Polr2f (RNA polymerase II, I and III subunit F)

Advanced Search (OLGA)

Gene: Polr2f (RNA polymerase II, I and III subunit F) Rattus norvegicus

Analyze

Symbol:

Polr2f

Name:

RNA polymerase II, I and III subunit F

RGD ID:

708567

Description:

Predicted to enable DNA-directed 5'-3' RNA polymerase activity. Predicted to contribute to RNA polymerase I activity; RNA polymerase II activity; and RNA polymerase III activity. Predicted to be involved in tRNA transcription by RNA polymerase III; transcription by RNA polymerase I; and transcription by RNA polymerase II. Predicted to be located in fibrillar center and nucleoplasm. Predicted to be part of RNA polymerase I complex; RNA polymerase II, core complex; and RNA polymerase III complex. Orthologous to human POLR2F (RNA polymerase II, I and III subunit F); PARTICIPATES IN RNA polymerase I transcription pathway; RNA polymerase II transcription pathway; RNA polymerase III transcription pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

DNA-directed RNA polymerase II subunit F; DNA-directed RNA polymerases I, II, and III subunit RPABC2; LOC83503; polymerase (RNA) II (DNA directed) polypeptide F; polymerase (RNA) II subunit F; polymerase II; RNA polymerase II subunit F; RNA polymerases I, II, and III subunit ABC2; RPB6; RPB6 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	POLR2F (RNA polymerase II, I and III subunit F)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Polr2f (polymerase (RNA) II (DNA directed) polypeptide F)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Polr2f (RNA polymerase II, I and III subunit F)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	POLR2F (RNA polymerase II, I and III subunit F)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Polr2f (RNA polymerase II, I and III subunit F)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	POLR2F (RNA polymerase II, I and III subunit F)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	POLR2F (RNA polymerase II, I and III subunit F)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Polr2f (RNA polymerase II, I and III subunit F)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	BORCS7 (BLOC-1 related complex subunit 7)	HGNC	OMA
Homo sapiens (human):	BORCS7-ASMT (BORCS7-ASMT readthrough (NMD candidate))	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	POLR2F (RNA polymerase II, I and III subunit F)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Polr2f (polymerase (RNA) II (DNA directed) polypeptide F)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	polr2f (polymerase (RNA) II (DNA directed) polypeptide F)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rpb-6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPO26	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	RpII18	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	polr2f	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	112,592,977 - 112,604,681 (+)	NCBI		GRCr8
mRatBN7.2	7	110,712,528 - 110,724,234 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	110,712,572 - 110,724,234 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	112,461,280 - 112,470,706 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	114,684,808 - 114,694,234 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	114,654,106 - 114,663,552 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	120,380,543 - 120,392,214 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	120,380,544 - 120,390,954 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	120,374,362 - 120,386,031 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	117,122,869 - 117,135,482 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	117,157,067 - 117,171,879 (+)	NCBI
Celera	7	107,047,109 - 107,056,555 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenylosuccinase lyase deficiency (ISO)

Anosmia (ISO)

Charcot-Marie-Tooth disease (ISO)

Deafness (ISO)

Emery-Dreifuss muscular dystrophy (ISO)

genetic disease (ISO)

Hearing Loss (ISO)

Hirschsprung Disease 1 (ISO)

Hirschsprung's disease (ISO)

intellectual disability (ISO)

Kallmann syndrome (ISO)

myoclonic dystonia 26 (ISO)

neurodegeneration with brain iron accumulation 2A (ISO)

Olfaction Disorders (ISO)

PCWH syndrome (ISO)

Van der Hoeve Halbertsma Waardenburg Gualdi Syndrome (ISO)

Waardenburg syndrome (ISO)

Waardenburg syndrome type 1 (ISO)

Waardenburg syndrome type 2A (ISO)

Waardenburg syndrome type 2E (ISO)

Waardenburg syndrome type 4A (ISO)

Waardenburg syndrome type 4C (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,6-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (ISO)

capsaicin (EXP)

carbamazepine (ISO)

chloropicrin (ISO)

chromium(6+) (ISO)

clofibric acid (EXP)

cobalt dichloride (ISO)

cocaine (EXP)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

diazinon (ISO)

dibutyl phthalate (ISO)

diclofenac (ISO)

disodium selenite (ISO)

finasteride (EXP)

flavonoids (EXP)

flutamide (EXP)

folic acid (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

ketamine (EXP)

methapyrilene (ISO)

N-nitrosodiethylamine (EXP)

perfluorohexanesulfonic acid (ISO)

pirinixic acid (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

tetrachloromethane (ISO)

theophylline (ISO)

triphenyl phosphate (ISO)

tungsten (ISO)

tunicamycin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

transcription by RNA polymerase I (IBA,TAS)

transcription by RNA polymerase II (IBA,ISO,ISS,TAS)

transcription by RNA polymerase III (TAS)

tRNA transcription by RNA polymerase III (IBA)

Cellular Component

fibrillar center (IEA,ISO)

nucleoplasm (ISO)

nucleus (ISO,ISS)

RNA polymerase I complex (IBA,ISO,TAS)

RNA polymerase II, core complex (IBA,ISO,ISS,TAS)

RNA polymerase III complex (IBA,ISO,TAS)

Molecular Function

DNA binding (IEA)

DNA-directed 5'-3' RNA polymerase activity (TAS)

RNA polymerase I activity (IBA)

RNA polymerase II activity (IBA)

RNA polymerase III activity (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

Huntington's disease pathway (IEA)

purine metabolic pathway (IEA)

pyrimidine metabolic pathway (IEA)

RNA polymerase I transcription pathway (ISO)

RNA polymerase II transcription pathway (ISO)

RNA polymerase III transcription pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Cell growth- and differentiation-dependent regulation of RNA polymerase III transcription.	Dumay-Odelot H, etal., Cell Cycle. 2010 Sep 15;9(18):3687-99. Epub 2010 Sep 1.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Characterization of human RNA polymerase III identifies orthologues for Saccharomyces cerevisiae RNA polymerase III subunits.	Hu P, etal., Mol Cell Biol. 2002 Nov;22(22):8044-55.
4.	A serine residue in the N-terminal acidic region of rat RPB6, one of the common subunits of RNA polymerases, is exclusively phosphorylated by casein kinase II in vitro.	Kayukawa K, etal., Gene 1999 Jun 24;234(1):139-47.
5.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
6.	TFIIB-related factors in RNA polymerase I transcription.	Knutson BA and Hahn S, Biochim Biophys Acta. 2013 Mar-Apr;1829(3-4):265-73. doi: 10.1016/j.bbagrm.2012.08.003. Epub 2012 Aug 30.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Comprehensive gene review and curation	RGD comprehensive gene curation
13.	RNA polymerase I activity is regulated at multiple steps in the transcription cycle: recent insights into factors that influence transcription elongation.	Schneider DA Gene. 2012 Feb 10;493(2):176-84. doi: 10.1016/j.gene.2011.08.006. Epub 2011 Aug 26.
14.	Conservation between the RNA polymerase I, II, and III transcription initiation machineries.	Vannini A and Cramer P, Mol Cell. 2012 Feb 24;45(4):439-46. doi: 10.1016/j.molcel.2012.01.023.

Additional References at PubMed

PMID:9268387	PMID:9852112	PMID:12477932	PMID:15489334

Genomics

Comparative Map Data

Polr2f
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	112,592,977 - 112,604,681 (+)	NCBI		GRCr8
mRatBN7.2	7	110,712,528 - 110,724,234 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	110,712,572 - 110,724,234 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	112,461,280 - 112,470,706 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	114,684,808 - 114,694,234 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	114,654,106 - 114,663,552 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	120,380,543 - 120,392,214 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	120,380,544 - 120,390,954 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	120,374,362 - 120,386,031 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	117,122,869 - 117,135,482 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	117,157,067 - 117,171,879 (+)	NCBI
Celera	7	107,047,109 - 107,056,555 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

POLR2F
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	37,953,663 - 38,041,915 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	37,952,607 - 38,041,915 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	38,349,670 - 38,437,922 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	36,679,664 - 36,693,752 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	22	36,674,217 - 36,688,306	NCBI
Celera	22	22,151,393 - 22,167,047 (+)	NCBI		Celera
Cytogenetic Map	22	q13.1	NCBI
HuRef	22	21,315,753 - 21,331,407 (+)	NCBI		HuRef
CHM1_1	22	38,308,430 - 38,324,073 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	38,415,270 - 38,503,533 (+)	NCBI		T2T-CHM13v2.0

Polr2f
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	79,025,525 - 79,035,974 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	79,025,209 - 79,035,974 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	79,141,325 - 79,151,774 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	79,141,009 - 79,151,774 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	78,971,797 - 78,982,197 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	78,968,622 - 78,979,022 (+)	NCBI		MGSCv36	mm8
Celera	15	81,254,081 - 81,264,455 (+)	NCBI		Celera
Cytogenetic Map	15	E1	NCBI
cM Map	15	37.7	NCBI

Polr2f
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	24,300,340 - 24,311,166 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955413	24,300,340 - 24,309,798 (+)	NCBI	ChiLan1.0	ChiLan1.0

POLR2F
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	26,694,895 - 26,707,451 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	26,691,256 - 26,707,507 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	26,649,845 - 26,662,477 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	27,486,614 - 27,499,265 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	27,486,609 - 27,535,525 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	27,206,582 - 27,218,897 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	27,518,146 - 27,530,610 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	27,695,350 - 27,707,999 (-)	NCBI		UU_Cfam_GSD_1.0

Polr2f
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	10,115,070 - 10,186,350 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936492	3,186,760 - 3,196,796 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936492	3,186,930 - 3,196,738 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

POLR2F
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	9,855,983 - 9,917,726 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	9,905,359 - 9,917,721 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	7,303,659 - 7,316,021 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

POLR2F
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	20,654,464 - 20,668,267 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	20,654,239 - 20,669,872 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	105,107,935 - 105,122,006 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Polr2f
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624752	9,978,273 - 9,988,134 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624752	9,978,373 - 9,988,192 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Polr2f
34 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	177
Count of miRNA genes:	136
Interacting mature miRNAs:	146
Transcripts:	ENSRNOT00000015009
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	80221299	124373579	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	102297359	133492884	Rat
2298475	Eau6	Experimental allergic uveoretinitis QTL 6		0.0029	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	7	84257275	129257275	Rat
71114	Niddm14	Non-insulin dependent diabetes mellitus QTL 14	4.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	7	84257275	129257275	Rat
1357336	Gluco6	Glucose level QTL 6	3.4		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	7	94811326	116294265	Rat
1357338	Stl17	Serum triglyceride level QTL 17	3.23		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	69736356	112729554	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	91412594	129807172	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	103146217	116738842	Rat
634331	Pia17	Pristane induced arthritis QTL 17	4.7		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	7	73829340	130221005	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	44421311	118198041	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	83153392	128153392	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	90482196	135012528	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	81737938	126737938	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	96670164	135012528	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2306821	Bp335	Blood pressure QTL 335		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	106571501	135012528	Rat
1558655	Swd4	Spike wave discharge measurement QTL 4	3.68	0.0002	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge severity grade (CMO:0001988)	7	86983365	131983365	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	80221299	125221299	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	41333674	119109060	Rat
2313102	Bmd79	Bone mineral density QTL 79	2.3	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	7	94811085	116738842	Rat
731174	Uae23	Urinary albumin excretion QTL 23	2.4	0.0042	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	7	104603555	135012528	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	68938720	113886318	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	80221299	112308525	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	75918751	120918751	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	68938720	113886318	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	91281130	135012528	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	68938720	113886318	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	69736226	117455174	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat

Markers in Region

RH132698

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	110,724,001 - 110,724,200 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	120,391,982 - 120,392,180	NCBI	Rnor6.0
Rnor_5.0	7	120,385,799 - 120,385,997	UniSTS	Rnor5.0
RGSC_v3.4	7	117,137,422 - 117,137,620	UniSTS	RGSC3.4
Celera	7	107,058,495 - 107,058,693	UniSTS
RH 3.4 Map	7	840.1	UniSTS
Cytogenetic Map	7	q34	UniSTS

BE105428

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	110,724,232 - 110,724,392 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	120,392,213 - 120,392,372	NCBI	Rnor6.0
Rnor_5.0	7	120,386,030 - 120,386,189	UniSTS	Rnor5.0
RGSC_v3.4	7	117,137,653 - 117,137,812	UniSTS	RGSC3.4
Celera	7	107,058,726 - 107,058,885	UniSTS
RH 3.4 Map	7	840.1	UniSTS
Cytogenetic Map	7	q34	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031335	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010053048	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_355831	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB017711	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC123360	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC083552	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015009 ⟹ ENSRNOP00000015009

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	110,712,572 - 110,724,234 (+)	Ensembl
Rnor_6.0 Ensembl	7	120,380,544 - 120,390,954 (+)	Ensembl

RefSeq Acc Id:

NM_031335 ⟹ NP_112625

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	112,593,064 - 112,602,509 (+)	NCBI
mRatBN7.2	7	110,712,617 - 110,722,062 (+)	NCBI
Rnor_6.0	7	120,380,597 - 120,390,042 (+)	NCBI
Rnor_5.0	7	120,374,362 - 120,386,031 (+)	NCBI
RGSC_v3.4	7	117,122,869 - 117,135,482 (+)	RGD
Celera	7	107,047,109 - 107,056,555 (+)	RGD

Sequence:

show sequence

TTTCTCTGCTCTGCGACCCGGACCGGCCAGTAAGGAGAAGGTATCATGTCAGACAACGAAGACA
ATTTCGATGGCGATGACTTTGATGACGTGGAGGAGGACGAAGGGCTTGACGACTTGGAAAATGC
TGAGGAGGAGGGTCAGGAAAATGTTGAGATTCTCCCATCTGGTGAACGACCGCAGGCCAACCAG
AAGCGTATCACCACTCCATACATGACCAAGTACGAGCGAGCCCGAGTGCTGGGCACCCGGGCTC
TCCAGATTGCGATGTGTGCCCCAGTAATGGTGGAGCTGGAGGGGGAGACAGACCCTTTGCTCAT
CGCCATGAAGGAACTCAAGGCCCGGAAGATCCCCATCATCATTCGCCGTTACCTGCCAGATGGA
AGCTATGAGGATTGGGGCGTGGATGAGCTCATCATCAGCGACTGAGCAGAGCTGTCAGGCTGTG
CCAGGCACCATCTCTATGCCCA

hide sequence

RefSeq Acc Id:

XR_010053048

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	112,592,977 - 112,604,681 (+)	NCBI

RefSeq Acc Id:

XR_355831

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	112,592,977 - 112,604,681 (+)	NCBI
mRatBN7.2	7	110,712,528 - 110,724,234 (+)	NCBI
Rnor_6.0	7	120,380,543 - 120,392,214 (+)	NCBI
Rnor_5.0	7	120,374,362 - 120,386,031 (+)	NCBI

Sequence:

show sequence

GGTCACGGCGCAAGCGCAAACCACACGTGTTGCCGCAAGGGGCTGAAGCGCGCGTTTCTCTGCT
CTGCGACCCGGACCGGCCAGTAAGGAGAAGGTATCATGTCAGACAACGAAGACAATTTCGATGG
CGATGACTTTGATGACGTGGAGGAGGACGAAGGGCTTGACGACTTGGAAAATGCTGAGGAGGAG
GGTCAGGAAAATGTTGAGATTCTCCCATCTGGTGAACGACCGCAGGCCAACCAGAAGCGTATCA
CCACTCCATACATGACCAAGTACGAGCGAGCCCGAGTGCTGGGCACCCGGGCTCTCCAGATTGC
GATGTGTGCCCCAGTAATGGTGGAGCTGGAGGGGGAGACAGACCCTTTGCTCATCGCCATGAAG
GAACTCAAGGCCCGGAAGATCCCCATCATCATTCGCCGTTACCTGCCAGATGGAAGCTATGAGG
ATTGGGGCGTGGATGAGCTCATCATCAGCGACTGAGCAGAGCTGTCAGGCTGTGCCAGGCACCA
TCTCTATGCCCATTTTATACATAAAAGAAGGTAACCCTGGACACCCACATAGTTGGAAGGAAGA
ATGGCTTTTGAGTGGCTCAGCCTGACCTCTGGCCCACTGCAACTCTCAGGAGACATGGTGTGCC
ACATGGGATTGGGCACCCTGGTCAGGGTGGAAGGAGGAGTGGCCACAGTAATAGGAGGGGTGCT
TGCTGCTCTGGATAAGGGTTAATTCTGGGAGTCATAGACTTCGCACCCCTACCACCCTCCTCCA
AGCCTTTGGAATCCTTTAATCAAGTTGGGTGCTGAAATTTCAGCTCTGAAATGCCGCCTTTGTG
CTGGCATCCAGGCAGCCGCCCCAGAGTGCGGGGGTCACTTTCTCGGCCCCATTTCTCTAAATGG
TGTCTTTGTTCCCTGCTGGGCTGCTCAGTATCAGATGTGATTAAGGGAGATGAAGCTTGGATGG
GGGGGGAGTTAACCCTTAGGGGATAGGGTGCAGGGAGATGGGAGAAGTGGGTGCTTTTCCTCTG
ACCTTCCTCTGAATTCTGCTCTTCTTGGGCAGCCCCTTGTTGACCTGGCAGGCCTGGGGTTGTC
TCCTGTGGGATATGTTGTCACCTGCCAACATTGTAAAGTCTCCCATCTCCTTAGGTTTATGGTC
ATCTTGTCAGTCATTTAAAAACACCTGATACCAGAGCTGCTGCTATGCCAGAGCACATCCCAGC
CTGTGTTGAAGGGATGAACAACCTAACTGGCTTCCATTTCGTCTTCCCCCCATGGCCATTTTCC
TGCAGCCTACACCAGTGGTGATGACCTGGGCGATCTCATGAGGTAGTGGGTCCCTCTATTTTTG
GGGCCCCTCCATCTTGTCAGCTCTGTTTAAAGTTCCCCCTTGGAGCAGGAGTCCCATAGACTGG
AAATGGAAACATGTCCTGCTTTTCAGTAGAGGGACAAGTAAGGGTCCCCATGAAAGGCTGGTAT
GAGGTCACTTCGTATCTTACAGTGTTGGTGTCATAGATGGAAACCTGCAGCCAGGAGTGGGTCT
TAGGAGTCGGTATTGTCAAATCAAATGAAAAAATATAGACTTTTATGGTATCTGGTCTGGTAGG
TCAAGAGACTGCCTCAGCCCTGGTTTTACCCAGGGAGTTGGCAATCTCCTGACACCTGTGATGG
GTGAAGGACACATTCCACGTGTGAGGAAGAGAGCTGATGTGGAGGGGCACTCAGGGTAGTGGCT
CCCCTTTCACTTATGAGTGACTTCAGTGAAGATACTCAGATGTGTAGGTGTATTTACTTGGACC
CCAGCTCACGGAAGGCCAGACACCAAGATTTAGCAGAGGTGGAGGAGTGGGTCAGATTCAACAG
ATAATCTATTAAAGATCAATAAAACACAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_112625	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83552	(Get FASTA)	NCBI Sequence Viewer
	BAA33414	(Get FASTA)	NCBI Sequence Viewer
	EDM15821	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015009.3
	ENSRNOP00055043810
	ENSRNOP00060026614
	ENSRNOP00065046855
GenBank Protein	O88828	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_112625 ⟸ NM_031335
- UniProtKB:	O88828 (UniProtKB/Swiss-Prot), A6HSQ1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERAR VLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIISD hide sequence

