Symbol:
Guca2b
Name:
guanylate cyclase activator 2B
RGD ID:
620044
Description:
Predicted to enable guanylate cyclase activator activity. Involved in cGMP-mediated signaling. Predicted to be located in extracellular region. Orthologous to human GUCA2B (guanylate cyclase activator 2B); PARTICIPATES IN calcium/calcium-mediated signaling pathway; INTERACTS WITH 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine; 6-propyl-2-thiouracil; ammonium chloride.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
guanylate cyclase activator 2b (retina); guanylate cyclase activator 2B (uroguanylin); uroguanylin
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GUCA2B (guanylate cyclase activator 2B) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Guca2b (guanylate cyclase activator 2b) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Guca2b (guanylate cyclase activator 2B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GUCA2B (guanylate cyclase activator 2B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GUCA2B (guanylate cyclase activator 2B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Guca2b (guanylate cyclase activator 2B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GUCA2B (guanylate cyclase activator 2B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GUCA2B (guanylate cyclase activator 2B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Guca2b (guanylate cyclase activator 2B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Guca2b (guanylate cyclase activator 2b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
GUCA2B (guanylate cyclase activator 2B)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 138,532,160 - 138,534,210 (-) NCBI GRCr8 mRatBN7.2 5 133,246,891 - 133,248,941 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 133,246,909 - 133,248,966 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 135,975,549 - 135,977,599 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 137,731,991 - 137,734,041 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 137,752,591 - 137,754,641 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 138,695,591 - 138,697,641 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 138,695,591 - 138,697,641 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 142,497,885 - 142,499,935 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 140,237,184 - 140,239,234 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 140,242,411 - 140,244,482 (-) NCBI Celera 5 131,770,229 - 131,772,279 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Guca2b Rat 1,1-dichloroethene decreases expression ISO Guca2b (Mus musculus) 6480464 vinylidene chloride results in decreased expression of GUCA2B mRNA CTD PMID:26682919 Guca2b Rat 1,2-dimethylhydrazine multiple interactions ISO Guca2b (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of GUCA2B mRNA CTD PMID:22206623 Guca2b Rat 17alpha-ethynylestradiol affects expression ISO Guca2b (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of GUCA2B mRNA CTD PMID:17555576 Guca2b Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Guca2b (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Guca2b Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine increases expression EXP 6480464 Puromycin Aminonucleoside results in increased expression of GUCA2B protein CTD PMID:15590761 Guca2b Rat 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine affects expression EXP 6480464 Puromycin Aminonucleoside affects the expression of GUCA2B mRNA CTD PMID:15590761 Guca2b Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO GUCA2B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of GUCA2B mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of GUCA2B mRNA CTD PMID:28628672 Guca2b Rat 4,4'-sulfonyldiphenol multiple interactions ISO GUCA2B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of GUCA2B mRNA CTD PMID:28628672 Guca2b Rat 4,4'-sulfonyldiphenol increases expression ISO Guca2b (Mus musculus) 6480464 bisphenol S results in increased expression of GUCA2B mRNA CTD PMID:39298647 Guca2b Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of GUCA2B mRNA CTD PMID:24780913 Guca2b Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of GUCA2B mRNA CTD PMID:16483693 Guca2b Rat benzo[a]pyrene increases methylation ISO GUCA2B (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of GUCA2B exon CTD PMID:27901495 Guca2b Rat benzo[a]pyrene affects methylation ISO GUCA2B (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GUCA2B 3' UTR and Benzo(a)pyrene affects the methylation of GUCA2B promoter CTD PMID:27901495 Guca2b Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of GUCA2B mRNA CTD PMID:25181051 Guca2b Rat bisphenol A increases expression ISO Guca2b (Mus musculus) 6480464 bisphenol A results in increased expression of GUCA2B mRNA CTD PMID:32156529 Guca2b Rat bisphenol A multiple interactions ISO GUCA2B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of GUCA2B mRNA CTD PMID:28628672 Guca2b Rat calcidiol increases expression EXP 6480464 Calcifediol deficiency results in increased expression of GUCA2B mRNA CTD PMID:17293106 Guca2b Rat CGP 52608 multiple interactions ISO GUCA2B (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to GUCA2B gene] CTD PMID:28238834 Guca2b Rat choline multiple interactions ISO Guca2b (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of GUCA2B mRNA CTD PMID:20938992 Guca2b Rat chromium(6+) affects expression ISO Guca2b (Mus musculus) 6480464 chromium hexavalent ion affects the expression of GUCA2B mRNA CTD PMID:28472532 Guca2b Rat cyclosporin A decreases expression ISO GUCA2B (Homo sapiens) 6480464 Cyclosporine results in decreased expression of GUCA2B mRNA CTD PMID:27989131 Guca2b Rat dexamethasone multiple interactions ISO GUCA2B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of GUCA2B mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of GUCA2B mRNA CTD PMID:28628672 Guca2b Rat dextran sulfate increases expression ISO Guca2b (Mus musculus) 6480464 Dextran Sulfate results in increased expression of GUCA2B protein CTD PMID:35999755 Guca2b Rat diquat increases expression ISO Guca2b (Mus musculus) 6480464 Diquat results in increased expression of GUCA2B mRNA CTD PMID:36851058 Guca2b Rat folic acid multiple interactions ISO Guca2b (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Guca2b Rat glyphosate affects methylation EXP 6480464 Glyphosate affects the methylation of GUCA2B gene CTD PMID:35440735 Guca2b Rat indometacin multiple interactions ISO GUCA2B (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of GUCA2B mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of GUCA2B mRNA CTD PMID:28628672 Guca2b Rat L-methionine multiple interactions ISO Guca2b (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of GUCA2B mRNA CTD PMID:20938992 Guca2b Rat methylmercury(1+) increases expression EXP 6480464 methylmercury II results in increased expression of GUCA2B mRNA CTD PMID:17905399 Guca2b Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of GUCA2B mRNA CTD PMID:19162173 Guca2b Rat progesterone affects expression ISO Guca2b (Mus musculus) 6480464 Progesterone affects the expression of GUCA2B mRNA CTD PMID:17251523 Guca2b Rat sodium fluoride decreases expression ISO Guca2b (Mus musculus) 6480464 Sodium Fluoride results in decreased expression of GUCA2B mRNA CTD PMID:27862939 Guca2b Rat tamoxifen affects expression ISO Guca2b (Mus musculus) 6480464 Tamoxifen affects the expression of GUCA2B mRNA CTD PMID:17555576 Guca2b Rat zinc atom increases expression EXP 6480464 Zinc deficiency results in increased expression of GUCA2B mRNA and Zinc deficiency results in increased expression of GUCA2B protein CTD PMID:11260404 more ... Guca2b Rat zinc atom multiple interactions EXP 6480464 [Zinc deficiency co-treated with IL1A protein] results in increased expression of GUCA2B mRNA and IL1A protein promotes the reaction [Zinc deficiency results in increased expression of GUCA2B protein] CTD PMID:12514266 Guca2b Rat zinc(0) multiple interactions EXP 6480464 [Zinc deficiency co-treated with IL1A protein] results in increased expression of GUCA2B mRNA and IL1A protein promotes the reaction [Zinc deficiency results in increased expression of GUCA2B protein] CTD PMID:12514266 Guca2b Rat zinc(0) increases expression EXP 6480464 Zinc deficiency results in increased expression of GUCA2B mRNA and Zinc deficiency results in increased expression of GUCA2B protein CTD PMID:11260404 more ...
1.
Upregulation of rat intestinal uroguanylin mRNA by dietary zinc restriction.
Blanchard RK and Cousins RJ, Am J Physiol 1997 May;272(5 Pt 1):G972-8.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Purification, cDNA sequence, and tissue distribution of rat uroguanylin.
Li Z, etal., Regul Pept 1997 Jan 15;68(1):45-56.
5.
The diversity of calcium sensor proteins in the regulation of neuronal function.
McCue HV, etal., Cold Spring Harb Perspect Biol. 2010 Aug;2(8):a004085. doi: 10.1101/cshperspect.a004085. Epub 2010 Jul 28.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Uroguanylin gene expression in the alimentary tract and extra-gastrointestinal tissues.
Miyazato M, etal., FEBS Lett 1996 Dec 2;398(2-3):170-4.
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
Online Mendelian Inheritance in Man, OMIM (TM).
Online Mendelian Inheritance in Man, OMIM (TM).
10.
GOA pipeline
RGD automated data pipeline
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Guca2b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 138,532,160 - 138,534,210 (-) NCBI GRCr8 mRatBN7.2 5 133,246,891 - 133,248,941 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 133,246,909 - 133,248,966 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 135,975,549 - 135,977,599 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 137,731,991 - 137,734,041 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 137,752,591 - 137,754,641 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 138,695,591 - 138,697,641 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 138,695,591 - 138,697,641 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 142,497,885 - 142,499,935 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 140,237,184 - 140,239,234 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 140,242,411 - 140,244,482 (-) NCBI Celera 5 131,770,229 - 131,772,279 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
GUCA2B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 42,153,410 - 42,155,820 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 42,153,410 - 42,155,820 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 42,619,081 - 42,621,491 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 42,391,679 - 42,394,082 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 42,288,184 - 42,290,588 NCBI Celera 1 40,901,379 - 40,903,782 (+) NCBI Celera Cytogenetic Map 1 p34.2 NCBI HuRef 1 40,738,645 - 40,741,048 (+) NCBI HuRef CHM1_1 1 42,736,196 - 42,738,599 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 42,024,047 - 42,026,457 (+) NCBI T2T-CHM13v2.0
Guca2b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 119,513,798 - 119,516,142 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 119,513,804 - 119,516,151 (-) Ensembl GRCm39 Ensembl GRCm38 4 119,656,601 - 119,658,945 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 119,656,607 - 119,658,954 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 119,329,206 - 119,331,550 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 119,154,547 - 119,156,877 (-) NCBI MGSCv36 mm8 Celera 4 118,380,210 - 118,382,528 (-) NCBI Celera Cytogenetic Map 4 D2.1 NCBI cM Map 4 55.48 NCBI
Guca2b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955537 1,798,249 - 1,801,673 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955537 1,798,249 - 1,801,673 (+) NCBI ChiLan1.0 ChiLan1.0
GUCA2B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 184,656,603 - 184,659,049 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 183,798,643 - 183,801,089 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 41,452,722 - 41,455,192 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 42,832,809 - 42,835,202 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 42,832,196 - 42,835,425 (+) Ensembl panpan1.1 panPan2
GUCA2B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 1,094,283 - 1,096,605 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 1,094,276 - 1,096,688 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 1,351,322 - 1,353,606 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 1,181,767 - 1,184,052 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 1,181,761 - 1,184,098 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 1,086,868 - 1,089,152 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 1,148,603 - 1,150,888 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 1,163,515 - 1,165,799 (-) NCBI UU_Cfam_GSD_1.0
Guca2b Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 57,807,471 - 57,809,709 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 23,632,781 - 23,634,496 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 23,632,836 - 23,634,330 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GUCA2B
GUCA2B Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 90,767,183 - 90,770,403 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 90,767,609 - 90,770,198 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 26,135,158 - 26,137,524 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Guca2b
.
Predicted Target Of
Count of predictions: 82 Count of miRNA genes: 72 Interacting mature miRNAs: 75 Transcripts: ENSRNOT00000012062 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 1300122 Wbc1 White blood cell count QTL 1 2.75 leukocyte quantity (VT:0000217) total white blood cell count (CMO:0000365) 5 125392826 139989768 Rat 7365049 Bp359 Blood pressure QTL 359 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128071929 134724733 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 1331803 Rf32 Renal function QTL 32 2.798 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 129132428 143070159 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 7394710 Emca12 Estrogen-induced mammary cancer QTL 12 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 124160767 133749643 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
Ugn
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 138,532,206 - 138,533,050 (+) Marker Load Pipeline mRatBN7.2 5 133,246,937 - 133,247,781 (+) MAPPER mRatBN7.2 Rnor_6.0 5 138,695,638 - 138,696,481 NCBI Rnor6.0 Rnor_5.0 5 142,497,932 - 142,498,775 UniSTS Rnor5.0 RGSC_v3.4 5 140,237,231 - 140,238,074 UniSTS RGSC3.4 Celera 5 131,770,276 - 131,771,119 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
2
12
45
56
63
39
20
39
3
130
36
40
45
49
24
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012062 ⟹ ENSRNOP00000012062
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 133,246,909 - 133,248,966 (-) Ensembl Rnor_6.0 Ensembl 5 138,695,591 - 138,697,641 (-) Ensembl
RefSeq Acc Id:
NM_022284 ⟹ NP_071620
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 138,532,160 - 138,534,210 (-) NCBI mRatBN7.2 5 133,246,891 - 133,248,941 (-) NCBI Rnor_6.0 5 138,695,591 - 138,697,641 (-) NCBI Rnor_5.0 5 142,497,885 - 142,499,935 (-) NCBI RGSC_v3.4 5 140,237,184 - 140,239,234 (-) RGD Celera 5 131,770,229 - 131,772,279 (-) RGD
Sequence:
GCAGAAACCCAGAGGTGTGAGCTGGGAAGCCGGGCCATGTCAGGAAGCCAACTGTGGGCTGCTGTACTCCTGCTGCTGGTGCTGCAGAGTGCCCAGGGTGTCTACATCAAGTACCATGGCTTCCAAGT
hide sequence
RefSeq Acc Id:
NP_071620 ⟸ NM_022284
- Peptide Label:
precursor
- UniProtKB:
P70668 (UniProtKB/Swiss-Prot), A6JZP7 (UniProtKB/TrEMBL)
- Sequence:
MSGSQLWAAVLLLLVLQSAQGVYIKYHGFQVQLESVKKLNELEEKQMSDPQQQKSGLLPDVCYNPALPLDLQPVCASQEAASTFKALRTIATDECELCINVACTGC
hide sequence
Ensembl Acc Id:
ENSRNOP00000012062 ⟸ ENSRNOT00000012062
RGD ID: 13693986 Promoter ID: EPDNEW_R4511 Type: multiple initiation site Name: Guca2b_1 Description: guanylate cyclase activator 2B SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 138,697,666 - 138,697,726 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2009-02-26
Guca2b
guanylate cyclase activator 2B
Guca2b
guanylate cyclase activator 2b (retina)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-22
Guca2b
guanylate cyclase activator 2b (retina)
Guca2b
guanylate cyclase activator 2b
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-12-14
Guca2b
guanylate cyclase activator 2b
guanylate cyclase activator 2B (uroguanylin)
Name updated
1299863 APPROVED
2004-12-02
guanylate cyclase activator 2B (uroguanylin)
Guca2b
uroguanylin
Name updated
1299863 APPROVED
2002-08-07
Guca2b
uroguanylin
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_expression
mRNA highly expressed in intestine, almost nonexistant in the colon
731150
gene_expression
mRNA also expressed in the lung, pancreas and kidney
728663
