Symbol:
Ccr2
Name:
C-C motif chemokine receptor 2
RGD ID:
620876
Description:
Enables identical protein binding activity. Involved in several processes, including positive regulation of tumor necrosis factor production; regulation of signal transduction; and response to hyperoxia. Located in perikaryon; perinuclear region of cytoplasm; and primary dendrite. Biomarker of demyelinating disease and periapical periodontitis. Human ortholog(s) of this gene implicated in several diseases, including Kawasaki disease; aggressive periodontitis; coronary artery disease (multiple); glucose metabolism disease (multiple); and uveitis (multiple). Orthologous to human CCR2 (C-C motif chemokine receptor 2); PARTICIPATES IN chemokine mediated signaling pathway; cytokine mediated signaling pathway; INTERACTS WITH (+)-pilocarpine; 17alpha-ethynylestradiol; acrylamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
C-C chemokine receptor type 2; C-C CKR-2; CC-CKR-2; CCR-2; chemokine (C-C motif) receptor 2; chemokine receptor CCR2; chemokine receptor CCR2 gene
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Allele / Splice:
Ccr2m1Mcwi
Ccr2m2Mcwi
Genetic Models:
BN-Ccr2m2Mcwi
FHH-Ccr2m1Mcwi
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 132,611,883 - 132,619,106 (+) NCBI GRCr8 mRatBN7.2 8 123,734,465 - 123,742,483 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 123,734,430 - 123,742,100 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 129,328,887 - 129,330,008 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 127,528,007 - 127,529,128 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 125,345,931 - 125,347,052 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 RGSC_v3.4 8 128,892,784 - 128,893,905 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 128,912,520 - 128,913,642 (+) NCBI Celera 8 122,833,545 - 122,834,666 (+) NCBI Celera Cytogenetic Map 8 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ccr2 Rat (+)-catechin multiple interactions ISO Ccr2 (Mus musculus) 6480464 [resveratrol co-treated with Catechin co-treated with caffeic acid] results in decreased expression of CCR2 mRNA CTD PMID:16806235 Ccr2 Rat (+)-pilocarpine increases expression EXP 6480464 Pilocarpine results in increased expression of CCR2 protein CTD PMID:20034406 Ccr2 Rat (+)-pilocarpine decreases expression ISO Ccr2 (Mus musculus) 6480464 Pilocarpine results in decreased expression of CCR2 mRNA and Pilocarpine results in decreased expression of CCR2 protein CTD PMID:19490431 Ccr2 Rat 1,3-benzothiazole-2-thiol increases expression ISO CCR2 (Homo sapiens) 6480464 captax results in increased expression of CCR2 mRNA CTD PMID:20713136 Ccr2 Rat 1,4-phenylenediamine decreases expression ISO CCR2 (Homo sapiens) 6480464 4-phenylenediamine results in decreased expression of CCR2 mRNA CTD PMID:19371601 Ccr2 Rat 1-chloro-2,4-dinitrobenzene decreases expression ISO CCR2 (Homo sapiens) 6480464 Dinitrochlorobenzene results in decreased expression of CCR2 mRNA CTD PMID:17374397 and PMID:19371601 Ccr2 Rat 1-chloro-2,4-dinitrobenzene increases expression ISO CCR2 (Homo sapiens) 6480464 Dinitrochlorobenzene results in increased expression of CCR2 mRNA CTD PMID:20713136 Ccr2 Rat 1-chloro-2,4-dinitrobenzene increases expression ISO Ccr2 (Mus musculus) 6480464 Dinitrochlorobenzene results in increased expression of CCR2 mRNA CTD PMID:19647056 Ccr2 Rat 1-fluoro-2,4-dinitrobenzene increases expression ISO CCR2 (Homo sapiens) 6480464 Dinitrofluorobenzene results in increased expression of CCR2 mRNA CTD PMID:21362464 Ccr2 Rat 1-fluoro-2,4-dinitrobenzene multiple interactions ISO CCR2 (Homo sapiens) 6480464 [CCL2 protein results in increased expression of CCR2 protein] which affects the susceptibility to Dinitrofluorobenzene CTD PMID:21362464 Ccr2 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine increases expression ISO Ccr2 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:30195017 Ccr2 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Ccr2 (Mus musculus) 6480464 TGM2 protein affects the reaction [1-Methyl-4-phenyl-1 more ... CTD PMID:30195017 Ccr2 Rat 1-O-palmitoyl-2-O-(5-oxovaleryl)-sn-glycero-3-phosphocholine increases expression ISO CCR2 (Homo sapiens) 6480464 1-palmitoyl-2-(5-oxovaleroyl)-sn-glycero-3-phosphorylcholine results in increased expression of CCR2 mRNA CTD PMID:16386258 Ccr2 Rat 17alpha-ethynylestradiol decreases expression ISO Ccr2 (Mus musculus) 6480464 Ethinyl Estradiol results in decreased expression of CCR2 mRNA CTD PMID:12538720 and PMID:15885639 Ccr2 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of CCR2 mRNA CTD PMID:15834898 Ccr2 Rat 17beta-estradiol increases expression ISO Ccr2 (Mus musculus) 6480464 Estradiol results in increased expression of CCR2 mRNA CTD PMID:19484750 and PMID:39298647 Ccr2 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO CCR2 (Homo sapiens) 6480464 2 more ... CTD PMID:23146750 Ccr2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO CCR2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of CCR2 protein CTD PMID:21685244 Ccr2 Rat 2,4,6-trinitrobenzenesulfonic acid increases expression ISO Ccr2 (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in increased expression of CCR2 mRNA CTD PMID:17982090 Ccr2 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Ccr2 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Ccr2 Rat 2,4-dinitrobenzenesulfonic acid increases expression ISO Ccr2 (Mus musculus) 6480464 2 and 4-dinitrobenzenesulfonic acid results in increased expression of CCR2 mRNA CTD PMID:30116771 Ccr2 Rat 2-acetyl-1-alkyl-sn-glycero-3-phosphocholine increases expression ISO CCR2 (Homo sapiens) 6480464 Platelet Activating Factor results in increased expression of CCR2 mRNA CTD PMID:16386258 Ccr2 Rat 2-butoxyethanol decreases expression ISO Ccr2 (Mus musculus) 6480464 n-butoxyethanol results in decreased expression of CCR2 mRNA CTD PMID:19812364 Ccr2 Rat 3-chlorophenol increases expression ISO CCR2 (Homo sapiens) 6480464 3-chlorophenol results in increased expression of CCR2 mRNA CTD PMID:18486366 Ccr2 Rat 4,4'-sulfonyldiphenol increases expression ISO Ccr2 (Mus musculus) 6480464 bisphenol S results in increased expression of CCR2 mRNA CTD PMID:39298647 Ccr2 Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one decreases expression ISO CCR2 (Homo sapiens) 6480464 Oxazolone results in decreased expression of CCR2 mRNA CTD PMID:17374397 Ccr2 Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one increases expression ISO Ccr2 (Mus musculus) 6480464 Oxazolone results in increased expression of CCR2 mRNA CTD PMID:19647056 Ccr2 Rat 4-hydroxyphenyl retinamide decreases expression ISO Ccr2 (Mus musculus) 6480464 Fenretinide results in decreased expression of CCR2 mRNA CTD PMID:28973697 Ccr2 Rat 5-aza-2'-deoxycytidine increases expression ISO CCR2 (Homo sapiens) 6480464 Decitabine results in increased expression of CCR2 mRNA CTD PMID:21856257 Ccr2 Rat 9-cis-retinoic acid decreases expression ISO CCR2 (Homo sapiens) 6480464 Alitretinoin results in decreased expression of CCR2 mRNA and Alitretinoin results in decreased expression of CCR2 protein CTD PMID:16712875 Ccr2 Rat 9-cis-retinoic acid multiple interactions ISO CCR2 (Homo sapiens) 6480464 4-(4-fluorophenyl)-2-(4-hydroxyphenyl)-5-(4-pyridyl)imidazole inhibits the reaction [Alitretinoin results in decreased expression of CCR2 mRNA] CTD PMID:16712875 Ccr2 Rat acetaldehyde increases expression ISO CCR2 (Homo sapiens) 6480464 Acetaldehyde results in increased expression of CCR2 protein CTD PMID:19036374 Ccr2 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of CCR2 mRNA CTD PMID:28959563 Ccr2 Rat aflatoxin B1 increases methylation ISO CCR2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of CCR2 gene CTD PMID:27153756 Ccr2 Rat Aflatoxin B2 alpha increases methylation ISO CCR2 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of CCR2 promoter CTD PMID:30157460 Ccr2 Rat all-trans-retinoic acid increases expression ISO CCR2 (Homo sapiens) 6480464 Tretinoin results in increased expression of CCR2 mRNA CTD PMID:19828696 Ccr2 Rat AM6545 multiple interactions ISO Ccr2 (Mus musculus) 6480464 [AM6545 co-treated with Perindopril] inhibits the reaction [Streptozocin results in increased expression of CCR2 mRNA] and AM6545 inhibits the reaction [Streptozocin results in increased expression of CCR2 mRNA] CTD PMID:30184259 Ccr2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CCR2 mRNA CTD PMID:16483693 Ccr2 Rat ammonium hexachloroplatinate decreases expression ISO CCR2 (Homo sapiens) 6480464 ammonium hexachloroplatinate results in decreased expression of CCR2 mRNA CTD PMID:19371601 Ccr2 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of CCR2 mRNA CTD PMID:30779732 Ccr2 Rat amphotericin B decreases expression EXP 6480464 Amphotericin B results in decreased expression of CCR2 mRNA CTD PMID:20623750 Ccr2 Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions ISO CCR2 (Homo sapiens) 6480464 pyrazolanthrone inhibits the reaction [Silicon Dioxide results in increased expression of CCR2 protein] CTD PMID:26163174 Ccr2 Rat antirheumatic drug decreases expression ISO CCR2 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of CCR2 mRNA CTD PMID:24449571 and PMID:25339124 Ccr2 Rat arsane affects expression ISO CCR2 (Homo sapiens) 6480464 Arsenic affects the expression of CCR2 protein