Ensembl Acc Id:

ENSRNOP00000015009 ⟸ ENSRNOT00000015009

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O88828-F1-model_v2	AlphaFold	O88828	1-127	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695477

Promoter ID:

EPDNEW_R6002

Type:

initiation region

Name:

Polr2f_1

Description:

RNA polymerase II subunit F

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	120,380,565 - 120,380,625	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:708567	AgrOrtholog
BioCyc Gene	G2FUF-32779	BioCyc
Ensembl Genes	ENSRNOG00000011214	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055030556	UniProtKB/Swiss-Prot
	ENSRNOG00060018885	UniProtKB/Swiss-Prot
	ENSRNOG00065033081	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000015009.7	UniProtKB/Swiss-Prot
	ENSRNOT00055053010	UniProtKB/Swiss-Prot
	ENSRNOT00060032612	UniProtKB/Swiss-Prot
	ENSRNOT00065056914	UniProtKB/Swiss-Prot
Gene3D-CATH	3.90.940.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7190444	IMAGE-MGC_LOAD
InterPro	DNA-dir_RNA_polK_14-18kDa_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Pol_omega/K/RPB6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RPB6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RPB6/omega-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Rpo6/Rpb6	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
KEGG Report	rno:83503	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:93368	IMAGE-MGC_LOAD
NCBI Gene	83503	ENTREZGENE
PANTHER	DNA-DIRECTED RNA POLYMERASE SUBUNIT K	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	RNA_pol_Rpb6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Polr2f	PhenoGen
PIRSF	RPB6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RpoK/RPB6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	RNA_POL_K_14KD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000011214	RatGTEx
	ENSRNOG00055030556	RatGTEx
	ENSRNOG00060018885	RatGTEx
	ENSRNOG00065033081	RatGTEx
SMART	RNA_pol_Rpb6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	RPB6/omega subunit-like	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6HSQ1	ENTREZGENE, UniProtKB/TrEMBL
	O88828	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2020-06-22	Polr2f	RNA polymerase II, I and III subunit F	Polr2f	RNA polymerase II subunit F	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-07-21	Polr2f	RNA polymerase II subunit F	Polr2f	polymerase (RNA) II subunit F	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-03-09	Polr2f	polymerase (RNA) II subunit F	Polr2f	polymerase (RNA) II (DNA directed) polypeptide F	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-08	Polr2f	polymerase (RNA) II (DNA directed) polypeptide F	LOC83503	polymerase II	Symbol and Name updated	1299863	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_regulation	undergoes in vitro serine phosphorylation by casein kinase II	1299534

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)