Guca2b (guanylate cyclase activator 2B)

Advanced Search (OLGA)

Gene: Guca2b (guanylate cyclase activator 2B) Rattus norvegicus

Analyze

Symbol:

Guca2b

Name:

guanylate cyclase activator 2B

RGD ID:

620044

Description:

Predicted to enable guanylate cyclase activator activity. Involved in cGMP-mediated signaling. Predicted to be located in photoreceptor outer segment. Orthologous to human GUCA2B (guanylate cyclase activator 2B); PARTICIPATES IN calcium/calcium-mediated signaling pathway; INTERACTS WITH 3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine; 6-propyl-2-thiouracil; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

guanylate cyclase activator 2b (retina); guanylate cyclase activator 2B (uroguanylin); uroguanylin

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	138,532,160 - 138,534,210 (-)	NCBI		GRCr8
mRatBN7.2	5	133,246,891 - 133,248,941 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	133,246,909 - 133,248,966 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	135,975,549 - 135,977,599 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	137,731,991 - 137,734,041 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	137,752,591 - 137,754,641 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	138,695,591 - 138,697,641 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	138,695,591 - 138,697,641 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	142,497,885 - 142,499,935 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	140,237,184 - 140,239,234 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	140,242,411 - 140,244,482 (-)	NCBI
Celera	5	131,770,229 - 131,772,279 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Charcot-Marie-Tooth disease dominant intermediate C (ISO)

end stage renal disease (ISO)

nephrotic syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

calcidiol (EXP)

CGP 52608 (ISO)

choline (ISO)

chromium(6+) (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

diquat (ISO)

folic acid (ISO)

glyphosate (EXP)

indometacin (ISO)

L-methionine (ISO)

methylmercury(1+) (EXP)

pirinixic acid (EXP)

progesterone (ISO)

sodium fluoride (ISO)

tamoxifen (ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adipose tissue development (ISO)

body fluid secretion (ISO)

cGMP-mediated signaling (IDA)

energy homeostasis (ISO)

glucose homeostasis (ISO)

multicellular organism growth (ISO)

negative regulation of blood pressure (ISO)

reduction of food intake in response to dietary excess (ISO)

renal sodium ion absorption (ISO)

response to glucose (ISO)

Cellular Component

extracellular region (IEA)

photoreceptor outer segment (ISO)

Molecular Function

guanylate cyclase activator activity (IBA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

calcium/calcium-mediated signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Upregulation of rat intestinal uroguanylin mRNA by dietary zinc restriction.	Blanchard RK and Cousins RJ, Am J Physiol 1997 May;272(5 Pt 1):G972-8.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Purification, cDNA sequence, and tissue distribution of rat uroguanylin.	Li Z, etal., Regul Pept 1997 Jan 15;68(1):45-56.
5.	The diversity of calcium sensor proteins in the regulation of neuronal function.	McCue HV, etal., Cold Spring Harb Perspect Biol. 2010 Aug;2(8):a004085. doi: 10.1101/cshperspect.a004085. Epub 2010 Jul 28.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Uroguanylin gene expression in the alimentary tract and extra-gastrointestinal tissues.	Miyazato M, etal., FEBS Lett 1996 Dec 2;398(2-3):170-4.
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:14561709	PMID:16814407	PMID:18499760	PMID:18499761	PMID:21106860	PMID:22183407	PMID:22952280	PMID:23376485	PMID:23533145	PMID:27044258

Genomics

Comparative Map Data

Guca2b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	138,532,160 - 138,534,210 (-)	NCBI		GRCr8
mRatBN7.2	5	133,246,891 - 133,248,941 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	133,246,909 - 133,248,966 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	135,975,549 - 135,977,599 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	137,731,991 - 137,734,041 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	137,752,591 - 137,754,641 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	138,695,591 - 138,697,641 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	138,695,591 - 138,697,641 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	142,497,885 - 142,499,935 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	140,237,184 - 140,239,234 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	140,242,411 - 140,244,482 (-)	NCBI
Celera	5	131,770,229 - 131,772,279 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

