 - 39,960,750 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	39,939,832 - 39,959,734 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	12,757,953 - 12,779,570 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Siah2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	28,158,750 - 28,178,810 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624730	28,159,096 - 28,178,832 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Siah2
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	3	97,185,864 - 97,202,380 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Siah2
125 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	133
Count of miRNA genes:	101
Interacting mature miRNAs:	125
Transcripts:	ENSRNOT00000018488
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	105628029	150628029	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1358360	Sradr2	Stress Responsive Adrenal Weight QTL 2	10.24		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	2	124103798	154505346	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	20695736	231474293	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	138595962	205135428	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	124537199	209621565	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	78269809	208420281	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	122597372	215234002	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	27148328	145807373	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	143565208	188565208	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	139067258	192287892	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1582257	Gluco21	Glucose level QTL 21	3.1	0.0035	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	120039407	159440891	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	144882354	205135428	Rat
1359035	Bp276	Blood pressure QTL 276			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	100807373	145807373	Rat
8662836	Vetf8	Vascular elastic tissue fragility QTL 8	0.66		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	106869825	151869825	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845182	205135428	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
5135226	Leukc2	Leukocyte quantity QTL 2			eosinophil quantity (VT:0002602)	blood eosinophil count (CMO:0000033)	2	120039407	151869825	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
2299162	Iddm32	Insulin dependent diabetes mellitus QTL 32	2.36		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	93602631	145807373	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	139067258	184067258	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	78269809	205135428	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	143344967	251712708	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	143746578	205135428	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	143344967	251712708	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	114384617	215381366	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	113746222	205135428	Rat
7488933	Bp368	Blood pressure QTL 368		0.004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	104957381	149957381	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	114384617	215381366	Rat
738007	Anxrr7	Anxiety related response QTL 7	4.4		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	120339555	165339555	Rat
9685068	Swd7	Spike wave discharge measurement QTL 7	3.2	0.01	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge rate (CMO:0001739)	2	143806628	149738646	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	117415288	205135428	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	159440891	Rat
1581552	Pur12	Proteinuria QTL 12	5.19	0.0009	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	2	114032149	150226270	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	114440891	159440891	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	184731399	Rat
1354594	Despr10	Despair related QTL 10		2e-06	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	2	116804572	161804572	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	76328396	209350714	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	30219200	171802126	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	92	59	6	356	192	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_134457	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB067815	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC112531	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF389477	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018488 ⟹ ENSRNOP00000018488

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	145,063,857 - 145,081,675 (-)	Ensembl
mRatBN7.2 Ensembl	2	142,914,003 - 142,931,752 (-)	Ensembl
Rnor_6.0 Ensembl	2	148,874,151 - 148,891,900 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096984 ⟹ ENSRNOP00000095454

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	145,063,857 - 145,081,873 (-)	Ensembl
mRatBN7.2 Ensembl	2	142,914,003 - 142,931,950 (-)	Ensembl

RefSeq Acc Id:

NM_134457 ⟹ NP_604452

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	145,063,847 - 145,081,675 (-)	NCBI
mRatBN7.2	2	142,913,924 - 142,931,752 (-)	NCBI
Rnor_6.0	2	148,874,151 - 148,891,900 (-)	NCBI
Rnor_5.0	2	168,292,053 - 168,309,802 (-)	NCBI
RGSC_v3.4	2	148,022,641 - 148,040,390 (-)	RGD
Celera	2	137,342,181 - 137,359,932 (-)	RGD

Sequence:

show sequence

GGAGGAGGGCACCGCACGGCCGCGATCCCCGAGAGCGTGGACCACTCCGGGCGCCGCCGAGAGG
ATCGGCGCGGTCGCGTCCCCGCCCTCCCGGTGCTGGTCGGGTCCGCGCCCGGTCCCCGGACTGG
GCGCCGTGGCGTTACCCCGGAGCCCGCCACCCGCGGGGCGCGCACCGCCTTAACCCGGGCGGCC
CCGCGGCAGGCAGAAGCCCGCAGGTCCATGGTGGGCTCGGAGCGCGATGAGCCGCCCGTCCTCC
ACCGGCCCCAGCGCTAACAAACCCTGCAGCAAGCAGCCGCCGCCGCCTCAGACCCCGCACGCCC
CGTCCCCGGCTGCGCCCCCGGCTGCCGCCACCATCTCGGCTGCGGGCCCCGGCTCGTCCGCGGT
GCCCGCCGCGGCAGCGGTGATCTCAGGCCCCGGCGCCGGCGGCGGGGCCGGCCCAGTGTCCCCG
CAGCACCACGAGCTGACCTCGCTGTTCGAGTGCCCGGTCTGTTTTGACTATGTCCTGCCCCCCA
TTCTGCAGTGCCAGGCCGGGCACCTGGTGTGTAACCAATGCCGCCAGAAGTTGAGCTGCTGCCC
GACGTGCAGGGGCGCCCTAACGCCCAGCATCAGGAACCTGGCTATGGAGAAGGTCGCCTCGGCA
GTTCTGTTTCCCTGTAAGTATGCCACCACGGGCTGTTCCCTGACTCTACACCATACAGAGAAAC
CAGAGCATGAAGACATCTGTGAATACCGTCCTTATTCCTGTCCCTGTCCTGGTGCCTCCTGCAA
GTGGCAAGGATCCCTAGAAGCTGTGATGTCCCATCTCATGCATGCCCACAAGAGCATCACTACC
CTTCAGGGAGAGGACATAGTCTTTCTAGCTACAGACATTAACCTGCCAGGGGCTGTGGACTGGG
TGATGATGCAGTCCTGTTTTGGCCACCACTTCATGCTGGTACTCGAGAAGCAAGAGAAGTACGA
AGGTCACCAGCAGTTCTTTGCCATCGTCCTCCTCATTGGCACCCGCAAGCAAGCAGAGAACTTT
GCCTACAGACTGGAGTTGAATGGGAACCGGAGGAGACTGACCTGGGAGGCCACACCCCGGTCCA
TTCATGATGGTGTGGCTGCAGCCATCATGAACAGTGACTGCCTTGTTTTTGACACAGCCATAGC
ACATCTCTTTGCAGATAATGGGAACCTTGGAATCAATGTCACAATATCTACATGCTGTCAGTGA
GGCTCCAGGAGGCTTTCCGAACCCTGGGAAGTTATTTGGGCATAACGCTCTATGTTTAATAAAG
TTTTTTAATACATGTTTTATTTAGTACGTCTTCCCAAGTCAGGACCCACAACTGTCCTGTGTTT
TATTTAAACAACAGCTTCCTGTCTGGCACTGATGAAACAAAGTTTACTGAACTGTGATAAGTGG
GGTTGGCCTGTTAGTAATTCGGAGGTGGTTCTGTGACCTCAAATCAAAACTATTCTGTTTACTT
TCTGAACAGCTCTTGACAGATTCCTCAGGGCTGCCTCCCCCTGCCTCATCCTGATCCAACAAAA
GCACAGTGACATTCATGAGATCCCCTTTATTTCTAGGAGGTAGCAATTGCTTTAATACCCCATC
ACCTGACCGTAGTACTCATCTCCAACACAGCCAGAGAATCAACAAAGTTGAACAACCTCCTCTT
CTCAGAGTTTGAGGATCACTGGCTTGAATTGTGGAAAGGGTCCAGGATCTAAAGGTGCTTTAAG
GCCATCCTCTGCTGACACCGTTGGTCTCTACAGTCCACACACCACACTGAGAGCAGAACTAAAA
GTCCACGGGGACACAACTCCTGGGGCTTGCCTGCTCTTGGGTTCTCAGAGTTCTCACATAGTTG
TTGCTCACCATAATACTGATGGCCTGTTTACATATGGCTTCCCTTGGAAGCCCCCTTGACTATA
ACTGATGTGAAAGACTAGATCAGTGCTTGGGAGAACTTGATATCCAGTATCACATGCTTGCCAC
TTTAAAGGCATGTGTCAGATTTGTGGCTTTAGTTTTTGTTGTTTCTCGTGCCGAATTCCTGCGG