CTD PMID:24675094 Ccr2 Rat arsane affects methylation ISO CCR2 (Homo sapiens) 6480464 Arsenic affects the methylation of CCR2 gene CTD PMID:25304211 Ccr2 Rat arsane decreases expression ISO Ccr2 (Mus musculus) 6480464 Arsenic results in decreased expression of CCR2 mRNA CTD PMID:19654921 Ccr2 Rat arsane decreases expression ISO CCR2 (Homo sapiens) 6480464 Arsenic results in decreased expression of CCR2 mRNA CTD PMID:19962721 Ccr2 Rat arsane multiple interactions ISO CCR2 (Homo sapiens) 6480464 [Arsenic co-treated with Fluorides] results in decreased expression of CCR2 mRNA CTD PMID:19962721 Ccr2 Rat arsenic atom affects expression ISO CCR2 (Homo sapiens) 6480464 Arsenic affects the expression of CCR2 protein CTD PMID:24675094 Ccr2 Rat arsenic atom affects methylation ISO CCR2 (Homo sapiens) 6480464 Arsenic affects the methylation of CCR2 gene CTD PMID:25304211 Ccr2 Rat arsenic atom decreases expression ISO Ccr2 (Mus musculus) 6480464 Arsenic results in decreased expression of CCR2 mRNA CTD PMID:19654921 Ccr2 Rat arsenic atom decreases expression ISO CCR2 (Homo sapiens) 6480464 Arsenic results in decreased expression of CCR2 mRNA CTD PMID:19962721 Ccr2 Rat arsenic atom multiple interactions ISO CCR2 (Homo sapiens) 6480464 [Arsenic co-treated with Fluorides] results in decreased expression of CCR2 mRNA CTD PMID:19962721 Ccr2 Rat asbestos affects expression ISO CCR2 (Homo sapiens) 6480464 Asbestos affects the expression of CCR2 mRNA CTD PMID:17297452 Ccr2 Rat asperentin increases expression ISO Ccr2 (Mus musculus) 6480464 cladosporin results in increased expression of CCR2 mRNA CTD PMID:19818335 Ccr2 Rat Azoxymethane multiple interactions ISO Ccr2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of CCR2 mRNA CTD PMID:29950665 Ccr2 Rat barium sulfate increases expression EXP 6480464 Barium Sulfate results in increased expression of CCR2 mRNA CTD PMID:29463257 Ccr2 Rat benzo[a]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with 1 more ... CTD PMID:18711122 Ccr2 Rat benzo[a]pyrene decreases methylation ISO CCR2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of CCR2 5' UTR CTD PMID:27901495 Ccr2 Rat benzo[a]pyrene increases methylation ISO CCR2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of CCR2 promoter CTD PMID:27901495 Ccr2 Rat benzo[a]pyrene affects methylation ISO CCR2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CCR2 3' UTR CTD PMID:27901495 Ccr2 Rat benzo[a]pyrene increases expression ISO Ccr2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of CCR2 mRNA CTD PMID:23735875 Ccr2 Rat benzo[a]pyrene decreases expression ISO Ccr2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of CCR2 mRNA CTD PMID:21569818 Ccr2 Rat benzo[b]fluoranthene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benzo(b)fluoranthene] affects the expression of CCR2 mRNA CTD PMID:18711122 Ccr2 Rat benzylpenicillin multiple interactions ISO Ccr2 (Mus musculus) 6480464 [Penicillin G co-treated with Erythromycin] results in increased expression of CCR2 mRNA CTD PMID:27503388 Ccr2 Rat bis(2-chloroethyl) sulfide increases expression ISO Ccr2 (Mus musculus) 6480464 Mustard Gas results in increased expression of CCR2 mRNA CTD PMID:18955075 Ccr2 Rat bis(2-ethylhexyl) phthalate increases expression ISO Ccr2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of CCR2 mRNA CTD PMID:28085963 Ccr2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Ccr2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of CCR2 mRNA CTD PMID:34319233 Ccr2 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO CCR2 (Homo sapiens) 6480464 KLF7 protein inhibits the reaction [Diethylhexyl Phthalate results in increased expression of CCR2 mRNA] CTD PMID:37734194 Ccr2 Rat bis(2-ethylhexyl) phthalate increases expression ISO CCR2 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of CCR2 mRNA CTD PMID:37734194 Ccr2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CCR2 mRNA CTD PMID:25181051 Ccr2 Rat bisphenol A increases expression ISO Ccr2 (Mus musculus) 6480464 bisphenol A results in increased expression of CCR2 mRNA CTD PMID:32144343 and PMID:32156529 Ccr2 Rat bisphenol A multiple interactions ISO Ccr2 (Mus musculus) 6480464 necrostatin-1 inhibits the reaction [bisphenol A results in increased expression of CCR2 mRNA] CTD PMID:32144343 Ccr2 Rat bleomycin A2 increases expression ISO Ccr2 (Mus musculus) 6480464 Bleomycin results in increased expression of CCR2 mRNA CTD PMID:29033951 Ccr2 Rat bleomycin A2 decreases response to substance ISO Ccr2 (Mus musculus) 6480464 CCR2 gene mutant form results in decreased susceptibility to Bleomycin CTD PMID:14609568 Ccr2 Rat bleomycin A2 multiple interactions ISO Ccr2 (Mus musculus) 6480464 CCR2 gene mutant form inhibits the reaction [Bleomycin results in increased expression of ACTA2 mRNA] more ... CTD PMID:14609568 Ccr2 Rat Brevianamide A increases expression ISO Ccr2 (Mus musculus) 6480464 brevianamide A results in increased expression of CCR2 mRNA CTD PMID:19818335 Ccr2 Rat buta-1,3-diene decreases expression ISO Ccr2 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of CCR2 mRNA CTD PMID:29038090 Ccr2 Rat cadmium atom multiple interactions ISO Ccr2 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of CCR2 mRNA CTD PMID:36200916 Ccr2 Rat cadmium dichloride multiple interactions ISO Ccr2 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of CCR2 mRNA CTD PMID:36200916 Ccr2 Rat carbon nanotube increases expression ISO Ccr2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Ccr2 Rat celecoxib decreases expression ISO Ccr2 (Mus musculus) 6480464 Celecoxib results in decreased expression of CCR2 mRNA CTD PMID:12902868 Ccr2 Rat ceric oxide increases expression EXP 6480464 ceric oxide results in increased expression of CCR2 mRNA CTD PMID:29463257 Ccr2 Rat chenodeoxycholic acid multiple interactions ISO CCR2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of CCR2 mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of CCR2 mRNA CTD PMID:32152650 Ccr2 Rat chloroprene decreases expression ISO Ccr2 (Mus musculus) 6480464 Chloroprene results in decreased expression of CCR2 mRNA CTD PMID:23125180 Ccr2 Rat chlorpyrifos decreases expression ISO Ccr2 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of CCR2 mRNA CTD PMID:37019170 Ccr2 Rat choline multiple interactions ISO Ccr2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CCR2 mRNA CTD PMID:20938992 Ccr2 Rat cis-caffeic acid multiple interactions ISO Ccr2 (Mus musculus) 6480464 [resveratrol co-treated with Catechin co-treated with caffeic acid] results in decreased expression of CCR2 mRNA CTD PMID:16806235 Ccr2 Rat cisplatin increases expression ISO CCR2 (Homo sapiens) 6480464 Cisplatin results in increased expression of CCR2 mRNA CTD PMID:27594783 Ccr2 Rat cocaine affects expression EXP 6480464 Cocaine affects the expression of CCR2 mRNA CTD PMID:20187946 Ccr2 Rat cocaine increases response to substance ISO Ccr2 (Mus musculus) 6480464 CCR2 results in increased susceptibility to Cocaine CTD PMID:20354174 Ccr2 Rat crocidolite asbestos decreases expression ISO CCR2 (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of CCR2 mRNA CTD PMID:24160326 Ccr2 Rat curcumin decreases expression ISO Ccr2 (Mus musculus) 6480464 Curcumin results in decreased expression of CCR2 mRNA CTD PMID:18403477 Ccr2 Rat cyclosporin A increases expression ISO CCR2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of CCR2 mRNA CTD PMID:20106945 and PMID:32152650 Ccr2 Rat cyclosporin A multiple interactions ISO CCR2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of CCR2 mRNA CTD PMID:32152650 Ccr2 Rat deoxycholic acid multiple interactions ISO CCR2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of CCR2 mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of CCR2 mRNA CTD PMID:32152650 Ccr2 Rat deoxynivalenol increases expression ISO Ccr2 (Mus musculus) 6480464 deoxynivalenol results in increased expression of CCR2 mRNA CTD PMID:22968694 Ccr2 Rat dextran sulfate multiple interactions ISO Ccr2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of CCR2 mRNA CTD PMID:29950665 Ccr2 Rat dibenz[a,h]anthracene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with 1 more ... CTD PMID:18711122 Ccr2 Rat dibenzo[a,l]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with dibenzo(a and l)pyrene] affects the expression of CCR2 mRNA CTD PMID:18711122 Ccr2 Rat Didecyldimethylammonium increases expression ISO Ccr2 (Mus musculus) 6480464 didecyldimethylammonium results in increased expression of CCR2 mRNA CTD PMID:19762220 Ccr2 Rat diethylstilbestrol increases expression ISO Ccr2 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of CCR2 mRNA CTD PMID:21041162 Ccr2 Rat dimethylarsinic acid decreases expression EXP 6480464 Cacodylic Acid results in decreased expression of CCR2 mRNA CTD PMID:37567419 Ccr2 Rat disulfiram increases expression ISO CCR2 (Homo sapiens) 6480464 Disulfiram results in increased expression of CCR2 protein CTD PMID:32712770 Ccr2 Rat diuron decreases expression ISO CCR2 (Homo sapiens) 6480464 Diuron results in decreased expression of CCR2 mRNA CTD PMID:35967413 Ccr2 Rat doxorubicin multiple interactions EXP 6480464 [Doxorubicin co-treated with Fungal Polysaccharides] results in decreased expression of CCR2 mRNA CTD PMID:27181935 Ccr2 Rat doxorubicin increases expression ISO Ccr2 (Mus musculus) 6480464 Doxorubicin results in increased expression of CCR2 mRNA CTD PMID:36227756 Ccr2 Rat edaravone multiple interactions ISO Ccr2 (Mus musculus) 6480464 Edaravone inhibits the reaction [Thioacetamide results in increased expression of CCR2 mRNA] CTD PMID:36343683 Ccr2 Rat erythromycin A increases expression ISO Ccr2 (Mus musculus) 6480464 Erythromycin results in increased expression of CCR2 mRNA CTD PMID:27503388 Ccr2 Rat erythromycin A multiple interactions ISO Ccr2 (Mus musculus) 6480464 [Penicillin G co-treated with Erythromycin] results in increased expression of CCR2 mRNA CTD PMID:27503388 Ccr2 Rat ethanol increases expression ISO CCR2 (Homo sapiens) 6480464 Ethanol results in increased expression of CCR2 mRNA CTD PMID:26014148 Ccr2 Rat ethanol multiple interactions ISO Ccr2 (Mus musculus) 6480464 5-aminoisoquinolinone inhibits the reaction [Ethanol results in increased expression of CCR2 mRNA] more ... CTD PMID:27984176 Ccr2 Rat ethanol increases expression ISO Ccr2 (Mus musculus) 6480464 Ethanol results in increased expression of CCR2 mRNA CTD PMID:27984176 Ccr2 Rat ethyl methanesulfonate decreases expression ISO CCR2 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of CCR2 mRNA CTD PMID:23649840 Ccr2 Rat eugenol decreases expression ISO CCR2 (Homo sapiens) 6480464 Eugenol results in decreased expression of CCR2 mRNA CTD PMID:17374397 Ccr2 Rat flumequine multiple interactions ISO Ccr2 (Mus musculus) 6480464 [flumequine co-treated with 2-amino-3 more ... CTD PMID:23681119 Ccr2 Rat folic acid multiple interactions ISO Ccr2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CCR2 mRNA CTD PMID:20938992 Ccr2 Rat glycochenodeoxycholic acid multiple interactions ISO CCR2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of CCR2 mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of CCR2 mRNA CTD PMID:32152650 Ccr2 Rat glycocholic acid multiple interactions ISO CCR2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of CCR2 mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of CCR2 mRNA CTD PMID:32152650 Ccr2 Rat glycodeoxycholic acid multiple interactions ISO CCR2 (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of CCR2 mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of CCR2 mRNA CTD PMID:32152650 Ccr2 Rat isoniazide decreases expression EXP 6480464 Isoniazid results in decreased expression of CCR2 mRNA CTD PMID:20623750 Ccr2 Rat L-methionine multiple interactions ISO Ccr2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CCR2 mRNA CTD PMID:20938992 Ccr2 Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of CCR2 mRNA CTD PMID:22641619 Ccr2 Rat lead diacetate increases expression ISO Ccr2 (Mus musculus) 6480464 lead acetate results in increased expression of CCR2 mRNA CTD PMID:22609695 Ccr2 Rat linuron multiple interactions ISO Ccr2 (Mus musculus) 6480464 SIGMAR1 gene mutant form inhibits the reaction [Linuron results in increased expression of CCR2 mRNA] and XBP1 gene mutant form inhibits the reaction [Linuron results in increased expression of CCR2 mRNA] CTD PMID:30661753 Ccr2 Rat linuron increases expression ISO Ccr2 (Mus musculus) 6480464 Linuron results in increased expression of CCR2 mRNA CTD PMID:30661753 Ccr2 Rat lipopolysaccharide increases expression ISO CCR2 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of CCR2 mRNA CTD PMID:35953652 Ccr2 Rat lipopolysaccharide decreases expression ISO CCR2 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of CCR2 mRNA CTD PMID:35811015 Ccr2 Rat lipopolysaccharide multiple interactions ISO CCR2 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 and PMID:35953652 Ccr2 Rat losartan decreases expression EXP 6480464 Losartan results in decreased expression of CCR2 mRNA CTD PMID:17922026 Ccr2 Rat LY294002 multiple interactions ISO CCR2 (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Silicon Dioxide results in increased expression of CCR2 protein] CTD PMID:26163174 Ccr2 Rat mechlorethamine multiple interactions EXP 6480464 Valproic Acid inhibits the reaction [Mechlorethamine results in increased expression of CCR2 mRNA] CTD PMID:28184907 Ccr2 Rat mechlorethamine increases expression EXP 6480464 Mechlorethamine results in increased expression of CCR2 mRNA and Mechlorethamine results in increased expression of CCR2 protein CTD PMID:26273949 and PMID:28184907 Ccr2 Rat MeIQx multiple interactions ISO Ccr2 (Mus musculus) 6480464 [flumequine co-treated with 2-amino-3 more ... CTD PMID:23681119 Ccr2 Rat mercury atom decreases expression ISO CCR2 (Homo sapiens) 6480464 Mercury results in decreased expression of CCR2 mRNA CTD PMID:16823088 Ccr2 Rat mercury dichloride increases response to substance EXP 6480464 CCR2 protein results in increased susceptibility to Mercuric Chloride CTD PMID:12834626 Ccr2 Rat mercury dichloride increases expression EXP 6480464 Mercuric Chloride results in increased expression of CCR2 mRNA and Mercuric Chloride results in increased expression of CCR2 protein CTD PMID:12834626 Ccr2 Rat mercury(0) decreases expression ISO CCR2 (Homo sapiens) 6480464 Mercury results in decreased expression of CCR2 mRNA CTD PMID:16823088 Ccr2 Rat metformin multiple interactions ISO Ccr2 (Mus musculus) 6480464 Metformin inhibits the reaction [IL13 protein results in increased expression of CCR2 mRNA] CTD PMID:26497364 Ccr2 Rat methamphetamine increases response to substance ISO Ccr2 (Mus musculus) 6480464 CCR2 protein results in increased susceptibility to Methamphetamine CTD PMID:20624155 Ccr2 Rat methamphetamine increases expression ISO Ccr2 (Mus musculus) 6480464 Methamphetamine results in increased expression of CCR2 mRNA CTD PMID:20624155 Ccr2 Rat methamphetamine increases methylation ISO Ccr2 (Mus musculus) 6480464 Methamphetamine results in increased methylation of CCR2 promoter CTD PMID:20624155 Ccr2 Rat methotrexate decreases expression ISO CCR2 (Homo sapiens) 6480464 Methotrexate results in decreased expression of CCR2 mRNA CTD PMID:24449571 Ccr2 Rat methyl methanesulfonate decreases expression ISO CCR2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of CCR2 mRNA CTD PMID:23649840 Ccr2 Rat mevalonic acid multiple interactions ISO CCR2 (Homo sapiens) 6480464 Mevalonic Acid inhibits the reaction [Simvastatin inhibits the reaction [IFNG results in increased expression of CCR2 mRNA]] CTD PMID:16321392 Ccr2 Rat mycophenolic acid increases expression ISO Ccr2 (Mus musculus) 6480464 Mycophenolic Acid results in increased expression of CCR2 mRNA CTD PMID:19818335 Ccr2 Rat mycotoxin increases expression ISO Ccr2 (Mus musculus) 6480464 Mycotoxins results in increased expression of CCR2 mRNA CTD PMID:19818335 Ccr2 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine increases expression ISO CCR2 (Homo sapiens) 6480464 N more ... CTD PMID:19013360 Ccr2 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine decreases expression ISO CCR2 (Homo sapiens) 6480464 N more ... CTD PMID:12756304 Ccr2 Rat nefazodone increases expression ISO CCR2 (Homo sapiens) 6480464 nefazodone results in increased expression of CCR2 mRNA CTD PMID:32152650 Ccr2 Rat nefazodone multiple interactions ISO CCR2 (Homo sapiens) 6480464 [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of CCR2 mRNA CTD PMID:32152650 Ccr2 Rat neoechinulin A increases expression ISO Ccr2 (Mus musculus) 6480464 neoechinulin A results in increased expression of CCR2 mRNA CTD PMID:19818335 Ccr2 Rat nickel atom affects expression ISO CCR2 (Homo sapiens) 6480464 Nickel affects the expression of CCR2 mRNA CTD PMID:14575637 Ccr2 Rat nickel atom increases expression ISO CCR2 (Homo sapiens) 6480464 Nickel results in increased expression of CCR2 mRNA CTD PMID:24768652 and PMID:25583101 Ccr2 Rat nickel atom multiple interactions ISO CCR2 (Homo sapiens) 6480464 trichostatin A inhibits the reaction [Nickel affects the expression of CCR2 mRNA] CTD PMID:14575637 Ccr2 Rat nickel atom decreases expression ISO CCR2 (Homo sapiens) 6480464 Nickel results in decreased expression of CCR2 mRNA CTD PMID:23195993 Ccr2 Rat nickel sulfate decreases expression ISO CCR2 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of CCR2 mRNA CTD PMID:17374397 Ccr2 Rat olaparib multiple interactions ISO Ccr2 (Mus musculus) 6480464 [Ethanol co-treated with Dietary Fats co-treated with olaparib] results in decreased expression of CCR2 mRNA CTD PMID:27984176 Ccr2 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CCR2 mRNA CTD PMID:25729387 Ccr2 Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of CCR2 mRNA CTD PMID:25729387 Ccr2 Rat ozone multiple interactions EXP 6480464 [Fish Oils co-treated with Ozone] results in increased expression of CCR2 mRNA CTD PMID:33217375 Ccr2 Rat ozone multiple interactions ISO Ccr2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of CCR2 mRNA CTD PMID:34911549 Ccr2 Rat ozone increases expression ISO Ccr2 (Mus musculus) 6480464 Ozone results in increased expression of CCR2 mRNA CTD PMID:38897669 Ccr2 Rat ozone decreases expression ISO Ccr2 (Mus musculus) 6480464 Ozone results in decreased expression of CCR2 mRNA CTD PMID:26342085 Ccr2 Rat ozone decreases response to substance ISO Ccr2 (Mus musculus) 6480464 CCR2 gene mutant form results in decreased susceptibility to Ozone CTD PMID:27837169 Ccr2 Rat paracetamol increases expression ISO CCR2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of CCR2 mRNA CTD PMID:26690555 Ccr2 Rat paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of CCR2 mRNA CTD PMID:20623750 Ccr2 Rat paracetamol affects response to substance ISO Ccr2 (Mus musculus) 6480464 CCR2 protein affects the susceptibility to Acetaminophen CTD PMID:18713872 Ccr2 Rat paracetamol affects expression ISO Ccr2 (Mus musculus) 6480464 Acetaminophen affects the expression of CCR2 mRNA CTD PMID:17562736 Ccr2 Rat paracetamol increases expression ISO Ccr2 (Mus musculus) 6480464 Acetaminophen results in increased expression of CCR2 mRNA and Acetaminophen results in increased expression of CCR2 protein CTD PMID:11981759 more ... Ccr2 Rat paracetamol multiple interactions ISO Ccr2 (Mus musculus) 6480464 CCR2 protein affects the reaction [Acetaminophen results in increased expression of CCL7 protein] more ... CTD PMID:11981759 and PMID:22575169 Ccr2 Rat paricalcitol increases expression ISO Ccr2 (Mus musculus) 6480464 paricalcitol results in increased expression of CCR2 mRNA CTD PMID:25037058 Ccr2 Rat PCB138 affects expression ISO CCR2 (Homo sapiens) 6480464 2 more ... CTD PMID:21703328 Ccr2 Rat pentachlorophenol increases expression ISO CCR2 (Homo sapiens) 6480464 Pentachlorophenol results in increased expression of CCR2 mRNA CTD PMID:35550411 Ccr2 Rat perindopril multiple interactions ISO Ccr2 (Mus musculus) 6480464 [AM6545 co-treated with Perindopril] inhibits the reaction [Streptozocin results in increased expression of CCR2 mRNA] and Perindopril inhibits the reaction [Streptozocin results in increased expression of CCR2 mRNA] CTD PMID:30184259 Ccr2 Rat picrotoxin increases expression EXP 6480464 Picrotoxin results in increased expression of CCR2 mRNA CTD PMID:15170462 Ccr2 Rat piperidines multiple interactions ISO CCR2 (Homo sapiens) 6480464 Piperidines analog binds to and results in decreased activity of CCR2 protein and Piperidines analog inhibits the reaction [CCL2 protein binds to CCR2 protein] CTD PMID:10770925 and PMID:10843593 Ccr2 Rat proanthocyanidin decreases expression ISO CCR2 (Homo sapiens) 6480464 proanthocyanidin results in decreased expression of CCR2 mRNA CTD PMID:12462994 Ccr2 Rat protein kinase inhibitor multiple interactions ISO CCR2 (Homo sapiens) 6480464 Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in increased expression of CCR2 mRNA] CTD PMID:28003376 Ccr2 Rat resveratrol multiple interactions ISO Ccr2 (Mus musculus) 6480464 [resveratrol co-treated with Catechin co-treated with caffeic acid] results in decreased expression of CCR2 mRNA CTD PMID:16806235 Ccr2 Rat resveratrol decreases expression ISO CCR2 (Homo sapiens) 6480464 Resveratrol results in decreased expression of CCR2 mRNA and Resveratrol results in decreased expression of CCR2 protein CTD PMID:17499741 Ccr2 Rat rotenone decreases expression ISO CCR2 (Homo sapiens) 6480464 Rotenone results in decreased expression of CCR2 mRNA CTD PMID:29331484 Ccr2 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO CCR2 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Ccr2 Rat SB 203580 multiple interactions ISO CCR2 (Homo sapiens) 6480464 SB 203580 inhibits the reaction [Silicon Dioxide results in increased expression of CCR2 protein] CTD PMID:26163174 Ccr2 Rat serpentine asbestos increases expression ISO Ccr2 (Mus musculus) 6480464 Asbestos and Serpentine results in increased expression of CCR2 mRNA CTD PMID:16251409 Ccr2 Rat sevoflurane multiple interactions ISO CCR2 (Homo sapiens) 6480464 Sevoflurane inhibits the reaction [Lipopolysaccharides results in increased expression of CCR2 mRNA] CTD PMID:35953652 Ccr2 Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of CCR2 mRNA CTD PMID:21602193 Ccr2 Rat silicon dioxide increases expression ISO Ccr2 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of CCR2 mRNA and Silicon Dioxide results in increased expression of CCR2 protein CTD PMID:29341224 Ccr2 Rat silicon dioxide increases expression ISO CCR2 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of CCR2 mRNA and Silicon Dioxide results in increased expression of CCR2 protein CTD PMID:26163174 Ccr2 Rat silicon dioxide multiple interactions ISO CCR2 (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Silicon Dioxide results in increased expression of CCR2 protein] more ... CTD PMID:26163174 Ccr2 Rat simvastatin decreases expression ISO CCR2 (Homo sapiens) 6480464 Simvastatin results in decreased expression of CCR2 mRNA and Simvastatin results in decreased expression of CCR2 protein CTD PMID:15781755 and PMID:16781696 Ccr2 Rat simvastatin decreases expression EXP 6480464 Simvastatin results in decreased expression of CCR2 mRNA and Simvastatin results in decreased expression of CCR2 protein CTD PMID:16414398 and PMID:17449418 Ccr2 Rat simvastatin multiple interactions ISO CCR2 (Homo sapiens) 6480464 [2-chloro-5-nitrobenzanilide binds to and results in decreased activity of PPARG protein] inhibits the reaction [Simvastatin results in decreased expression of CCR2 mRNA] more ... CTD PMID:15781755 and PMID:16321392 Ccr2 Rat sodium arsenate increases expression ISO Ccr2 (Mus musculus) 6480464 sodium arsenate results in increased expression of CCR2 mRNA CTD PMID:30953684 Ccr2 Rat sodium arsenite increases expression ISO Ccr2 (Mus musculus) 6480464 sodium arsenite results in increased expression of CCR2 mRNA CTD PMID:21911445 Ccr2 Rat sodium arsenite increases expression ISO CCR2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of CCR2 mRNA CTD PMID:38568856 Ccr2 Rat sodium chlorate multiple interactions ISO CCR2 (Homo sapiens) 6480464 sodium chlorate inhibits the reaction [CCL2 protein results in increased activity of CCR2 protein] CTD PMID:23408426 Ccr2 Rat sodium chlorate decreases sulfation ISO CCR2 (Homo sapiens) 6480464 sodium chlorate results in decreased sulfation of CCR2 protein CTD PMID:23408426 Ccr2 Rat sodium fluoride decreases expression EXP 6480464 Sodium Fluoride results in decreased expression of CCR2 mRNA CTD PMID:27257137 Ccr2 Rat sterigmatocystin increases expression ISO Ccr2 (Mus musculus) 6480464 Sterigmatocystin results in increased expression of CCR2 mRNA CTD PMID:19818335 Ccr2 Rat streptozocin increases expression ISO Ccr2 (Mus musculus) 6480464 Streptozocin results in increased expression of CCR2 mRNA CTD PMID:30184259 Ccr2 Rat streptozocin multiple interactions ISO Ccr2 (Mus musculus) 6480464 [AM6545 co-treated with Perindopril] inhibits the reaction [Streptozocin results in increased expression of CCR2 mRNA] more ... CTD PMID:30184259 Ccr2 Rat sulforaphane decreases expression ISO CCR2 (Homo sapiens) 6480464 sulforaphane results in decreased expression of CCR2 mRNA CTD PMID:26833863 Ccr2 Rat tacrolimus hydrate increases expression ISO Ccr2 (Mus musculus) 6480464 Tacrolimus results in increased expression of CCR2 mRNA CTD PMID:29362864 Ccr2 Rat tamoxifen decreases expression ISO Ccr2 (Mus musculus) 6480464 Tamoxifen results in decreased expression of CCR2 mRNA CTD PMID:25123088 Ccr2 Rat tamoxifen multiple interactions ISO Ccr2 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Tamoxifen] affects the expression of CCR2 mRNA CTD PMID:29974145 Ccr2 Rat telmisartan decreases expression EXP 6480464 telmisartan results in decreased expression of CCR2 mRNA CTD PMID:17922026 Ccr2 Rat tetrachloromethane increases expression ISO Ccr2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of CCR2 mRNA and Carbon Tetrachloride results in increased expression of CCR2 protein CTD PMID:22206755 more ... Ccr2 Rat tetrachloromethane multiple interactions ISO Ccr2 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Tamoxifen] affects the expression of CCR2 mRNA more ... CTD PMID:22206755 more ... Ccr2 Rat thioacetamide increases expression ISO Ccr2 (Mus musculus) 6480464 Thioacetamide results in increased expression of CCR2 mRNA CTD PMID:36343683 Ccr2 Rat thioacetamide multiple interactions ISO Ccr2 (Mus musculus) 6480464 Edaravone inhibits the reaction [Thioacetamide results in increased expression of CCR2 mRNA] CTD PMID:36343683 Ccr2 Rat thiram decreases expression ISO CCR2 (Homo sapiens) 6480464 Thiram results in decreased expression of CCR2 mRNA CTD PMID:19371601 Ccr2 Rat titanium dioxide increases expression ISO Ccr2 (Mus musculus) 6480464 titanium dioxide results in increased expression of CCR2 mRNA CTD PMID:23557971 Ccr2 Rat titanium dioxide multiple interactions ISO Ccr2 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of CCR2 mRNA CTD PMID:29950665 Ccr2 Rat titanium dioxide decreases expression ISO Ccr2 (Mus musculus) 6480464 titanium dioxide results in decreased expression of CCR2 mRNA CTD PMID:29264374 Ccr2 Rat TMC-120A increases expression ISO Ccr2 (Mus musculus) 6480464 TMC 120A results in increased expression of CCR2 mRNA CTD PMID:19818335 Ccr2 Rat toluene 2,4-diisocyanate increases expression ISO Ccr2 (Mus musculus) 6480464 Toluene 2 and 4-Diisocyanate results in increased expression of CCR2 mRNA CTD PMID:19647056 Ccr2 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CCR2 mRNA CTD PMID:25729387 Ccr2 Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of CCR2 mRNA CTD PMID:25729387 Ccr2 Rat trans-caffeic acid multiple interactions ISO Ccr2 (Mus musculus) 6480464 [resveratrol co-treated with Catechin co-treated with caffeic acid] results in decreased expression of CCR2 mRNA CTD PMID:16806235 Ccr2 Rat trichostatin A multiple interactions ISO CCR2 (Homo sapiens) 6480464 trichostatin A inhibits the reaction [Nickel affects the expression of CCR2 mRNA] CTD PMID:14575637 Ccr2 Rat triclosan increases expression ISO CCR2 (Homo sapiens) 6480464 Triclosan results in increased expression of CCR2 mRNA CTD PMID:34681664 Ccr2 Rat tungsten decreases expression ISO Ccr2 (Mus musculus) 6480464 Tungsten results in decreased expression of CCR2 mRNA CTD PMID:30912803 Ccr2 Rat valproic acid multiple interactions EXP 6480464 Valproic Acid inhibits the reaction [Mechlorethamine results in increased expression of CCR2 mRNA] CTD PMID:28184907 Ccr2 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of CCR2 mRNA CTD PMID:23034163 Ccr2 Rat zinc sulfate increases expression ISO CCR2 (Homo sapiens) 6480464 Zinc Sulfate results in increased expression of CCR2 mRNA CTD PMID:12756304 and PMID:32712770 Ccr2 Rat ziram increases expression ISO CCR2 (Homo sapiens) 6480464 Ziram results in increased expression of CCR2 mRNA CTD PMID:32712770 Ccr2 Rat ziram decreases expression ISO CCR2 (Homo sapiens) 6480464 Ziram results in decreased expression of CCR2 protein CTD PMID:32712770
Imported Annotations - KEGG (archival)
(+)-catechin (ISO) (+)-pilocarpine (EXP,ISO) 1,3-benzothiazole-2-thiol (ISO) 1,4-phenylenediamine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 1-fluoro-2,4-dinitrobenzene (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 1-O-palmitoyl-2-O-(5-oxovaleryl)-sn-glycero-3-phosphocholine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-trinitrobenzenesulfonic acid (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrobenzenesulfonic acid (ISO) 2-acetyl-1-alkyl-sn-glycero-3-phosphocholine (ISO) 2-butoxyethanol (ISO) 3-chlorophenol (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 9-cis-retinoic acid (ISO) acetaldehyde (ISO) acrylamide (EXP) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) AM6545 (ISO) ammonium chloride (EXP) ammonium hexachloroplatinate (ISO) amphetamine (EXP) amphotericin B (EXP) anthra[1,9-cd]pyrazol-6(2H)-one (ISO) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) asbestos (ISO) asperentin (ISO) Azoxymethane (ISO) barium sulfate (EXP) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (EXP) benzylpenicillin (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bleomycin A2 (ISO) Brevianamide A (ISO) buta-1,3-diene (ISO) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) celecoxib (ISO) ceric oxide (EXP) chenodeoxycholic acid (ISO) chloroprene (ISO) chlorpyrifos (ISO) choline (ISO) cis-caffeic acid (ISO) cisplatin (ISO) cocaine (EXP,ISO) crocidolite asbestos (ISO) curcumin (ISO) cyclosporin A (ISO) deoxycholic acid (ISO) deoxynivalenol (ISO) dextran sulfate (ISO) dibenz[a,h]anthracene (EXP) dibenzo[a,l]pyrene (EXP) Didecyldimethylammonium (ISO) diethylstilbestrol (ISO) dimethylarsinic acid (EXP) disulfiram (ISO) diuron (ISO) doxorubicin (EXP,ISO) edaravone (ISO) erythromycin A (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) eugenol (ISO) flumequine (ISO) folic acid (ISO) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) isoniazide (EXP) L-methionine (ISO) lead diacetate (EXP,ISO) linuron (ISO) lipopolysaccharide (ISO) losartan (EXP) LY294002 (ISO) mechlorethamine (EXP) MeIQx (ISO) mercury atom (ISO) mercury dichloride (EXP) mercury(0) (ISO) metformin (ISO) methamphetamine (ISO) methotrexate (ISO) methyl methanesulfonate (ISO) mevalonic acid (ISO) mycophenolic acid (ISO) mycotoxin (ISO) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) nefazodone (ISO) neoechinulin A (ISO) nickel atom (ISO) nickel sulfate (ISO) olaparib (ISO) oxaliplatin (EXP) ozone (EXP,ISO) paracetamol (EXP,ISO) paricalcitol (ISO) PCB138 (ISO) pentachlorophenol (ISO) perindopril (ISO) picrotoxin (EXP) piperidines (ISO) proanthocyanidin (ISO) protein kinase inhibitor (ISO) resveratrol (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 203580 (ISO) serpentine asbestos (ISO) sevoflurane (ISO) silicon dioxide (EXP,ISO) simvastatin (EXP,ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium chlorate (ISO) sodium fluoride (EXP) sterigmatocystin (ISO) streptozocin (ISO) sulforaphane (ISO) tacrolimus hydrate (ISO) tamoxifen (ISO) telmisartan (EXP) tetrachloromethane (ISO) thioacetamide (ISO) thiram (ISO) titanium dioxide (ISO) TMC-120A (ISO) toluene 2,4-diisocyanate (ISO) topotecan (EXP) trans-caffeic acid (ISO) trichostatin A (ISO) triclosan (ISO) tungsten (ISO) valproic acid (EXP) vinclozolin (EXP) zinc sulfate (ISO) ziram (ISO)
Biological Process
blood vessel remodeling (IEA,IEP) calcium-mediated signaling (IBA) cell chemotaxis (IBA) cellular defense response (ISO) cellular homeostasis (ISO,ISS) chemokine-mediated signaling pathway (IMP) chemotaxis (IEA) cytokine-mediated signaling pathway (IMP,ISO) G protein-coupled receptor signaling pathway (IEA,IMP) hemopoiesis (ISO) homeostasis of number of cells within a tissue (ISO) humoral immune response (ISO) immune response (IBA,IEA,ISO) inflammatory response (IBA,IEA,ISO) inflammatory response to antigenic stimulus (IEP) inflammatory response to wounding (ISO,ISS) intracellular calcium ion homeostasis (IDA) leukocyte adhesion to vascular endothelial cell (ISO) macrophage migration (ISO,ISS) monocyte chemotaxis (ISO) monocyte extravasation (ISO,ISS) negative regulation of angiogenesis (ISO,ISS) negative regulation of eosinophil degranulation (ISO,ISS) negative regulation of type 2 immune response (ISO,ISS) neutrophil clearance (ISO) positive regulation of alpha-beta T cell proliferation (ISO,ISS) positive regulation of astrocyte chemotaxis (ISO,ISS) positive regulation of CD8-positive, alpha-beta T cell extravasation (ISO,ISS) positive regulation of cold-induced thermogenesis (ISO,ISS) positive regulation of cytosolic calcium ion concentration (IBA) positive regulation of glutamate receptor signaling pathway (IGI) positive regulation of hematopoietic stem cell migration (ISO,ISS) positive regulation of immune complex clearance by monocytes and macrophages (ISO,ISS) positive regulation of inflammatory response (ISO,ISS) positive regulation of interleukin-2 production (ISO,ISS) positive regulation of leukocyte tethering or rolling (ISO) positive regulation of monocyte chemotaxis (IEA,ISO,ISS) positive regulation of monocyte extravasation (ISO,ISS) positive regulation of p38MAPK cascade (IDA) positive regulation of synaptic transmission, glutamatergic (ISO,ISS) positive regulation of T cell activation (ISO,ISS) positive regulation of T cell chemotaxis (ISO,ISS) positive regulation of T-helper 1 type immune response (ISO,ISS) positive regulation of thymocyte migration (ISO,ISS) positive regulation of tumor necrosis factor production (IMP,ISO,ISS) positive regulation of type II interferon production (ISO,ISS) regulation of inflammatory response (ISO,ISS) regulation of macrophage migration (ISO) regulation of mononuclear cell migration (ISO) regulation of T cell cytokine production (ISO,ISS) regulation of T cell differentiation (ISO,ISS) regulation of T cell migration (ISO) regulation of vascular endothelial growth factor production (ISO,ISS) response to hyperoxia (IEP) response to hypoxia (IEP) sensory perception of pain (ISO,ISS) signal transduction (IEA) T-helper 17 cell chemotaxis (ISO,ISS)
1.
Polymorphisms of chemokine and chemokine receptor genes in idiopathic immune-mediated posterior segment uveitis.
Ahad MA, etal., Mol Vis. 2007 Mar 23;13:388-96.
2.
Inhibition of corneal neovascularization by genetic ablation of CCR2.
Ambati BK, etal., Cornea. 2003 Jul;22(5):465-7.
3.
Immunohistochemical detection of CCR2 and CX3CR1 in sepsis-induced lung injury.
An JL, etal., Forensic Sci Int. 2009 Nov 20;192(1-3):e21-5. Epub 2009 Sep 4.
4.
Chemokine receptors CCR2 and CX3CR1 regulate skin fibrosis in the mouse model of cytokine-induced systemic sclerosis.
Arai M, etal., J Dermatol Sci. 2013 Mar;69(3):250-8. doi: 10.1016/j.jdermsci.2012.10.010. Epub 2012 Oct 24.
5.
Increased presence of dendritic cells and dendritic cell chemokines in the sinus mucosa of chronic rhinosinusitis with nasal polyps and allergic fungal rhinosinusitis.
Ayers CM, etal., Int Forum Allergy Rhinol. 2011 Jul-Aug;1(4):296-302. doi: 10.1002/alr.20046. Epub 2011 Apr 11.
6.
Constitutive neuronal expression of CCR2 chemokine receptor and its colocalization with neurotransmitters in normal rat brain: functional effect of MCP-1/CCL2 on calcium mobilization in primary cultured neurons.
Banisadr G, etal., J Comp Neurol. 2005 Nov 14;492(2):178-92.
7.
Therapeutic effect of a topical CCR2 antagonist on induced alveolar bone loss in mice.
Barros SP, etal., J Periodontal Res. 2011 Apr;46(2):246-51. doi: 10.1111/j.1600-0765.2010.01340.x. Epub 2011 Jan 18.
8.
MCP-1 and CCR2 gene variants in oral squamous cell carcinoma.
Bektas-Kayhan K, etal., Oral Dis. 2012 Jan;18(1):55-9. doi: 10.1111/j.1601-0825.2011.01843.x. Epub 2011 Aug 24.
9.
Critical role for the chemokine MCP-1/CCR2 in the pathogenesis of bronchiolitis obliterans syndrome.
Belperio JA, etal., J Clin Invest. 2001 Aug;108(4):547-56.
10.
Delayed functional expression of neuronal chemokine receptors following focal nerve demyelination in the rat: a mechanism for the development of chronic sensitization of peripheral nociceptors.
Bhangoo S, etal., Mol Pain. 2007 Dec 12;3:38.
11.
Enhanced pulmonary allergic responses to Aspergillus in CCR2-/- mice.
Blease K, etal., J Immunol. 2000 Sep 1;165(5):2603-11.
12.