GUCA2B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	42,153,410 - 42,155,820 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	42,153,410 - 42,155,820 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	42,619,081 - 42,621,491 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	42,391,679 - 42,394,082 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	42,288,184 - 42,290,588	NCBI
Celera	1	40,901,379 - 40,903,782 (+)	NCBI		Celera
Cytogenetic Map	1	p34.2	NCBI
HuRef	1	40,738,645 - 40,741,048 (+)	NCBI		HuRef
CHM1_1	1	42,736,196 - 42,738,599 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	42,024,047 - 42,026,457 (+)	NCBI		T2T-CHM13v2.0

Guca2b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	119,513,798 - 119,516,142 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	119,513,804 - 119,516,151 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	119,656,601 - 119,658,945 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	119,656,607 - 119,658,954 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	119,329,206 - 119,331,550 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	119,154,547 - 119,156,877 (-)	NCBI		MGSCv36	mm8
Celera	4	118,380,210 - 118,382,528 (-)	NCBI		Celera
Cytogenetic Map	4	D2.1	NCBI
cM Map	4	55.48	NCBI

Guca2b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955537	1,798,249 - 1,801,673 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955537	1,798,249 - 1,801,673 (+)	NCBI	ChiLan1.0	ChiLan1.0

GUCA2B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	184,656,603 - 184,659,049 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	183,798,643 - 183,801,089 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	41,452,722 - 41,455,192 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	42,832,809 - 42,835,202 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	42,832,196 - 42,835,425 (+)	Ensembl	panpan1.1		panPan2

GUCA2B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	1,094,283 - 1,096,605 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	1,094,276 - 1,096,688 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	1,351,322 - 1,353,606 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	1,181,767 - 1,184,052 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	1,181,761 - 1,184,098 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	1,086,868 - 1,089,152 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	1,148,603 - 1,150,888 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	1,163,515 - 1,165,799 (-)	NCBI		UU_Cfam_GSD_1.0

Guca2b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	57,807,471 - 57,809,709 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	23,632,781 - 23,634,496 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	23,632,836 - 23,634,330 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GUCA2B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	169,152,179 - 169,154,551 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	169,152,172 - 169,154,557 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

GUCA2B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	90,767,183 - 90,770,403 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	90,767,609 - 90,770,198 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	26,135,158 - 26,137,524 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Guca2b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624892	1,506,303 - 1,508,840 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624892	1,506,517 - 1,508,751 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Guca2b
5 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	82
Count of miRNA genes:	72
Interacting mature miRNAs:	75
Transcripts:	ENSRNOT00000012062
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
1300122	Wbc1	White blood cell count QTL 1	2.75		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	5	125392826	139989768	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	94858972	143070159	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	129132447	151006154	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	129132428	143070159	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	97570330	136479578	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	120740824	143608494	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
7394710	Emca12	Estrogen-induced mammary cancer QTL 12			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	124160767	133749643	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
631527	Tls1	T-lymphoma susceptibility QTL 1	0	0.001	thymus integrity trait (VT:0010555)	post-insult time to onset of T-cell lymphoma (CMO:0001907)	5	90450144	135450144	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat

Markers in Region

Ugn

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	133,246,937 - 133,247,781 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	138,695,638 - 138,696,481	NCBI	Rnor6.0
Rnor_5.0	5	142,497,932 - 142,498,775	UniSTS	Rnor5.0
RGSC_v3.4	5	140,237,231 - 140,238,074	UniSTS	RGSC3.4
Celera	5	131,770,276 - 131,771,119	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	2	12	45	56	63	39	20	39	3	130	36	40	45	49	24

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022284	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U41322	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U73898	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U75186	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000012062 ⟹ ENSRNOP00000012062

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	133,246,909 - 133,248,966 (-)	Ensembl
Rnor_6.0 Ensembl	5	138,695,591 - 138,697,641 (-)	Ensembl

RefSeq Acc Id:

NM_022284 ⟹ NP_071620

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	138,532,160 - 138,534,210 (-)	NCBI
mRatBN7.2	5	133,246,891 - 133,248,941 (-)	NCBI
Rnor_6.0	5	138,695,591 - 138,697,641 (-)	NCBI
Rnor_5.0	5	142,497,885 - 142,499,935 (-)	NCBI
RGSC_v3.4	5	140,237,184 - 140,239,234 (-)	RGD
Celera	5	131,770,229 - 131,772,279 (-)	RGD