hide sequence

Protein Sequences


Protein RefSeqs	NP_604452	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAL91363	(Get FASTA)	NCBI Sequence Viewer
	BAB70754	(Get FASTA)	NCBI Sequence Viewer
	EDM14859	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018488
	ENSRNOP00000018488.1
GenBank Protein	Q8R4T2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_604452 ⟸ NM_134457

- UniProtKB:

Q920M8 (UniProtKB/Swiss-Prot), Q8R4T2 (UniProtKB/Swiss-Prot), A6JVJ3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSRPSSTGPSANKPCSKQPPPPQTPHAPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGAGGG
AGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAM
EKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHA
HKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTR
KQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTI
STCCQ

hide sequence

Ensembl Acc Id:

ENSRNOP00000018488 ⟸ ENSRNOT00000018488

Ensembl Acc Id:

ENSRNOP00000095454 ⟸ ENSRNOT00000096984

Protein Domains

RING-type SIAH-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8R4T2-F1-model_v2	AlphaFold	Q8R4T2	1-325	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691345

Promoter ID:

EPDNEW_R1870

Type:

initiation region

Name:

Siah2_1

Description:

siah E3 ubiquitin protein ligase 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	148,891,911 - 148,891,971	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620778	AgrOrtholog
BioCyc Gene	G2FUF-52996	BioCyc
Ensembl Genes	ENSRNOG00000013703	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000018488	ENTREZGENE
	ENSRNOT00000018488.3	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.40.10	UniProtKB/Swiss-Prot
	Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2, Chain A	UniProtKB/Swiss-Prot
InterPro	7-in-absentia-prot_TRAF-dom	UniProtKB/Swiss-Prot
	SINA-like	UniProtKB/Swiss-Prot
	Sina-like_RING	UniProtKB/Swiss-Prot
	TRAF-like	UniProtKB/Swiss-Prot
	Znf_RING	UniProtKB/Swiss-Prot
	Znf_RING/FYVE/PHD	UniProtKB/Swiss-Prot
	Znf_SIAH	UniProtKB/Swiss-Prot
KEGG Report	rno:140593	UniProtKB/Swiss-Prot
NCBI Gene	140593	ENTREZGENE
PANTHER	E3 UBIQUITIN-PROTEIN LIGASE SIAH2	UniProtKB/Swiss-Prot
	PTHR45877	UniProtKB/Swiss-Prot
Pfam	Sina	UniProtKB/Swiss-Prot
	Sina_RING	UniProtKB/Swiss-Prot
	Sina_ZnF	UniProtKB/Swiss-Prot
PhenoGen	Siah2	PhenoGen
PROSITE	ZF_RING_2	UniProtKB/Swiss-Prot
	ZF_SIAH	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000013703	RatGTEx
Superfamily-SCOP	RING/U-box	UniProtKB/Swiss-Prot
	TRAF domain-like	UniProtKB/Swiss-Prot
UniProt	A0A8I6AQV5_RAT	UniProtKB/TrEMBL
	A6JVJ3	ENTREZGENE, UniProtKB/TrEMBL
	Q8R4T2	ENTREZGENE
	Q920M8	ENTREZGENE
	SIAH2_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q920M8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-03-07	Siah2	siah E3 ubiquitin protein ligase 2	Siah2	seven in absentia 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Siah2	seven in absentia 2			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Siah2	seven in absentia 2			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to cytosolic and membrane-associated pools	633984

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - CTD

RGD Manual Annotations