Impact of deficiency in CCR2 and CX3CR1 receptors on monocytes trafficking in herpes simplex virus encephalitis.
Boivin N, etal., J Gen Virol. 2012 Jun;93(Pt 6):1294-304. doi: 10.1099/vir.0.041046-0. Epub 2012 Feb 29.
13.
Polymorphisms in chemokine receptor genes and susceptibility to Kawasaki disease.
Breunis WB, etal., Clin Exp Immunol. 2007 Oct;150(1):83-90. Epub 2007 Aug 2.
14.
Possible contribution of chemokine receptor CCR2 and CCR5 polymorphisms in the pathogenesis of chronic spontaneous autoreactive urticaria.
Brzoza Z, etal., Allergol Immunopathol (Madr). 2013 May 30. pii: S0301-0546(13)00103-1. doi: 10.1016/j.aller.2013.02.003.
15.
Monocyte chemoattractant protein-1 mediates cockroach allergen-induced bronchial hyperreactivity in normal but not CCR2-/- mice: the role of mast cells.
Campbell EM, etal., J Immunol. 1999 Aug 15;163(4):2160-7.
16.
CCR2-64I gene polymorphism increase susceptibility to oral cancer.
Chen MK, etal., Oral Oncol. 2011 Jul;47(7):577-82. doi: 10.1016/j.oraloncology.2011.04.008. Epub 2011 May 12.
17.
Spontaneous Development of Autoimmune Uveitis Is CCR2 Dependent.
Chen YF, etal., Am J Pathol. 2014 Jun;184(6):1695-705. doi: 10.1016/j.ajpath.2014.02.024. Epub 2014 Apr 13.
18.
The chemokine CCL2 activates p38 mitogen-activated protein kinase pathway in cultured rat hippocampal cells.
Cho J and Gruol DL, J Neuroimmunol. 2008 Aug 13;199(1-2):94-103. Epub 2008 Jun 27.
19.
Inflammation drives dysbiosis and bacterial invasion in murine models of ileal Crohn's disease.
Craven M, etal., PLoS One. 2012;7(7):e41594. doi: 10.1371/journal.pone.0041594. Epub 2012 Jul 25.
20.
Development of experimental autoimmune uveitis: efficient recruitment of monocytes is independent of CCR2.
Dagkalis A, etal., Invest Ophthalmol Vis Sci. 2009 Sep;50(9):4288-94. doi: 10.1167/iovs.09-3434. Epub 2009 Apr 8.
21.
Spinal CCL2 pronociceptive action is no longer effective in CCR2 receptor antagonist-treated rats.
Dansereau MA, etal., J Neurochem. 2008 Jul;106(2):757-69. Epub 2008 Apr 17.
22.
Beta-chemokine receptor expression in idiopathic inflammatory myopathies.
De Paepe B and De Bleecker JL, Muscle Nerve. 2005 May;31(5):621-7.
23.
Comprehensive analysis of the candidate genes CCL2, CCR2, and TLR4 in age-related macular degeneration.
Despriet DD, etal., Invest Ophthalmol Vis Sci. 2008 Jan;49(1):364-71. doi: 10.1167/iovs.07-0656.
24.
MCP-1, CCR2 and CCR5 polymorphisms in Tunisian patients with atopic asthma.
Dhaouadi T, etal., Iran J Allergy Asthma Immunol. 2013 Mar;12(1):29-36. doi: 012.01/ijaai.2936.
25.
Retinal neuronal MCP-1 induced by AGEs stimulates TNF-alpha expression in rat microglia via p38, ERK, and NF-kappaB pathways.
Dong N, etal., Mol Vis. 2014 May 2;20:616-28. eCollection 2014.
26.
CCR2-dependent intraepithelial lymphocytes mediate inflammatory gut pathology during Toxoplasma gondii infection.
Egan CE, etal., Mucosal Immunol. 2009 Nov;2(6):527-35. doi: 10.1038/mi.2009.105. Epub 2009 Sep 9.
27.
Chemokine/chemokine receptor interactions in extramedullary leukaemia of the skin in childhood AML: differential roles for CCR2, CCR5, CXCR4 and CXCR7.
Faaij CM, etal., Pediatr Blood Cancer. 2010 Aug;55(2):344-8. doi: 10.1002/pbc.22500.
28.
[Expression of chemokine receptor CCR2 in cerebral tissue of newborn rat with experimental hypoxic-ischemic brain damage]
Feng X and Yao YJ, Sichuan Da Xue Xue Bao Yi Xue Ban. 2007 Nov;38(6):942-4, 964.
29.
Lack of association of CCR2-64I and CCR5-Delta 32 with type 1 diabetes and latent autoimmune diabetes in adults.
Gambelunghe G, etal., Hum Immunol. 2003 Jun;64(6):629-32.
30.
CCR2 deficiency results in increased osteolysis in experimental periapical lesions in mice.
Garlet TP, etal., J Endod. 2010 Feb;36(2):244-50. doi: 10.1016/j.joen.2009.09.004. Epub 2009 Oct 23.
31.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
32.
Critical protective role for MCP-1 in pneumonic Burkholderia mallei infection.
Goodyear A, etal., J Immunol. 2010 Feb 1;184(3):1445-54. Epub 2009 Dec 30.
33.
Amelioration of murine dry eye disease by topical antagonist to chemokine receptor 2.
Goyal S, etal., Arch Ophthalmol. 2009 Jul;127(7):882-7. doi: 10.1001/archophthalmol.2009.125.
34.
Chemokine receptor expression in peripheral blood monocytes from patients with neovascular age-related macular degeneration.
Grunin M, etal., Invest Ophthalmol Vis Sci. 2012 Aug 7;53(9):5292-300. doi: 10.1167/iovs.11-9165.
35.
Monocyte chemoattractant protein-1 (MCP-1/CCL2) in experimental autoimmune orchitis.
Guazzone VA, etal., J Reprod Immunol 2003 Dec;60(2):143-57.
36.
Knockout of ccr2 alleviates photoreceptor cell death in a model of retinitis pigmentosa.
Guo C, etal., Exp Eye Res. 2012 Nov;104:39-47. doi: 10.1016/j.exer.2012.08.013. Epub 2012 Sep 26.
37.
Chemokine receptor expression in rat adjuvant-induced arthritis.
Haas CS, etal., Arthritis Rheum. 2005 Dec;52(12):3718-30.
38.
A role for MCP-1/CCR2 in interstitial lung disease in children.
Hartl D, etal., Respir Res. 2005 Aug 11;6:93.
39.
Therapy for pneumonitis and sialadenitis by accumulation of CCR2-expressing CD4+CD25+ regulatory T cells in MRL/lpr mice.
Hasegawa H, etal., Arthritis Res Ther. 2007;9(1):R15.
40.
A critical role for CCR2/MCP-1 interactions in the development of idiopathic pneumonia syndrome after allogeneic bone marrow transplantation.
Hildebrandt GC, etal., Blood. 2004 Mar 15;103(6):2417-26. Epub 2003 Nov 13.
41.
Changes in protein expression and distribution of spinal CCR2 in a rat model of bone cancer pain.
Hu JH, etal., Brain Res. 2013 May 6;1509:1-7. doi: 10.1016/j.brainres.2013.03.002. Epub 2013 Mar 17.
42.
Deficiency of lymph node resident dendritic cells and dysregulation of DC chemoattractants in a malnourished mouse model of Leishmania donovani infection.
Ibrahim MK, etal., Infect Immun. 2014 May 12.
43.
Dual targeting of CCR2 and CX3CR1 in an arterial injury model of vascular inflammation.
Jerath MR, etal., Thromb J. 2010 Sep 13;8:14. doi: 10.1186/1477-9560-8-14.
44.
Impaired expression of inflammatory cytokines and chemokines at early stages of infection with Leishmania amazonensis.
Ji J, etal., Infect Immun. 2003 Aug;71(8):4278-88.
45.
Expression of chemokine receptors CXCR4, CCR2, CCR5 and CX3CR1 in neural progenitor cells isolated from the subventricular zone of the adult rat brain.
Ji JF, etal., Neurosci Lett. 2004 Jan 30;355(3):236-40.
46.
Chemokine receptor expression in cultured glia and rat experimental allergic encephalomyelitis.
Jiang Y, etal., J Neuroimmunol 1998 Jun 1;86(1):1-12.
47.
Inhibition of MCP-1/CCR2 pathway ameliorates the development of diabetic nephropathy.
Kanamori H, etal., Biochem Biophys Res Commun. 2007 Sep 7;360(4):772-7. Epub 2007 Jul 6.
48.
Chemokine and chemokine receptor expression during experimental autoimmune uveoretinitis in mice.
Keino H, etal., Graefes Arch Clin Exp Ophthalmol. 2003 Feb;241(2):111-5. Epub 2003 Jan 28.
49.
Association between a genetic variation of CC chemokine receptor-2 and atopic asthma.
Kim YK, etal., Allergy. 2007 Feb;62(2):208-9.
50.
Force-dependent development of neuropathic central pain and time-related CCL2/CCR2 expression after graded spinal cord contusion injuries of the rat.
Knerlich-Lukoschus F, etal., J Neurotrauma. 2008 May;25(5):427-48.
51.
Chronic hypoxia upregulates the expression and function of proinflammatory cytokines in the rat carotid body.
Lam SY, etal., Histochem Cell Biol. 2008 Sep;130(3):549-59. Epub 2008 May 1.
52.
Blocking the monocyte chemoattractant protein-1/CCR2 chemokine pathway induces permanent survival of islet allografts through a programmed death-1 ligand-1-dependent mechanism.
Lee I, etal., J Immunol. 2003 Dec 15;171(12):6929-35.
53.
The expression of MCP-1 and CCR2 in induced rats periapical lesions.
Liu L, etal., Arch Oral Biol. 2014 May;59(5):492-9. doi: 10.1016/j.archoralbio.2014.02.008. Epub 2014 Feb 22.
54.
Opposite roles of CCR2 and CX3CR1 macrophages in alkali-induced corneal neovascularization.
Lu P, etal., Cornea. 2009 Jun;28(5):562-9. doi: 10.1097/ICO.0b013e3181930bcd.
55.
Important role of CCR2 in a murine model of coronary vasculitis.
Martinez HG, etal., BMC Immunol. 2012 Oct 17;13:56. doi: 10.1186/1471-2172-13-56.
56.
Exacerbation of established pulmonary fibrosis in a murine model by gammaherpesvirus.
McMillan TR, etal., Am J Respir Crit Care Med. 2008 Apr 1;177(7):771-80. Epub 2008 Jan 10.
57.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
58.
CCR2 chemokine receptor signaling mediates pain in experimental osteoarthritis.
Miller RE, etal., Proc Natl Acad Sci U S A. 2012 Dec 11;109(50):20602-7. doi: 10.1073/pnas.1209294110. Epub 2012 Nov 26.
59.
Increased expression levels of monocyte CCR2 and monocyte chemoattractant protein-1 in patients with diabetes mellitus.
Mine S, etal., Biochem Biophys Res Commun. 2006 Jun 9;344(3):780-5. Epub 2006 Apr 17.
60.
CCR2-mediated recruitment of fibrocytes to the alveolar space after fibrotic injury.
Moore BB, etal., Am J Pathol. 2005 Mar;166(3):675-84.
61.
22-S-Hydroxycholesterol protects against ethanol-induced liver injury by blocking the auto/paracrine activation of MCP-1 mediated by LXRα.
Na TY, etal., J Pathol. 2015 Apr;235(5):710-20. doi: 10.1002/path.4494. Epub 2015 Jan 5.
62.
Chemokine receptor genotype is associated with diabetic nephropathy in Japanese with type 2 diabetes.
Nakajima K, etal., Diabetes. 2002 Jan;51(1):238-42.
63.
Genotypes and haplotypes of CCR2 and CCR3 genes in Japanese cedar pollinosis.
Nakamura H, etal., Int Arch Allergy Immunol. 2007;142(4):329-34. Epub 2006 Nov 28.
64.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
65.
MCP-1/CCR2 signalling pathway regulates hyperoxia-induced acute lung injury via nitric oxide production.
Okuma T, etal., Int J Exp Pathol. 2006 Dec;87(6):475-83.
66.
Chemokine receptor (CCR2) genotype is associated with myocardial infarction and heart failure in patients under 65 years of age.
Ortlepp JR, etal., J Mol Med. 2003 Jun;81(6):363-7. Epub 2003 Apr 29.
67.
Chemokine receptor 2 serves an early and essential role in resistance to Mycobacterium tuberculosis.
Peters W, etal., Proc Natl Acad Sci U S A 2001 Jul 3;98(14):7958-63.
68.
CC chemokine receptor (CCR)2 polymorphism in Czech patients with myocardial infarction.
Petrkova J, etal., Immunol Lett. 2003 Jul 3;88(1):53-5.
69.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
70.
Differential upregulation of chemokine receptors on CD56 NK cells and their transmigration to the site of infection in tuberculous pleurisy.
Pokkali S, etal., FEMS Immunol Med Microbiol. 2009 Apr;55(3):352-60. Epub 2009 Jan 12.
71.
Eosinophils and type 2 cytokine signaling in macrophages orchestrate development of functional beige fat.
Qiu Y, etal., Cell. 2014 Jun 5;157(6):1292-308. doi: 10.1016/j.cell.2014.03.066.
72.
GOA pipeline
RGD automated data pipeline
73.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
74.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
75.
The CCR2 promoter polymorphism T-960A, but not the serum MCP-1 level, is associated with endothelial function in prediabetic individuals.
Rittig K, etal., Atherosclerosis. 2008 Jun;198(2):338-46. Epub 2007 Dec 21.
76.
CC chemokine receptor (CCR)2 is required for langerhans cell migration and localization of T helper cell type 1 (Th1)-inducing dendritic cells. Absence of CCR2 shifts the Leishmania major-resistant phenotype to a susceptible state dominated by Th2 cytokines, b cell outgrowth, and sustained neutrophilic inflammation.
Sato N, etal., J Exp Med. 2000 Jul 17;192(2):205-18.
77.
CC chemokine receptor 2 is protective against noise-induced hair cell death: studies in CX3CR1(+/GFP) mice.
Sautter NB, etal., J Assoc Res Otolaryngol. 2006 Dec;7(4):361-72. Epub 2006 Oct 31.
78.
The suppression of bone marrow-derived microglia in the amygdala improves the anxiety-like behavior induced by chronic partial sciatic nerve ligation in mice.
Sawada A, etal., Pain. 2014 Jun 4. pii: S0304-3959(14)00264-4. doi: 10.1016/j.pain.2014.05.031.
79.
Post-reperfusion changes of monocyte function in coronary blood after extracorporeal circulation.
Sbrana S, etal., Cytometry B Clin Cytom. 2005 May;65(1):14-21.
80.
Blunt chest trauma induces mediator-dependent monocyte migration to the lung.
Seitz DH, etal., Crit Care Med. 2010 Sep;38(9):1852-9.
81.
CCR2(+) monocytes infiltrate atrophic lesions in age-related macular disease and mediate photoreceptor degeneration in experimental subretinal inflammation in Cx3cr1 deficient mice.
Sennlaub F, etal., EMBO Mol Med. 2013 Nov;5(11):1775-93. doi: 10.1002/emmm.201302692. Epub 2013 Oct 21.
82.
Chemokine receptor expression and in vivo signaling pathways in the joints of rats with adjuvant-induced arthritis.
Shahrara S, etal., Arthritis Rheum. 2003 Dec;48(12):3568-83.
83.
Fms-like tyrosine kinase 3 ligand regulates migratory pattern and antigen uptake of lung dendritic cell subsets in a murine model of allergic airway inflammation.
Shao Z, etal., J Immunol. 2009 Dec 1;183(11):7531-8. doi: 10.4049/jimmunol.0901341. Epub 2009 Nov 16.
84.
Differential expression of chemokines and chemokine receptors in inflammatory periapical diseases.
Silva TA, etal., Oral Microbiol Immunol. 2005 Oct;20(5):310-6.
85.
Retinal ganglion cell death is induced by microglia derived pro-inflammatory cytokines in the hypoxic neonatal retina.
Sivakumar V, etal., J Pathol. 2011 Jan 17. doi: 10.1002/path.2858.
86.
Interferon-gamma potentiates NMDA receptor signaling in spinal dorsal horn neurons via microglia-neuron interaction.
Sonekatsu M, etal., Mol Pain. 2016 Apr 18;12. pii: 12/0/1744806916644927. doi: 10.1177/1744806916644927. Print 2016.
87.
Genetic variation at the CCR5/CCR2 gene cluster and risk of psoriasis and psoriatic arthritis.
Soto-Sanchez J, etal., Cytokine. 2010 May;50(2):114-6. doi: 10.1016/j.cyto.2010.01.006. Epub 2010 Feb 12.
88.
A common haplotype of the C-C chemokine receptor 2 gene and HLA-DRB1*0301 are independent genetic risk factors for Lofgren's syndrome.
Spagnolo P, etal., J Intern Med. 2008 Nov;264(5):433-41. Epub 2008 May 29.
89.
Rat aortic MCP-1 and its receptor CCR2 increase with age and alter vascular smooth muscle cell function.
Spinetti G, etal., Arterioscler Thromb Vasc Biol. 2004 Aug;24(8):1397-402. Epub 2004 Jun 3.
90.
Chemokine receptor CCR2 and CCR5 polymorphisms in children with insulin-dependent diabetes mellitus.
Szalai C, etal., Pediatr Res. 1999 Jul;46(1):82-4.
91.
Val64Ile polymorphism in the C-C chemokine receptor 2 is associated with reduced coronary artery calcification.
Valdes AM, etal., Arterioscler Thromb Vasc Biol. 2002 Nov 1;22(11):1924-8.
92.
The chemokine CCL2 modulates Ca2+ dynamics and electrophysiological properties of cultured cerebellar Purkinje neurons.
van Gassen KL, etal., Eur J Neurosci. 2005 Jun;21(11):2949-57.
93.
Proinflammatory gene expression at chronic periodontitis and peri-implantitis sites in patients with or without type 2 diabetes.
Venza I, etal., J Periodontol. 2010 Jan;81(1):99-108. doi: 10.1902/jop.2009.090358.
94.
Expression of CCR2 on monocytes and macrophages in chronically inflamed skin in atopic dermatitis and psoriasis.
Vestergaard C, etal., Acta Derm Venereol. 2004;84(5):353-8.
95.
Excitatory monocyte chemoattractant protein-1 signaling is up-regulated in sensory neurons after chronic compression of the dorsal root ganglion.
White FA, etal., Proc Natl Acad Sci U S A. 2005 Sep 27;102(39):14092-7. Epub 2005 Sep 20.
96.
Suppression and regression of choroidal neovascularization in mice by a novel CCR2 antagonist, INCB3344.
Xie P, etal., PLoS One. 2011;6(12):e28933. doi: 10.1371/journal.pone.0028933. Epub 2011 Dec 19.
97.
Role of monocyte chemoattractant protein-1 and its receptor,CCR-2, in the pathogenesis of bleomycin-induced scleroderma.
Yamamoto T and Nishioka K, J Invest Dermatol. 2003 Sep;121(3):510-6.
98.
Roles of CC chemokine receptors (CCRs) on lipopolysaccharide-induced acute lung injury.
Yang D, etal., Respir Physiol Neurobiol. 2010 Mar 31;170(3):253-9. Epub 2010 Feb 10.
99.
Inhibition of the chemokine (C-C motif) ligand 2/chemokine (C-C motif) receptor 2 pathway attenuates hyperglycaemia and inflammation in a mouse model of hepatic steatosis and lipoatrophy.
Yang SJ, etal., Diabetologia. 2009 May;52(5):972-81. doi: 10.1007/s00125-009-1309-8. Epub 2009 Mar 10.
100.
[Interaction of polymorphisms of monocyte chemoattractant protein-1 receptor CCR2 gene 190A/G, nicotinamide adenine dinucleotide phosphate oxidase subunit p22phox gene C242T and cigarette smoking increases the risk of nonalcoholic fatty liver disease].
Zhang C and Guo L, Wei Sheng Yan Jiu. 2015 Sep;44(5):730-7.
101.
CCL2-CCR2 signaling promotes hepatic ischemia/reperfusion injury.
Zhang J, etal., J Surg Res. 2016 May 15;202(2):352-62. doi: 10.1016/j.jss.2016.02.029. Epub 2016 Mar 3.
102.
Genetic variations in CC chemokine receptors and hypertension.
Zhang M, etal., Am J Hypertens. 2006 Jan;19(1):67-72.
103.
MCP-1 chemokine receptor CCR2 is decreased on circulating monocytes in sporadic amyotrophic lateral sclerosis (sALS).
Zhang R, etal., J Neuroimmunol. 2006 Oct;179(1-2):87-93. Epub 2006 Jul 20.
104.
Complementary DNA microarray analysis of chemokines and their receptors in allergic rhinitis.
Zhang RX, etal., J Investig Allergol Clin Immunol. 2007;17(5):329-36.
105.
Chemokine CCL2 and its receptor CCR2 in the medullary dorsal horn are involved in trigeminal neuropathic pain.
Zhang ZJ, etal., J Neuroinflammation. 2012 Jul 9;9:136. doi: 10.1186/1742-2094-9-136.
106.
Contribution of chemokine CCL2/CCR2 signaling in the dorsal root ganglion and spinal cord to the maintenance of neuropathic pain in a rat model of lumbar disc herniation.
Zhu X, etal., J Pain. 2014 May;15(5):516-26. doi: 10.1016/j.jpain.2014.01.492. Epub 2014 Jan 23.
107.
Combined association of CCR2-V64I and MCP-1-2518A/G polymorphisms with generalised aggressive periodontitis in Chinese.
Zhu XL, etal., Chin J Dent Res. 2010;13(2):109-14.
Ccr2 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 132,611,883 - 132,619,106 (+) NCBI GRCr8 mRatBN7.2 8 123,734,465 - 123,742,483 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 123,734,430 - 123,742,100 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 129,328,887 - 129,330,008 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 127,528,007 - 127,529,128 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 125,345,931 - 125,347,052 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 RGSC_v3.4 8 128,892,784 - 128,893,905 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 128,912,520 - 128,913,642 (+) NCBI Celera 8 122,833,545 - 122,834,666 (+) NCBI Celera Cytogenetic Map 8 q32 NCBI
CCR2 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 46,354,111 - 46,360,940 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 46,353,864 - 46,360,940 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 46,395,602 - 46,402,431 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 46,370,364 - 46,377,432 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 3 46,332,557 - 46,339,734 (+) NCBI Celera Cytogenetic Map 3 p21.31 NCBI HuRef 3 46,438,874 - 46,446,051 (+) NCBI HuRef CHM1_1 3 46,345,233 - 46,352,410 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 46,369,948 - 46,376,777 (+) NCBI T2T-CHM13v2.0
Ccr2 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 123,901,954 - 123,913,594 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 123,901,987 - 123,913,594 (+) Ensembl GRCm39 Ensembl GRCm38 9 124,101,918 - 124,109,140 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 124,101,950 - 124,113,557 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 124,016,922 - 124,023,879 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 123,950,982 - 123,957,349 (+) NCBI MGSCv36 mm8 Celera 9 124,890,502 - 124,897,441 (-) NCBI Celera Cytogenetic Map 9 F4 NCBI cM Map 9 75.05 NCBI
Ccr2 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955420 25,641,184 - 25,664,413 (-) NCBI ChiLan1.0 ChiLan1.0
CCR2 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 46,315,650 - 46,320,292 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 46,320,418 - 46,325,060 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 46,255,725 - 46,263,285 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 47,361,118 - 47,368,312 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 47,361,124 - 47,368,312 (+) Ensembl panpan1.1 panPan2
CCR2 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 42,305,344 - 42,313,258 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 42,307,580 - 42,308,698 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 42,220,658 - 42,229,191 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 42,787,203 - 42,795,751 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 42,787,205 - 42,793,246 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 42,028,417 - 42,036,962 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 42,429,835 - 42,438,385 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 42,710,738 - 42,719,282 (-) NCBI UU_Cfam_GSD_1.0
CCR2 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 29,369,122 - 29,376,343 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 29,368,735 - 29,374,564 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 32,532,565 - 32,538,394 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CCR2 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 7,795,192 - 7,801,242 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 7,798,646 - 7,799,728 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 159,351,063 - 159,358,108 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
738011 Anxrr9 Anxiety related response QTL 9 6.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 8 93535351 123900184 Rat 1358903 Bp252 Blood pressure QTL 252 7 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 738014 Anxrr15 Anxiety related response QTL 15 3.6 0.005 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 95718998 123900184 Rat 2300182 Bmd56 Bone mineral density QTL 56 5.4 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 95718998 123900184 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 1358893 Bp263 Blood pressure QTL 263 5.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat
PMC164693P1
Rat Assembly Chr Position (strand) Source JBrowse RGSC_v3.4 8 128,893,811 - 128,893,893 UniSTS RGSC3.4 Celera 8 122,834,572 - 122,834,654 UniSTS Cytogenetic Map 8 q32 UniSTS
This gene Ccr2 is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSRNOT00000100998 ⟹ ENSRNOP00000095594
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 123,734,430 - 123,742,100 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000114724 ⟹ ENSRNOP00000081733
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 123,735,941 - 123,742,100 (+) Ensembl
RefSeq Acc Id:
NM_021866 ⟹ NP_068638
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 132,612,203 - 132,619,106 (+) NCBI mRatBN7.2 8 123,734,783 - 123,741,686 (+) NCBI RGSC_v3.4 8 128,892,784 - 128,893,905 (+) RGD Celera 8 122,833,545 - 122,834,666 (+) RGD
Sequence:
ATGGAAGACAGTAATATGTTACCTCAGTTCATCCATGGCATACTATCAACATCTCATTCTCTATTTCCAAGAAGTATCCAAGAGCTTGATGAGGGGGCCACCACACCGTATGACTATGATGATGGTGA ACCTTGTCATAAAACCAGTGTGAAGCAAATTGGAGCTTGGATCCTGCCCCCACTCTACTCCCTGGTATTCATCTTTGGTTTTGTGGGCAACATGTTGGTCATTATAATTCTGATAAGCTGTAAAAAGC TGAAGAGCATGACTGATATCTACCTGTTCAACCTGGCCATCTCTGACCTGCTCTTCCTGCTCACACTCCCATTCTGGGCTCACTATGCTGCAAATGAGTGGGTCTTTGGGAATATAATGTGCAAATTA TTCACAGGGCTTTATCACATTGGGTATTTTGGTGGAATCTTCTTCATTATCCTCCTGACAATTGATAGATATTTGGCTATTGTCCATGCTGTCTTTGCTTTAAAAGCCAGGACAGTTACCTTTGGGGT AATAACAAGTGTAGTCACTTGGGTGGTGGCTGTGTTTGCCTCTCTACCAGGAATCATATTTACTAAATCTGAACAAGAAGATGATCAGCATACTTGTGGCCCTTATTTTCCAACAATCTGGAAGAATT TCCAAACAATAATGAGGAATATCTTGAGTTTGATCCTGCCCCTACTTGTCATGGTCATCTGCTACTCAGGAATCCTCCACACCCTGTTTCGCTGTAGGAATGAGAAAAAGAGGCATAGGGCTGTGAGG CTCATCTTTGCCATCATGATTGTCTACTTTCTCTTCTGGACTCCATACAATATTGTTCTCTTCCTGACCACCTTCCAGGAATTCTTGGGAATGAGTAACTGTGTGGTTGACATGCACTTAGACCAGGC CATGCAGGTGACAGAGACTCTTGGAATGACACACTGCTGCGTTAATCCTATCATTTATGCCTTTGTTGGTGAGAAGTTCCGAAGGTATCTCTCCATATTTTTCAGAAAGCACATTGCCAAAAATCTCT GCAAACAATGCCCAGTTTTCTATAGGGAGACAGCAGACCGAGTGAGCTCAACATTTACCCCTTCTACTGGGGAGCAAGAAGTCTCAGTTGGGTTGTAA
hide sequence
RefSeq Acc Id:
XM_039082061 ⟹ XP_038937989
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 132,612,836 - 132,619,103 (+) NCBI mRatBN7.2 8 123,735,404 - 123,741,686 (+) NCBI
RefSeq Acc Id:
XM_039082063 ⟹ XP_038937991
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 132,611,883 - 132,619,103 (+) NCBI mRatBN7.2 8 123,734,465 - 123,741,686 (+) NCBI
RefSeq Acc Id:
NP_068638 ⟸ NM_021866
- UniProtKB:
O55193 (UniProtKB/Swiss-Prot), A6I4D2 (UniProtKB/TrEMBL)
- Sequence:
MEDSNMLPQFIHGILSTSHSLFPRSIQELDEGATTPYDYDDGEPCHKTSVKQIGAWILPPLYSLVFIFGFVGNMLVIIILISCKKLKSMTDIYLFNLAISDLLFLLTLPFWAHYAANEWVFGNIMCKL FTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVITSVVTWVVAVFASLPGIIFTKSEQEDDQHTCGPYFPTIWKNFQTIMRNILSLILPLLVMVICYSGILHTLFRCRNEKKRHRAVR LIFAIMIVYFLFWTPYNIVLFLTTFQEFLGMSNCVVDMHLDQAMQVTETLGMTHCCVNPIIYAFVGEKFRRYLSIFFRKHIAKNLCKQCPVFYRETADRVSSTFTPSTGEQEVSVGL
hide sequence
RefSeq Acc Id:
XP_038937991 ⟸ XM_039082063
- Peptide Label:
isoform X1
- UniProtKB:
O55193 (UniProtKB/Swiss-Prot), A6I4D2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038937989 ⟸ XM_039082061
- Peptide Label:
isoform X1
- UniProtKB:
O55193 (UniProtKB/Swiss-Prot), A6I4D2 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000095594 ⟸ ENSRNOT00000100998
Ensembl Acc Id:
ENSRNOP00000081733 ⟸ ENSRNOT00000114724
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-22
Ccr2
C-C motif chemokine receptor 2
Ccr2
chemokine (C-C motif) receptor 2
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2005-01-20
Ccr2
chemokine (C-C motif) receptor 2
chemokine receptor CCR2 gene
Name updated
1299863
APPROVED
2002-08-07
Ccr2
chemokine receptor CCR2 gene
Symbol and Name status set to provisional
70820
PROVISIONAL
Note Type
Note
Reference
gene_expression
expressed in spleen, lung, kidney, thymus, and macrophages
632391
gene_regulation
increased after induction of experimental allergic encephalomyelitis (EAE)
632391