Sequence:

show sequence

GCAGAAACCCAGAGGTGTGAGCTGGGAAGCCGGGCCATGTCAGGAAGCCAACTGTGGGCTGCTG
TACTCCTGCTGCTGGTGCTGCAGAGTGCCCAGGGTGTCTACATCAAGTACCATGGCTTCCAAGT
CCAGCTAGAATCGGTGAAGAAGCTGAATGAGTTGGAAGAGAAGCAGATGTCCGATCCCCAGCAG
CAGAAAAGTGGCCTCCTCCCCGATGTGTGCTACAACCCCGCCTTGCCCCTGGACCTCCAGCCTG
TTTGTGCATCCCAGGAAGCTGCCAGCACCTTCAAGGCCTTGAGGACCATTGCCACTGATGAATG
TGAGCTGTGTATAAATGTTGCCTGTACGGGCTGCTGATGAAATGACTCCAGACACCTACCCCCA
CAGCCTACCCTGCCCATACTTAGGTACCATTGACATAATTACCACCCTCCCAGCACAAATGGAT
CCATAGCAAGACAATATGGATGCAGAGCCGCCATATTTGGTCCCCAGGCAGCTGCACCGGAATA
AAAATGTTACCCGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_071620	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB18331	(Get FASTA)	NCBI Sequence Viewer
	AAB18760	(Get FASTA)	NCBI Sequence Viewer
	AAB61209	(Get FASTA)	NCBI Sequence Viewer
	EDL90106	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000012062.4
	ENSRNOP00055017380
	ENSRNOP00060022875
	ENSRNOP00065023651
GenBank Protein	P70668	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_071620 ⟸ NM_022284
- Peptide Label:	precursor
- UniProtKB:	P70668 (UniProtKB/Swiss-Prot), A6JZP7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSGSQLWAAVLLLLVLQSAQGVYIKYHGFQVQLESVKKLNELEEKQMSDPQQQKSGLLPDVCYN PALPLDLQPVCASQEAASTFKALRTIATDECELCINVACTGC hide sequence

Ensembl Acc Id:

ENSRNOP00000012062 ⟸ ENSRNOT00000012062

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P70668-F1-model_v2	AlphaFold	P70668	1-106	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693986

Promoter ID:

EPDNEW_R4511

Type:

multiple initiation site

Name:

Guca2b_1

Description:

guanylate cyclase activator 2B

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	138,697,666 - 138,697,726	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620044	AgrOrtholog
BioCyc Gene	G2FUF-40080	BioCyc
Ensembl Genes	ENSRNOG00000008979	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00055012588	UniProtKB/Swiss-Prot
	ENSRNOG00060016589	UniProtKB/Swiss-Prot
	ENSRNOG00065017803	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000012062.7	UniProtKB/Swiss-Prot
	ENSRNOT00055021465	UniProtKB/Swiss-Prot
	ENSRNOT00060028410	UniProtKB/Swiss-Prot
	ENSRNOT00065029780	UniProtKB/Swiss-Prot
Gene3D-CATH	3.90.1450.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Guanylin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Guanylin_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:64055	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	64055	ENTREZGENE
PANTHER	GUANYLATE CYCLASE ACTIVATOR 2B	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GUANYLIN FAMILY MEMBER	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
Pfam	Guanylin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Guca2b	PhenoGen
PIRSF	Guanylin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	GUANYLIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000008979	RatGTEx
	ENSRNOG00055012588	RatGTEx
	ENSRNOG00060016589	RatGTEx
	ENSRNOG00065017803	RatGTEx
Superfamily-SCOP	Proguanylin	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6JZP7	ENTREZGENE, UniProtKB/TrEMBL
	GUC2B_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-02-26	Guca2b	guanylate cyclase activator 2B	Guca2b	guanylate cyclase activator 2b (retina)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-22	Guca2b	guanylate cyclase activator 2b (retina)	Guca2b	guanylate cyclase activator 2b	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-12-14	Guca2b	guanylate cyclase activator 2b		guanylate cyclase activator 2B (uroguanylin)	Name updated	1299863	APPROVED
2004-12-02		guanylate cyclase activator 2B (uroguanylin)	Guca2b	uroguanylin	Name updated	1299863	APPROVED
2002-08-07	Guca2b	uroguanylin			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	mRNA highly expressed in intestine, almost nonexistant in the colon	731150
gene_expression	mRNA also expressed in the lung, pancreas and kidney	728663

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations